3OGAA

1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
134
Chain Sequence
AMRQRTIVCPLIQNDGCYLLCKMADGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRIKTYGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVKPEELALYDLNVATRHTLALKGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside triphosphatase nudI
publication title 1.75 Angstrom resolution crystal structure of a putative NTP pyrophosphohydrolase (yfaO) from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Hydrolase
total genus 38
structure length 134
sequence length 142
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3ogaA00
1VC9A 2A8PA 4ILQA 4YOQA 5GHOA 1V8NA 1KHZA 1X51A 1Q33A 2KDVA 3A6VA 2CL3A 1MQEA 3EEUA 3GWYA 3WHWA 3Q93A 4S2YA 3O69A 1JRKA 1G0SA 4JZSA 1XSBA 1MK1A 2PNYA 3AC9A 3MCFA 5C7TA 1RRQA 5LPGA 3DKUA 4HVYA 2O1CA 2A8RA 4YPHA 1K26A 2W4EA 3R03A 1X84A 3GZ6A 2QJTA 3GZ5A 3COUA 2AZWA 4N1UA 1V8WA 4NFWA 3HYQA 1I9AA 1SZ3A 4C9WA 3EESA 1OW2A 4HFQA 1V8UA 4S2WA 2G73A 2R5WA 1VC8A 5IW5A 1SOIA 1MQWA 1GA7A 1PVFA 1TUMA 1VCDA 2B0VA 2GB5A 3EXQA 3I9XA 3OGAA 3Q2SA 5FSLA 5HZXA 4JZUA 3Q4IA 3SHDA 3X0NA 3O61A 3O8SA 5GHQA 5ANWA 1NFSA 1VIQA 1RRSA 4N1TA 3Q2TA 1Q27A 2B2KA 1VIUA 1R67A 1U20A 2ICKA 3Q1PA 5GHIA 1V8SA 1PPWA 4ZG0A 5ISYA 3Q91A 5ANTA 2A8QA 2YVMA 3N9UA 4S2XA 5GHNA 3I7VA 1VK6A 3F13A 5C8LA 2FMLA 3HHJA 2FVVA 3H95A 4S2VA 5DD4A 2DSBA 1V8TA 1NQZA 3P6YA 2I8UA 1XSCA 2GT2A 2VNPA 1K2EA 2I6KA 3FFUA 4C9XA 5ANUA 3FJYA 3BHOA 1IRYA 4K6EA 1RYAA 3X0RA 2G74A 3I7UA 2PQVA 1HX3A 5ANSA 5IW4A 3F6AA 4KG4A 2XSQA 3EF5A 2RRKA 4JZTA 5GHJA 5FSMA 3X0OA 1PUSA 3SMDA 1SU2A 5BONA 3GZ8A 1PPVA 1MUTA 5GHPA 1PPXA 2I8TA 2QJOA 5CFJA 3X0MA 4DYWA 3O6ZA 2YVNA 1NFZA 5ANVA 5FSKA 3X0KA 3FSPA 3A6SA 1JKNA 5I8UA 3X0IA 3KVHA 3FCMA 3BAPA 5FSOA 2DSCA 2DUKA 4V14A 1G9QA 2O5FA 3DUPA 3X0QA 3L85A 3ID9A 3MGMA 1VHGA 3SONA 4JZVA 1V8VA 1MP2A 2ICJA 1VRLA 4IJXA 1PUNA 1F3YA 1X83A 2A6TA 2Q9PA 1KT9A 3MDGA 2J8QA 5FSNA 4NFXA 3MDIA 2O5WA 2YVOA 3GG6A 1NQYA 3X0JA 3X0LA 2QKMB 1V8LA 1HZTA 