3OGAA

1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
134
Chain Sequence
AMRQRTIVCPLIQNDGCYLLCKMADGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRIKTYGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVKPEELALYDLNVATRHTLALKGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nucleoside triphosphatase nudI
publication title 1.75 Angstrom resolution crystal structure of a putative NTP pyrophosphohydrolase (yfaO) from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 38
structure length 134
sequence length 142
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3ogaA00
2I8UA 4YPRA 3X0JA 2A6TA 1VIUA 3X0IA 1K2EA 1V8TA 3A6VA 3SONA 5GHPA 2VNPA 3I7VA 1V8UA 2YVOA 1V8VA 2I6KA 3GRNA 4ZG0A 3BHOA 3O52A 3SHDA 4K6EA 1V8YA 3QSJA 1QVJA 1XSBA 3KVHA 3G0QA 2B0VA 1V8IA 4KG4A 1MUTA 2G74A 2O1CA 4JZSA 2XSQA 3Q2SA 2FVVA 5I8UA 1MQWA 5GHMA 2A8QA 1RRSA 4JZVA 3ACAA 1X84A 1HX3A 2YVPA 5FSOA 1V8MA 3GZ6A 5CFJA 1F3YA 3COUA 3O69A 3GZ5A 2DUKA 5IW5A 4S2YA 1XSCA 1RRQA 1PPWA 1KTGA 1K26A 1XSAA 4NFWA 2YVNA 1RYAA 3GWYA 5FSIA 1VHGA 3MDGA 2W4EA 4MPOA 1VCDA 1V8SA 1VK6A 3A6SA 2GT4A 3A6TA 5FSLA 1X83A 5GHNA 3X0LA 4YPHA 3FCMA 2KDVA 3U53A 1SOIA 3CNGA 1Q54A 1V8RA 4N1UA 3E57A 4S2WA 1PUSA 3F13A 3RH7A 4V14A 4JZUA 5DDGA 1G9QA 4C9XA 1MR2A 3ZR1A 1V8WA 3Q1PA 5ANVA 2G73A 1SZ3A 4ILQA 1SJYA 4KG3A 2O5FA 1NFZA 5FSKA 1PPXA 2O5WA 1KHZA 1NQZA 3R03A 2A8TA 2DHOA 1VRLA 1JRKA 2QJTA 2YVMA 3GZ8A 2FMLA 2GT2A 3FK9A 3BM4A 5C7QA 5IW4A 1JKNA 2PNYA 4KYXA 1OW2A 1TUMA 3MGMA 3FFUA 1U20A 1V8NA 5ANSA 5LPGA 3HHJA 2ICKA 3F6AA 1GA7A 1HZTA 2RRKA 2A8RA 3N9UA 2GB5A 3OGAA 4KTBA 1VIQA 3I7UA 5C8LA 3X0KA 3AC9A 3O8SA 3FJYA 4NFXA 1Q33A 5GHIA 3X0NA 1VC9A 3P6YA 4HVYA 1Q27A 1VC8A 2J8QA 1R67A 4S2XA 3GG6A 4YOQA 5GHOA 1SU2A 1PPVA 1MP2A 5ANTA 4JZTA 3O61A 3X0SA 2DSBA 2DSDA 4IJXA 5CFIA 2B2KA 3FSPA 1X51A 2I8TA 4HFQA 5GHJA 3L85A 5C7TA 4DYWA 3DUPA 3X0OA 3O6ZA 3Q4IA 2JVBA 2R5WA 2AZWA 5GHQA 3ID9A 3WHWA 2VNQA 2A8PA 2ICJA 3MDIA 3HYQA 5ANWA 1MQEA 1VHZA 1I9AA 3ZR0A 