3E57A 2A8SA 3ZR0A 3ZR1A 5GHMA 5BS6A 3QSJA 2A8TA 2DSDA 3A6TA 1Q54A 1QVJA 2YVPA 4MPOA 2GT4A 5FSIA 5C7QA 1V8IA 4YPRA 4KYXA 2B06A 3J7Ye 1SJYA 1PUQA 2YYHA 3CNGA 3P5TA 2KDWA 3BM4A 3FK9A 4KG3A 5DDGA 1XSAA 3G0QA 3X0SA 1KTGA 2FKBA 2DHOA 5DPKA 3ACAA 3N77A 2JVBA 3RH7A 2VNQA 5DEQA 4KTBA 3O52A 1V8MA 3GRNA 1V8YA 4ICKA 3X0PA 5CFIA 1V8RA 1VHZA 3A6UA 1MR2A 3U53A
chains in the Genus database with same CATH superfamily
1VC9A 2A8PA 4ILQA 4YOQA 5GHOA 1V8NA 1KHZA 1X51A 1Q33A 2KDVA 3A6VA 2CL3A 1MQEA 3EEUA 3GWYA 3WHWA 3Q93A 4S2YA 3O69A 1JRKA 1G0SA 4JZSA 1XSBA 1MK1A 2PNYA 3AC9A 3MCFA 5C7TA 1RRQA 5LPGA 3DKUA 4HVYA 2O1CA 2A8RA 4YPHA 1K26A 2W4EA 3R03A 1X84A 3GZ6A 2QJTA 3GZ5A 3COUA 2AZWA 4N1UA 1V8WA 4NFWA 3HYQA 1I9AA 1SZ3A 4C9WA 3EESA 1OW2A 4HFQA 1V8UA 4J7GA 2G73A 2R5WA 4S2WA 1VC8A 5IW5A 1SOIA 1MQWA 1GA7A 1PVFA 1TUMA 1VCDA 2B0VA 2GB5A 3EXQA 3I9XA 3OGAA 3Q2SA 5FSLA 5HZXA 4JZUA 3Q4IA 3SHDA 3X0NA 3O61A 3O8SA 5GHQA 5ANWA 1NFSA 1VIQA 1RRSA 4N1TA 3Q2TA 1Q27A 2B2KA 1VIUA 1R67A 1U20A 2ICKA 3Q1PA 5GHIA 1V8SA 1PPWA 4ZG0A 5ISYA 3Q91A 5ANTA 2A8QA 2YVMA 3N9UA 4S2XA 5GHNA 3I7VA 1VK6A 3F13A 5C8LA 2FMLA 3HHJA 2FVVA 3H95A 4S2VA 5DD4A 2DSBA 1V8TA 1NQZA 3P6YA 2I8UA 1XSCA 2GT2A 2VNPA 1K2EA 2CZRA 2I6KA 3FFUA 4C9XA 5ANUA 3FJYA 3BHOA 1IRYA 4K6EA 1RYAA 3X0RA 2G74A 4J7HA 3I7UA 2PQVA 1HX3A 5ANSA 5IW4A 3F6AA 4KG4A 2XSQA 3EF5A 2RRKA 4JZTA 5GHJA 5FSMA 3X0OA 1PUSA 3SMDA 1SU2A 5BONA 3GZ8A 1PPVA 1MUTA 5GHPA 1PPXA 2I8TA 2QJOA 5CFJA 3X0MA 4DYWA 3O6ZA 2YVNA 1NFZA 5ANVA 5FSKA 3X0KA 3FSPA 3A6SA 1JKNA 5I8UA 3X0IA 3KVHA 3FCMA 3BAPA 5FSOA 2DSCA 2DUKA 4V14A 1G9QA 2O5FA 3DUPA 3X0QA 3L85A 3ID9A 3MGMA 1VHGA 3SONA 4JZVA 1V8VA 1MP2A 2ICJA 1VRLA 4IJXA 1PUNA 1F3YA 1X83A 2A6TA 2Q9PA 1KT9A 3MDGA 2J8QA 5FSNA 4NFXA 3MDIA 2O5WA 2YVOA 3GG6A 1NQYA 3X0JA 3X0LA 2QKMB 1V8LA 1HZTA 3E57A 2A8SA 3ZR0A 3ZR1A 5GHMA 5BS6A 3QSJA 2A8TA 2DSDA 3A6TA 1Q54A 1QVJA 2YVPA 4MPOA 2GT4A 5FSIA 5C7QA 1V8IA 4YPRA 4KYXA 2B06A 3J7Ye 1SJYA 1PUQA 2YYHA 3CNGA 3P5TA 2KDWA 3BM4A 3FK9A 4KG3A 5DDGA 1XSAA 3G0QA 3X0SA 1KTGA 2FKBA 2DHOA 5DPKA 3ACAA 3N77A 2JVBA 3RH7A 2VNQA 5DEQA 4KTBA 3O52A 1V8MA 3GRNA 1V8YA 4ICKA 3X0PA 5CFIA 1V8RA 1VHZA 3A6UA 1MR2A 3U53A
chains in the Genus database with same CATH topology
1VC9A 2A8PA 4ILQA 4YOQA 5GHOA 1V8NA 1KHZA 1X51A 1Q33A 2KDVA 3A6VA 2CL3A 1MQEA 3EEUA 3GWYA 3WHWA 3Q93A 4S2YA 3O69A 1JRKA 1G0SA 4JZSA 1XSBA 1MK1A 2PNYA 3AC9A 3MCFA 5C7TA 1RRQA 5LPGA 3DKUA 4HVYA 2O1CA 2A8RA 4YPHA 1K26A 2W4EA 3R03A 1X84A 3GZ6A 2QJTA 3GZ5A 3COUA 2AZWA 4N1UA 1V8WA 4NFWA 3HYQA 1I9AA 1SZ3A 4C9WA 3EESA 1OW2A 4HFQA 1V8UA 4J7GA 2G73A 2R5WA 4S2WA 1VC8A 5IW5A 1SOIA 1MQWA 1GA7A 1PVFA 1TUMA 1VCDA 2B0VA 2GB5A 3EXQA 3I9XA 3OGAA 3Q2SA 5FSLA 5HZXA 4JZUA 3Q4IA 3SHDA 3X0NA 3O61A 3O8SA 5GHQA 5ANWA 1NFSA 1VIQA 1RRSA 4N1TA 3Q2TA 1Q27A 2B2KA 1VIUA 1R67A 1U20A 2ICKA 3Q1PA 5GHIA 1V8SA 1PPWA 4ZG0A 5ISYA 3Q91A 5ANTA 2A8QA 2YVMA 3N9UA 4S2XA 5GHNA 3I7VA 1VK6A 3F13A 5C8LA 2FMLA 3HHJA 2FVVA 3H95A 4S2VA 5DD4A 2DSBA 1V8TA 1NQZA 3P6YA 2I8UA 1XSCA 2GT2A 2VNPA 1K2EA 2CZRA 2I6KA 3FFUA 4C9XA 5ANUA 3FJYA 3BHOA 1IRYA 4K6EA 1RYAA 3X0RA 2G74A 4J7HA 3I7UA 2PQVA 1HX3A 5ANSA 5IW4A 3F6AA 4KG4A 2XSQA 3EF5A 2RRKA 4JZTA 5GHJA 5FSMA 3X0OA 1PUSA 3SMDA 1SU2A 5BONA 3GZ8A 1PPVA 1MUTA 5GHPA 1PPXA 2I8TA 2QJOA 5CFJA 3X0MA 4DYWA 3O6ZA 2YVNA 1NFZA 5ANVA 5FSKA 3X0KA 3FSPA 3A6SA 1JKNA 5I8UA 3X0IA 3KVHA 3FCMA 3BAPA 5FSOA 2DSCA 2DUKA 4V14A 1G9QA 2O5FA 3DUPA 3X0QA 3L85A 3ID9A 3MGMA 1VHGA 3SONA 4JZVA 1V8VA 1MP2A 2ICJA 1VRLA 4IJXA 1PUNA 1F3YA 1X83A 2A6TA 2Q9PA 1KT9A 3MDGA 2J8QA 5FSNA 4NFXA 3MDIA 2O5WA 2YVOA 3GG6A 1NQYA 3X0JA 3X0LA 2QKMB 1V8LA 1HZTA 3E57A 2A8SA 3ZR0A 3ZR1A 5GHMA 5BS6A 3QSJA 2A8TA 2DSDA 3A6TA 1Q54A 1QVJA 2YVPA 4MPOA 2GT4A 5FSIA 5C7QA 1V8IA 4YPRA 4KYXA 2B06A 3J7Ye 1SJYA 1PUQA 2YYHA 3CNGA 3P5TA 2KDWA 3BM4A 3FK9A 4KG3A 5DDGA 1XSAA 3G0QA 3X0SA 1KTGA 2FKBA 2DHOA 5DPKA 3ACAA 3N77A 2JVBA 3RH7A 2VNQA 5DEQA 4KTBA 3O52A 1V8MA 3GRNA 1V8YA 4ICKA 3X0PA 5CFIA 1V8RA 1VHZA 3A6UA 1MR2A 3U53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VC9 