1PUQA 5ISYA 3I9XA 2A8SA 2KDWA 5DD4A 3DKUA 4C9WA 5FSNA 3Q93A 1PUNA 2B06A 5BONA 5DEQA 2YYHA 5HZXA 3X0PA 4S2VA 1IRYA 1NFSA 2Q9PA 3EESA 3EXQA 5FSMA 3X0QA 1PVFA 5ANUA 2CL3A 3N77A 1MK1A 1NQYA 3SMDA 2PQVA 3H95A 3X0MA 2FKBA 2QJOA 3EEUA 1KT9A 4ICKA 4N1TA 5BS6A 3BAPA 3J7Ye 1G0SA 3P5TA 3Q91A 2DSCA 3X0RA 5DPKA 3A6UA 1V8LA 3EF5A 2QKMB 3Q2TA 3MCFA
chains in the Genus database with same CATH superfamily
2I8UA 4YPRA 3X0JA 2A6TA 1VIUA 3X0IA 1K2EA 1V8TA 3A6VA 3SONA 5GHPA 2VNPA 3I7VA 1V8UA 2YVOA 1V8VA 2I6KA 3GRNA 4ZG0A 3BHOA 3O52A 3SHDA 4K6EA 1V8YA 3QSJA 1QVJA 1XSBA 3KVHA 3G0QA 2B0VA 1V8IA 4KG4A 1MUTA 2G74A 2O1CA 4JZSA 2XSQA 3Q2SA 2FVVA 5I8UA 1MQWA 5GHMA 2A8QA 1RRSA 4JZVA 2CZRA 3ACAA 1X84A 1HX3A 2YVPA 5FSOA 1V8MA 3GZ6A 5CFJA 1F3YA 3COUA 3O69A 3GZ5A 2DUKA 5IW5A 4S2YA 1XSCA 1RRQA 1PPWA 1KTGA 1K26A 1XSAA 4NFWA 2YVNA 1RYAA 3GWYA 5FSIA 1VHGA 3MDGA 2W4EA 4MPOA 1VCDA 1V8SA 1VK6A 3A6SA 2GT4A 3A6TA 5FSLA 1X83A 5GHNA 3X0LA 4YPHA 3FCMA 2KDVA 3U53A 1SOIA 3CNGA 1Q54A 1V8RA 4N1UA 3E57A 4S2WA 1PUSA 3F13A 3RH7A 4V14A 4JZUA 5DDGA 1G9QA 4C9XA 1MR2A 3ZR1A 1V8WA 3Q1PA 5ANVA 2G73A 1SZ3A 4ILQA 1SJYA 4KG3A 2O5FA 1NFZA 5FSKA 1PPXA 2O5WA 1KHZA 1NQZA 3R03A 2A8TA 2DHOA 1VRLA 1JRKA 2QJTA 2YVMA 3GZ8A 2FMLA 2GT2A 3FK9A 3BM4A 5C7QA 5IW4A 4J7HA 2PNYA 1JKNA 4KYXA 1OW2A 1TUMA 3MGMA 3FFUA 1U20A 1V8NA 5ANSA 5LPGA 3HHJA 2ICKA 3F6AA 1GA7A 1HZTA 2RRKA 2A8RA 3N9UA 2GB5A 3OGAA 4KTBA 1VIQA 3I7UA 5C8LA 3X0KA 3AC9A 3O8SA 3FJYA 4NFXA 1Q33A 5GHIA 3X0NA 1VC9A 3P6YA 4HVYA 1Q27A 1VC8A 2J8QA 1R67A 4S2XA 3GG6A 4YOQA 5GHOA 1SU2A 1PPVA 1MP2A 5ANTA 4JZTA 3O61A 3X0SA 2DSBA 2DSDA 4IJXA 5CFIA 2B2KA 3FSPA 1X51A 2I8TA 4HFQA 5GHJA 3L85A 5C7TA 4DYWA 3DUPA 3X0OA 3O6ZA 3Q4IA 2JVBA 2R5WA 2AZWA 5GHQA 3ID9A 3WHWA 2VNQA 2A8PA 2ICJA 4J7GA 3HYQA 3MDIA 5ANWA 1MQEA 1VHZA 1I9AA 3ZR0A 1PUQA 5ISYA 3I9XA 2A8SA 2KDWA 5DD4A 3DKUA 4C9WA 5FSNA 3Q93A 1PUNA 2B06A 5BONA 5DEQA 2YYHA 5HZXA 3X0PA 4S2VA 1IRYA 1NFSA 2Q9PA 3EESA 3EXQA 5FSMA 3X0QA 1PVFA 5ANUA 2CL3A 3N77A 1MK1A 1NQYA 3SMDA 2PQVA 3H95A 3X0MA 2FKBA 2QJOA 3EEUA 1KT9A 4ICKA 4N1TA 5BS6A 3BAPA 3J7Ye 1G0SA 3P5TA 3Q91A 2DSCA 3X0RA 5DPKA 3A6UA 1V8LA 3EF5A 2QKMB 3Q2TA 3MCFA
chains in the Genus database with same CATH topology
2I8UA 4YPRA 3X0JA 2A6TA 1VIUA 3X0IA 1K2EA 1V8TA 3A6VA 3SONA 5GHPA 2VNPA 3I7VA 1V8UA 2YVOA 1V8VA 2I6KA 3GRNA 4ZG0A 3BHOA 3O52A 3SHDA 4K6EA 1V8YA 3QSJA 1QVJA 1XSBA 3KVHA 3G0QA 2B0VA 1V8IA 4KG4A 1MUTA 2G74A 2O1CA 4JZSA 2XSQA 3Q2SA 2FVVA 5I8UA 1MQWA 5GHMA 2A8QA 1RRSA 4JZVA 2CZRA 3ACAA 1X84A 1HX3A 2YVPA 5FSOA 1V8MA 3GZ6A 5CFJA 1F3YA 3COUA 3O69A 3GZ5A 2DUKA 5IW5A 4S2YA 1XSCA 1RRQA 1PPWA 1KTGA 1K26A 1XSAA 4NFWA 2YVNA 1RYAA 3GWYA 5FSIA 1VHGA 3MDGA 2W4EA 4MPOA 1VCDA 1V8SA 1VK6A 3A6SA 2GT4A 3A6TA 5FSLA 1X83A 5GHNA 3X0LA 4YPHA 3FCMA 2KDVA 3U53A 1SOIA 3CNGA 1Q54A 1V8RA 4N1UA 3E57A 4S2WA 1PUSA 3F13A 3RH7A 4V14A 4JZUA 5DDGA 1G9QA 4C9XA 1MR2A 3ZR1A 1V8WA 3Q1PA 5ANVA 2G73A 1SZ3A 4ILQA 1SJYA 4KG3A 2O5FA 1NFZA 5FSKA 1PPXA 2O5WA 1KHZA 1NQZA 3R03A 2A8TA 2DHOA 1VRLA 1JRKA 2QJTA 2YVMA 3GZ8A 2FMLA 2GT2A 3FK9A 3BM4A 5C7QA 5IW4A 4J7HA 2PNYA 1JKNA 4KYXA 1OW2A 1TUMA 3MGMA 3FFUA 1U20A 1V8NA 5ANSA 5LPGA 3HHJA 2ICKA 3F6AA 1GA7A 1HZTA 2RRKA 2A8RA 3N9UA 2GB5A 3OGAA 4KTBA 1VIQA 3I7UA 5C8LA 3X0KA 3AC9A 3O8SA 3FJYA 4NFXA 1Q33A 5GHIA 3X0NA 1VC9A 3P6YA 4HVYA 1Q27A 1VC8A 2J8QA 1R67A 4S2XA 3GG6A 4YOQA 5GHOA 1SU2A 1PPVA 1MP2A 5ANTA 4JZTA 3O61A 3X0SA 2DSBA 2DSDA 4IJXA 5CFIA 2B2KA 3FSPA 1X51A 2I8TA 4HFQA 5GHJA 3L85A 5C7TA 4DYWA 3DUPA 3X0OA 3O6ZA 3Q4IA 2JVBA 2R5WA 2AZWA 5GHQA 3ID9A 3WHWA 2VNQA 2A8PA 2ICJA 4J7GA 3HYQA 3MDIA 5ANWA 1MQEA 1VHZA 1I9AA 3ZR0A 1PUQA 5ISYA 3I9XA 2A8SA 2KDWA 5DD4A 3DKUA 4C9WA 5FSNA 3Q93A 1PUNA 2B06A 5BONA 5DEQA 2YYHA 5HZXA 3X0PA 4S2VA 1IRYA 1NFSA 2Q9PA 3EESA 3EXQA 5FSMA 3X0QA 1PVFA 5ANUA 2CL3A 3N77A 1MK1A 1NQYA 3SMDA 2PQVA 3H95A 3X0MA 2FKBA 2QJOA 3EEUA 1KT9A 4ICKA 4N1TA 5BS6A 3BAPA 3J7Ye 1G0SA 3P5TA 3Q91A 2DSCA 3X0RA 5DPKA 3A6UA 1V8LA 3EF5A 2QKMB 3Q2TA 3MCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I8U