A;  2A8P A;  4ILQ A;  4YOQ A;  5GHO A;  1V8N A;  1KHZ A;  1X51 A;  1Q33 A;  2KDV A;  3A6V A;  2CL3 A;  1MQE A;  3EEU A;  3GWY A;  3WHW A;  3Q93 A;  4S2Y A;  3O69 A;  1JRK A;  1G0S A;  4JZS A;  1XSB A;  1MK1 A;  2PNY A;  3AC9 A;  3MCF A;  5C7T A;  1RRQ A;  5LPG A;  3DKU A;  4HVY A;  2O1C A;  2A8R A;  4YPH A;  1K26 A;  2W4E A;  3R03 A;  1X84 A;  3GZ6 A;  2QJT A;  3GZ5 A;  3COU A;  2AZW A;  4N1U A;  1V8W A;  4NFW A;  3HYQ A;  1I9A A;  1SZ3 A;  4C9W A;  3EES A;  1OW2 A;  4HFQ A;  1V8U A;  4S2W A;  2G73 A;  2R5W A;  1VC8 A;  5IW5 A;  1SOI A;  1MQW A;  1GA7 A;  1PVF A;  1TUM A;  1VCD A;  2B0V A;  2GB5 A;  3EXQ A;  3I9X A;  3OGA A;  3Q2S A;  5FSL A;  5HZX A;  4JZU A;  3Q4I A;  3SHD A;  3X0N A;  3O61 A;  3O8S A;  5GHQ A;  5ANW A;  1NFS A;  1VIQ A;  1RRS A;  4N1T A;  3Q2T A;  1Q27 A;  2B2K A;  1VIU A;  1R67 A;  1U20 A;  2ICK A;  3Q1P A;  5GHI A;  1V8S A;  1PPW A;  4ZG0 A;  5ISY A;  3Q91 A;  5ANT A;  2A8Q A;  2YVM A;  3N9U A;  4S2X A;  5GHN A;  3I7V A;  1VK6 A;  3F13 A;  5C8L A;  2FML A;  3HHJ A;  2FVV A;  3H95 A;  4S2V A;  5DD4 A;  2DSB A;  1V8T A;  1NQZ A;  3P6Y A;  2I8U A;  1XSC A;  2GT2 A;  2VNP A;  1K2E A;  2I6K A;  3FFU A;  4C9X A;  5ANU A;  3FJY A;  3BHO A;  1IRY A;  4K6E A;  1RYA A;  3X0R A;  2G74 A;  3I7U A;  2PQV A;  1HX3 A;  5ANS A;  5IW4 A;  3F6A A;  4KG4 A;  2XSQ A;  3EF5 A;  2RRK A;  4JZT A;  5GHJ A;  5FSM A;  3X0O A;  1PUS A;  3SMD A;  1SU2 A;  5BON A;  3GZ8 A;  1PPV A;  1MUT A;  5GHP A;  1PPX A;  2I8T A;  2QJO A;  5CFJ A;  3X0M A;  4DYW A;  3O6Z A;  2YVN A;  1NFZ A;  5ANV A;  5FSK A;  3X0K A;  3FSP A;  3A6S A;  1JKN A;  5I8U A;  3X0I A;  3KVH A;  3FCM A;  3BAP A;  5FSO A;  2DSC A;  2DUK A;  4V14 A;  1G9Q A;  2O5F A;  3DUP A;  3X0Q A;  3L85 A;  3ID9 A;  3MGM A;  1VHG A;  3SON A;  4JZV A;  1V8V A;  1MP2 A;  2ICJ A;  1VRL A;  4IJX A;  1PUN A;  1F3Y A;  1X83 A;  2A6T A;  2Q9P A;  1KT9 A;  3MDG A;  2J8Q A;  5FSN A;  4NFX A;  3MDI A;  2O5W A;  2YVO A;  3GG6 A;  