A;  4YPR A;  3X0J A;  2A6T A;  1VIU A;  3X0I A;  1K2E A;  1V8T A;  3A6V A;  3SON A;  5GHP A;  2VNP A;  3I7V A;  1V8U A;  2YVO A;  1V8V A;  2I6K A;  3GRN A;  4ZG0 A;  3BHO A;  3O52 A;  3SHD A;  4K6E A;  1V8Y A;  3QSJ A;  1QVJ A;  1XSB A;  3KVH A;  3G0Q A;  2B0V A;  1V8I A;  4KG4 A;  1MUT A;  2G74 A;  2O1C A;  4JZS A;  2XSQ A;  3Q2S A;  2FVV A;  5I8U A;  1MQW A;  5GHM A;  2A8Q A;  1RRS A;  4JZV A;  3ACA A;  1X84 A;  1HX3 A;  2YVP A;  5FSO A;  1V8M A;  3GZ6 A;  5CFJ A;  1F3Y A;  3COU A;  3O69 A;  3GZ5 A;  2DUK A;  5IW5 A;  4S2Y A;  1XSC A;  1RRQ A;  1PPW A;  1KTG A;  1K26 A;  1XSA A;  4NFW A;  2YVN A;  1RYA A;  3GWY A;  5FSI A;  1VHG A;  3MDG A;  2W4E A;  4MPO A;  1VCD A;  1V8S A;  1VK6 A;  3A6S A;  2GT4 A;  3A6T A;  5FSL A;  1X83 A;  5GHN A;  3X0L A;  4YPH A;  3FCM A;  2KDV A;  3U53 A;  1SOI A;  3CNG A;  1Q54 A;  1V8R A;  4N1U A;  3E57 A;  4S2W A;  1PUS A;  3F13 A;  3RH7 A;  4V14 A;  4JZU A;  5DDG A;  1G9Q A;  4C9X A;  1MR2 A;  3ZR1 A;  1V8W A;  3Q1P A;  5ANV A;  2G73 A;  1SZ3 A;  4ILQ A;  1SJY A;  4KG3 A;  2O5F A;  1NFZ A;  5FSK A;  1PPX A;  2O5W A;  1KHZ A;  1NQZ A;  3R03 A;  2A8T A;  2DHO A;  1VRL A;  1JRK A;  2QJT A;  2YVM A;  3GZ8 A;  2FML A;  2GT2 A;  3FK9 A;  3BM4 A;  5C7Q A;  5IW4 A;  1JKN A;  2PNY A;  4KYX A;  1OW2 A;  1TUM A;  3MGM A;  3FFU A;  1U20 A;  1V8N A;  5ANS A;  5LPG A;  3HHJ A;  2ICK A;  3F6A A;  1GA7 A;  1HZT A;  2RRK A;  2A8R A;  3N9U A;  2GB5 A;  3OGA A;  4KTB A;  1VIQ A;  3I7U A;  5C8L A;  3X0K A;  3AC9 A;  3O8S A;  3FJY A;  4NFX A;  1Q33 A;  5GHI A;  3X0N A;  1VC9 A;  3P6Y A;  4HVY A;  1Q27 A;  1VC8 A;  2J8Q A;  1R67 A;  4S2X A;  3GG6 A;  4YOQ A;  5GHO A;  1SU2 A;  1PPV A;  1MP2 A;  5ANT A;  4JZT A;  3O61 A;  3X0S A;  2DSB A;  2DSD A;  4IJX A;  5CFI A;  2B2K A;  3FSP A;  1X51 A;  2I8T A;  4HFQ A;  5GHJ A;  3L85 A;  5C7T A;  4DYW A;  3DUP A;  3X0O A;  3O6Z A;  3Q4I A;  2JVB A;  2R5W A;  2AZW A;  5GHQ A;  3ID9 A;  3WHW A;  2VNQ A;  2A8P A;  2ICJ A;  3MDI A;  3HYQ A;  5ANW A;  1MQE A;  1VHZ A;  1I9A A;  3ZR0 A;  1PUQ A;  5ISY A;  3I9X A;  2A8S A;  2KDW A;  5DD4 A;  3DKU A;  4C9W A;  5FSN A;  3Q93 A;  1PUN A;  2B06 A;  5BON A;  5DEQ A;  2YYH A;  5HZX A;  3X0P A;  4S2V A;  1IRY A;  1NFS A;  2Q9P A;  3EES A;  3EXQ A;  5FSM A;  3X0Q A;  1PVF A;  5ANU A;  2CL3 A;  3N77 A;  1MK1 A;  1NQY A;  3SMD A;  2PQV A;  3H95 A;  3X0M A;  2FKB A;  2QJO A;  3EEU A;  1KT9 A;  4ICK A;  4N1T A;  5BS6 A;  3BAP A;  3J7Y e;  1G0S A;  3P5T A;  3Q91 A;  2DSC A;  3X0R A;  5DPK A;  3A6U A;  1V8L A;  3EF5 A;  2QKM B;  3Q2T A;  3MCF A; 
#chains in the Genus database with same CATH topology
 2I8U A;  4YPR A;  3X0J A;  2A6T A;  1VIU A;  3X0I A;  1K2E A;  1V8T A;  3A6V A;  3SON A;  5GHP A;  2VNP A;  3I7V A;  1V8U A;  2YVO A;  1V8V A;  2I6K A;  3GRN A;  4ZG0 A;  3BHO A;  3O52 A;  3SHD A;  4K6E A;  1V8Y A;  3QSJ A;  1QVJ A;  1XSB A;  3KVH A;  3G0Q A;  2B0V A;  1V8I A;  4KG4 A;  1MUT A;  2G74 A;  2O1C A;  4JZS A;  2XSQ A;  3Q2S A;  2FVV A;  5I8U A;  1MQW A;  5GHM A;  2A8Q A;  1RRS A;  4JZV A;  2CZR A;  3ACA A;  1X84 A;  1HX3 A;  2YVP A;  5FSO A;  1V8M A;  3GZ6 A;  5CFJ A;  1F3Y A;  3COU A;  3O69 A;  3GZ5 A;  2DUK A;  5IW5 A;  4S2Y A;  1XSC A;  1RRQ A;  1PPW A;  1KTG A;  1K26 A;  1XSA A;  4NFW A;  2YVN A;  1RYA A;  3GWY A;  5FSI A;  1VHG A;  3MDG A;  2W4E A;  4MPO A;  1VCD A;  1V8S A;  1VK6 A;  3A6S A;  2GT4 A;  3A6T A;  5FSL A;  1X83 A;  5GHN A;  3X0L A;  4YPH A;  3FCM A;  2KDV A;  3U53 A;  1SOI A;  3CNG A;  1Q54 A;  1V8R A;  4N1U A;  3E57 A;  4S2W A;  1PUS A;  3F13 A;  3RH7 A;  4V14 A;  4JZU A;  5DDG A;  1G9Q A;  4C9X A;  1MR2 A;  3ZR1 A;  1V8W A;  3Q1P A;  5ANV A;  2G73 A;  1SZ3 A;  4ILQ A;  1SJY A;  4KG3 A;  2O5F A;  1NFZ A;  5FSK A;  1PPX A;  2O5W A;  1KHZ A;  1NQZ A;  3R03 A;  2A8T A;  2DHO A;  1VRL A;  1JRK A;  2QJT A;  2YVM A;  3GZ8 A;  2FML A;  2GT2 A;  3FK9 A;  3BM4 A;  5C7Q A;  5IW4 A;  4J7H A;  2PNY A;  1JKN A;  4KYX A;  1OW2 A;  1TUM A;  3MGM A;  