1NQY A;  3X0J A;  3X0L A;  2QKM B;  1V8L A;  1HZT A;  3E57 A;  2A8S A;  3ZR0 A;  3ZR1 A;  5GHM A;  5BS6 A;  3QSJ A;  2A8T A;  2DSD A;  3A6T A;  1Q54 A;  1QVJ A;  2YVP A;  4MPO A;  2GT4 A;  5FSI A;  5C7Q A;  1V8I A;  4YPR A;  4KYX A;  2B06 A;  3J7Y e;  1SJY A;  1PUQ A;  2YYH A;  3CNG A;  3P5T A;  2KDW A;  3BM4 A;  3FK9 A;  4KG3 A;  5DDG A;  1XSA A;  3G0Q A;  3X0S A;  1KTG A;  2FKB A;  2DHO A;  5DPK A;  3ACA A;  3N77 A;  2JVB A;  3RH7 A;  2VNQ A;  5DEQ A;  4KTB A;  3O52 A;  1V8M A;  3GRN A;  1V8Y A;  4ICK A;  3X0P A;  5CFI A;  1V8R A;  1VHZ A;  3A6U A;  1MR2 A;  3U53 A; 
#chains in the Genus database with same CATH topology
 1VC9 A;  2A8P A;  4ILQ A;  4YOQ A;  5GHO A;  1V8N A;  1KHZ A;  1X51 A;  1Q33 A;  2KDV A;  3A6V A;  2CL3 A;  1MQE A;  3EEU A;  3GWY A;  3WHW A;  3Q93 A;  4S2Y A;  3O69 A;  1JRK A;  1G0S A;  4JZS A;  1XSB A;  1MK1 A;  2PNY A;  3AC9 A;  3MCF A;  5C7T A;  1RRQ A;  5LPG A;  3DKU A;  4HVY A;  2O1C A;  2A8R A;  4YPH A;  1K26 A;  2W4E A;  3R03 A;  1X84 A;  3GZ6 A;  2QJT A;  3GZ5 A;  3COU A;  2AZW A;  4N1U A;  1V8W A;  4NFW A;  3HYQ A;  1I9A A;  1SZ3 A;  4C9W A;  3EES A;  1OW2 A;  4HFQ A;  1V8U A;  4J7G A;  2G73 A;  2R5W A;  4S2W A;  1VC8 A;  5IW5 A;  1SOI A;  1MQW A;  1GA7 A;  1PVF A;  1TUM A;  1VCD A;  2B0V A;  2GB5 A;  3EXQ A;  3I9X A;  3OGA A;  3Q2S A;  5FSL A;  5HZX A;  4JZU A;  3Q4I A;  3SHD A;  3X0N A;  3O61 A;  3O8S A;  5GHQ A;  5ANW A;  1NFS A;  1VIQ A;  1RRS A;  4N1T A;  3Q2T A;  1Q27 A;  2B2K A;  1VIU A;  1R67 A;  1U20 A;  2ICK A;  3Q1P A;  5GHI A;  1V8S A;  1PPW A;  4ZG0 A;  5ISY A;  3Q91 A;  5ANT A;  2A8Q A;  2YVM A;  3N9U A;  4S2X A;  5GHN A;  3I7V A;  1VK6 A;  3F13 A;  5C8L A;  2FML A;  3HHJ A;  2FVV A;  3H95 A;  4S2V A;  5DD4 A;  2DSB A;  1V8T A;  1NQZ A;  3P6Y A;  2I8U A;  1XSC A;  2GT2 A;  2VNP A;  1K2E A;  2CZR A;  2I6K A;  3FFU A;  4C9X A;  5ANU A;  3FJY A;  3BHO A;  1IRY A;  4K6E A;  1RYA A;  3X0R A;  2G74 A;  4J7H A;  3I7U A;  2PQV A;  1HX3 A;  5ANS