3FFU A;  1U20 A;  1V8N A;  5ANS A;  5LPG A;  3HHJ A;  2ICK A;  3F6A A;  1GA7 A;  1HZT A;  2RRK A;  2A8R A;  3N9U A;  2GB5 A;  3OGA A;  4KTB A;  1VIQ A;  3I7U A;  5C8L A;  3X0K A;  3AC9 A;  3O8S A;  3FJY A;  4NFX A;  1Q33 A;  5GHI A;  3X0N A;  1VC9 A;  3P6Y A;  4HVY A;  1Q27 A;  1VC8 A;  2J8Q A;  1R67 A;  4S2X A;  3GG6 A;  4YOQ A;  5GHO A;  1SU2 A;  1PPV A;  1MP2 A;  5ANT A;  4JZT A;  3O61 A;  3X0S A;  2DSB A;  2DSD A;  4IJX A;  5CFI A;  2B2K A;  3FSP A;  1X51 A;  2I8T A;  4HFQ A;  5GHJ A;  3L85 A;  5C7T A;  4DYW A;  3DUP A;  3X0O A;  3O6Z A;  3Q4I A;  2JVB A;  2R5W A;  2AZW A;  5GHQ A;  3ID9 A;  3WHW A;  2VNQ A;  2A8P A;  2ICJ A;  4J7G A;  3HYQ A;  3MDI A;  5ANW A;  1MQE A;  1VHZ A;  1I9A A;  3ZR0 A;  1PUQ A;  5ISY A;  3I9X A;  2A8S A;  2KDW A;  5DD4 A;  3DKU A;  4C9W A;  5FSN A;  3Q93 A;  1PUN A;  2B06 A;  5BON A;  5DEQ A;  2YYH A;  5HZX A;  3X0P A;  4S2V A;  1IRY A;  1NFS A;  2Q9P A;  3EES A;  3EXQ A;  5FSM A;  3X0Q A;  1PVF A;  5ANU A;  2CL3 A;  3N77 A;  1MK1 A;  1NQY A;  3SMD A;  2PQV A;  3H95 A;  3X0M A;  2FKB A;  2QJO A;  3EEU A;  1KT9 A;  4ICK A;  4N1T A;  5BS6 A;  3BAP A;  3J7Y e;  1G0S A;  3P5T A;  3Q91 A;  2DSC A;  3X0R A;  5DPK A;  3A6U A;  1V8L A;  3EF5 A;  2QKM B;  3Q2T A;  3MCF A; 
#chains in the Genus database with same CATH homology
 2I8U A;  4YPR A;  3X0J A;  2A6T A;  1VIU A;  3X0I A;  1K2E A;  1V8T A;  3A6V A;  3SON A;  5GHP A;  2VNP A;  3I7V A;  1V8U A;  2YVO A;  1V8V A;  2I6K A;  3GRN A;  4ZG0 A;  3BHO A;  3O52 A;  3SHD A;  4K6E A;  1V8Y A;  3QSJ A;  1QVJ A;  1XSB A;  3KVH A;  3G0Q A;  2B0V A;  1V8I A;  4KG4 A;  1MUT A;  2G74 A;  2O1C A;  4JZS A;  2XSQ A;  3Q2S A;  2FVV A;  5I8U A;  1MQW A;  5GHM A;  2A8Q A;  1RRS A;  4JZV A;  2CZR A;  3ACA A;  1X84 A;  1HX3 A;  2YVP A;  5FSO A;  1V8M A;  3GZ6 A;  5CFJ A;  1F3Y A;  3COU A;  3O69 A;  3GZ5 A;  2DUK A;  5IW5 A;  4S2Y A;  1XSC A;  1RRQ A;  1PPW A;  1KTG A;  1K26 A;  1XSA A;  4NFW A;  2YVN A;  1RYA A;  3GWY A;  