A;  5IW4 A;  3F6A A;  4KG4 A;  2XSQ A;  3EF5 A;  2RRK A;  4JZT A;  5GHJ A;  5FSM A;  3X0O A;  1PUS A;  3SMD A;  1SU2 A;  5BON A;  3GZ8 A;  1PPV A;  1MUT A;  5GHP A;  1PPX A;  2I8T A;  2QJO A;  5CFJ A;  3X0M A;  4DYW A;  3O6Z A;  2YVN A;  1NFZ A;  5ANV A;  5FSK A;  3X0K A;  3FSP A;  3A6S A;  1JKN A;  5I8U A;  3X0I A;  3KVH A;  3FCM A;  3BAP A;  5FSO A;  2DSC A;  2DUK A;  4V14 A;  1G9Q A;  2O5F A;  3DUP A;  3X0Q A;  3L85 A;  3ID9 A;  3MGM A;  1VHG A;  3SON A;  4JZV A;  1V8V A;  1MP2 A;  2ICJ A;  1VRL A;  4IJX A;  1PUN A;  1F3Y A;  1X83 A;  2A6T A;  2Q9P A;  1KT9 A;  3MDG A;  2J8Q A;  5FSN A;  4NFX A;  3MDI A;  2O5W A;  2YVO A;  3GG6 A;  1NQY A;  3X0J A;  3X0L A;  2QKM B;  1V8L A;  1HZT A;  3E57 A;  2A8S A;  3ZR0 A;  3ZR1 A;  5GHM A;  5BS6 A;  3QSJ A;  2A8T A;  2DSD A;  3A6T A;  1Q54 A;  1QVJ A;  2YVP A;  4MPO A;  2GT4 A;  5FSI A;  5C7Q A;  1V8I A;  4YPR A;  4KYX A;  2B06 A;  3J7Y e;  1SJY A;  1PUQ A;  2YYH A;  3CNG A;  3P5T A;  2KDW A;  3BM4 A;  3FK9 A;  4KG3 A;  5DDG A;  1XSA A;  3G0Q A;  3X0S A;  1KTG A;  2FKB A;  2DHO A;  5DPK A;  3ACA A;  3N77 A;  2JVB A;  3RH7 A;  2VNQ A;  5DEQ A;  4KTB A;  3O52 A;  1V8M A;  3GRN A;  1V8Y A;  4ICK A;  3X0P A;  5CFI A;  1V8R A;  1VHZ A;  3A6U A;  1MR2 A;  3U53 A; 
#chains in the Genus database with same CATH homology
 1VC9 A;  2A8P A;  4ILQ A;  4YOQ A;  5GHO A;  1V8N A;  1KHZ A;  1X51 A;  1Q33 A;  2KDV A;  3A6V A;  2CL3 A;  1MQE A;  3EEU A;  3GWY A;  3WHW A;  3Q93 A;  4S2Y A;  3O69 A;  1JRK A;  1G0S A;  4JZS A;  1XSB A;  1MK1 A;  2PNY A;  3AC9 A;  3MCF A;  5C7T A;  1RRQ A;  5LPG A;  3DKU A;  4HVY A;  2O1C A;  2A8R A;  4YPH A;  1K26 A;  2W4E A;  3R03 A;  1X84 A;  3GZ6 A;  2QJT A;  3GZ5 A;  3COU A;  2AZW A;  4N1U A;  1V8W A;  4NFW A;  3HYQ A;  1I9A A;  1SZ3 A;  4C9W A;  3EES A;  1OW2 A;  4HFQ A;  1V8U A;  4J7G A;  2G73 A;  2R5W A;  4S2W A;  1VC8 A;  5IW5 A;  1SOI A;  1MQW A;  1GA7 A;  1PVF A;  1TUM A;  1VCD A;  2B0V A;  2GB5 A;  3EXQ A;  3I9X A;  3OGA A;  3Q2S A;  5FSL A;  5HZX A;  4JZU A;  3Q4I A;  3SHD A;  3X0N A;  3O61 A;  3O8S A;  5GHQ A;  5ANW A;  1NFS A;  1VIQ A;  1RRS A;  4N1T A;  3Q2T A;  1Q27 A;  2B2K A;  1VIU A;  1R67 A;  1U20 A;  2ICK A;  3Q1P A;  5GHI A;  1V8S A;  1PPW A;  4ZG0 A;  5ISY A;  3Q91 A;  5ANT A;  2A8Q A;  2YVM A;  3N9U A;  4S2X A;  5GHN A;  3I7V A;  1VK6 A;  3F13 A;  5C8L A;  2FML A;  3HHJ A;  2FVV A;  3H95 A;  4S2V A;  5DD4 A;  2DSB A;  1V8T A;  1NQZ A;  3P6Y A;  2I8U A;  1XSC A;  2GT2 A;  2VNP A;  1K2E A;  2CZR A;  2I6K A;  3FFU A;  4C9X A;  5ANU A;  3FJY A;  3BHO A;  1IRY A;  4K6E A;  1RYA A;  3X0R A;  2G74 A;  4J7H A;  3I7U A;  2PQV A;  1HX3 A;  5ANS A;  5IW4 A;  3F6A A;  4KG4 A;  2XSQ A;  3EF5 A;  2RRK A;  4JZT A;  5GHJ A;  5FSM A;  3X0O A;  1PUS A;  3SMD A;  1SU2 A;  5BON A;  3GZ8 A;  1PPV A;  1MUT A;  5GHP A;  1PPX A;  2I8T A;  2QJO A;  5CFJ A;  3X0M A;  4DYW A;  3O6Z A;  2YVN A;  1NFZ A;  5ANV A;  5FSK A;  3X0K A;  3FSP A;  3A6S A;  1JKN A;  5I8U A;  3X0I A;  3KVH A;  3FCM A;  3BAP A;  5FSO A;  2DSC A;  2DUK A;  4V14 A;  1G9Q A;  2O5F A;  3DUP A;  3X0Q A;  3L85 A;  3ID9 A;  3MGM A;  1VHG A;  3SON A;  4JZV A;  1V8V A;  1MP2 A;  2ICJ A;  1VRL A;  4IJX A;  1PUN A;  1F3Y A;  1X83 A;  2A6T A;  2Q9P A;  1KT9 A;  3MDG A;  2J8Q A;  5FSN A;  4NFX A;  3MDI A;  2O5W A;  2YVO A;  3GG6 A;  1NQY A;  3X0J A;  3X0L A;  2QKM B;  1V8L A;  1HZT A;  3E57 A;  2A8S A;  3ZR0 A;  3ZR1 A;  5GHM A;  5BS6 A;  3QSJ A;  2A8T A;  2DSD A;  3A6T A;  1Q54 A;  1QVJ A;  2YVP A;  4MPO A;  2GT4 A;  5FSI A;  5C7Q A;  1V8I A;  4YPR A;  4KYX A;  2B06 A;  3J7Y e;  1SJY A;  1PUQ A;  2YYH A;  3CNG A;  3P5T A;  2KDW A;  3BM4 A;  3FK9 A;  4KG3 A;  5DDG A;  1XSA A;  3G0Q A;  3X0S A;  1KTG A;  2FKB A;  2DHO A;  5DPK A;  3ACA A;  3N77 A;  2JVB A;  3RH7 A;  2VNQ A;  5DEQ A;  4KTB A;  3O52 A;  1V8M A;  3GRN A;  1V8Y A;  4ICK A;  3X0P A;  5CFI A;  1V8R A;  1VHZ A;  3A6U A;  1MR2 A;  3U53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...