5FSI A;  1VHG A;  3MDG A;  2W4E A;  4MPO A;  1VCD A;  1V8S A;  1VK6 A;  3A6S A;  2GT4 A;  3A6T A;  5FSL A;  1X83 A;  5GHN A;  3X0L A;  4YPH A;  3FCM A;  2KDV A;  3U53 A;  1SOI A;  3CNG A;  1Q54 A;  1V8R A;  4N1U A;  3E57 A;  4S2W A;  1PUS A;  3F13 A;  3RH7 A;  4V14 A;  4JZU A;  5DDG A;  1G9Q A;  4C9X A;  1MR2 A;  3ZR1 A;  1V8W A;  3Q1P A;  5ANV A;  2G73 A;  1SZ3 A;  4ILQ A;  1SJY A;  4KG3 A;  2O5F A;  1NFZ A;  5FSK A;  1PPX A;  2O5W A;  1KHZ A;  1NQZ A;  3R03 A;  2A8T A;  2DHO A;  1VRL A;  1JRK A;  2QJT A;  2YVM A;  3GZ8 A;  2FML A;  2GT2 A;  3FK9 A;  3BM4 A;  5C7Q A;  5IW4 A;  4J7H A;  2PNY A;  1JKN A;  4KYX A;  1OW2 A;  1TUM A;  3MGM A;  3FFU A;  1U20 A;  1V8N A;  5ANS A;  5LPG A;  3HHJ A;  2ICK A;  3F6A A;  1GA7 A;  1HZT A;  2RRK A;  2A8R A;  3N9U A;  2GB5 A;  3OGA A;  4KTB A;  1VIQ A;  3I7U A;  5C8L A;  3X0K A;  3AC9 A;  3O8S A;  3FJY A;  4NFX A;  1Q33 A;  5GHI A;  3X0N A;  1VC9 A;  3P6Y A;  4HVY A;  1Q27 A;  1VC8 A;  2J8Q A;  1R67 A;  4S2X A;  3GG6 A;  4YOQ A;  5GHO A;  1SU2 A;  1PPV A;  1MP2 A;  5ANT A;  4JZT A;  3O61 A;  3X0S A;  2DSB A;  2DSD A;  4IJX A;  5CFI A;  2B2K A;  3FSP A;  1X51 A;  2I8T A;  4HFQ A;  5GHJ A;  3L85 A;  5C7T A;  4DYW A;  3DUP A;  3X0O A;  3O6Z A;  3Q4I A;  2JVB A;  2R5W A;  2AZW A;  5GHQ A;  3ID9 A;  3WHW A;  2VNQ A;  2A8P A;  2ICJ A;  4J7G A;  3HYQ A;  3MDI A;  5ANW A;  1MQE A;  1VHZ A;  1I9A A;  3ZR0 A;  1PUQ A;  5ISY A;  3I9X A;  2A8S A;  2KDW A;  5DD4 A;  3DKU A;  4C9W A;  5FSN A;  3Q93 A;  1PUN A;  2B06 A;  5BON A;  5DEQ A;  2YYH A;  5HZX A;  3X0P A;  4S2V A;  1IRY A;  1NFS A;  2Q9P A;  3EES A;  3EXQ A;  5FSM A;  3X0Q A;  1PVF A;  5ANU A;  2CL3 A;  3N77 A;  1MK1 A;  1NQY A;  3SMD A;  2PQV A;  3H95 A;  3X0M A;  2FKB A;  2QJO A;  3EEU A;  1KT9 A;  4ICK A;  4N1T A;  5BS6 A;  3BAP A;  3J7Y e;  1G0S A;  3P5T A;  3Q91 A;  2DSC A;  3X0R A;  5DPK A;  3A6U A;  1V8L A;  3EF5 A;  2QKM B;  3Q2T A;  3MCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...