3OGAA

1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
134
Chain Sequence
b'AMRQRTIVCPLIQNDGCYLLCKMADGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRIKTYGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVKPEELALYDLNVATRHTLALKGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside triphosphatase nudI
publication title 1.75 Angstrom resolution crystal structure of a putative NTP pyrophosphohydrolase (yfaO) from Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Hydrolase
total genus 38
structure length 134
sequence length 142
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3ogaA00
4NFXA 5ANTA 1PUQA 3MGMA 2W4EA 3DUPA 1VCDA 3U53A 4S2YA 2G73A 2VNPA 1V8MA 2I8UA 4N1UA 5BS6A 5GHMA 2DSDA 2QJTA 2O1CA 5IW5A 2I8TA 3I7VA 2YVPA 3FSPA 3MDIA 2RRKA 1NFSA 3OGAA 1HZTA 4IJXA 1V8SA 5IW4A 3AC9A 3GG6A 1X84A 2A8PA 1MQWA 2R5WA 4JZSA 4KTBA 5C8LA 3ACAA 3KVHA 3O6ZA 1SZ3A 1XSBA 3Q4IA 3X0SA 1V8YA 2GT4A 3EESA 3Q91A 1V8RA 2O5FA 3FJYA 3MCFA 4JZTA 4K6EA 5ANWA 3SONA 5FSLA 3Q93A 2GB5A 4HVYA 3X0LA 3Q2SA 3BAPA 1Q27A 1KTGA 1PPVA 2PNYA 3ZR1A 5C7TA 2PQVA 1VIQA 3HYQA 3X0RA 4S2VA 1Q54A 4N1TA 1VHGA 4C9XA 3A6TA 5ANSA 5GHNA 1X51A 5FSKA 2GT2A 5GHIA 1F3YA 1RYAA 3A6UA 3FK9A 1MP2A 2B2KA 3SMDA 1PUSA 5FSNA 2DSCA 2XSQA 1MK1A 3F13A 1MR2A 2A8TA 1VHZA 1HX3A 2B06A 5LPGA 1SOIA 4YPHA 1V8UA 3EXQA 5GHQA 2YYHA 1KT9A 1PPWA 2DUKA 3WHWA 1V8WA 1NFZA 1Q33A 3GZ6A 1SJYA 4YPRA 5ISYA 2CL3A 3DKUA 3RH7A 5DD4A 5FSMA 1IRYA 2Q9PA 1G9QA 3ID9A 4V14A 1MQEA 2JVBA 5DPKA 1R67A 2I6KA 4HFQA 1SU2A 1V8IA 2A8SA 5GHOA 1G0SA 3X0KA 2VNQA 3FCMA 1VIUA 1X83A 5FSOA 4C9WA 3Q2TA 2A6TA 3O61A 3GRNA 1RRSA 2QKMB 3FFUA 4JZVA 5ANVA 2FKBA 3X0IA 3COUA 2YVOA 2YVNA 3X0MA 4S2WA 4KG4A 5GHJA 3GZ8A 3EEUA 1MUTA 1KHZA 3O69A 1JKNA 3QSJA 2ICKA 4ILQA 1K2EA 5GHPA 3I9XA 1PVFA 3I7UA 2QJOA 3Q1PA 1VC8A 2FMLA 3R03A 4ZG0A 1VRLA 1NQYA 2ICJA 1JRKA 1TUMA 1GA7A 1VK6A 2G74A 5DDGA 3G0QA 2DHOA 5BONA 5CFIA 4JZUA 2B0VA 3P5TA 1V8VA 3BM4A 4YOQA 1K26A 1VC9A 4NFWA 1OW2A 1PUNA 3H95A 3X0QA 4ICKA 3MDGA 3X0JA 3SHDA 1XSAA 3A6VA 3BHOA 4S2XA 1QVJA 2AZWA 2J8QA 2KDWA 2A8RA 3E57A 1V8NA 1XSCA 2YVMA 2O5WA 3A6SA 3X0OA 5C7QA 5HZXA 2DSBA 3EF5A 3F6AA 3N9UA 1U20A 5ANUA 5DEQA 3X0PA 1V8LA 3GWYA 5I8UA 3X0NA 5CFJA 3HHJA 2FVVA 1NQZA 3GZ5A 3ZR0A 2KDVA 4KYXA 3P6YA 3CNGA 3N77A 3O52A 3L85A 3J7Ye 2A8QA 4DYWA 4MPOA 1V8TA 1RRQA 1I9AA 5FSIA 4KG3A 3O8SA 1PPXA
chains in the Genus database with same CATH superfamily
4NFXA 5ANTA 1PUQA 3MGMA 2W4EA 3DUPA 1VCDA 3U53A 4S2YA 2G73A 2VNPA 1V8MA 2I8UA 4N1UA 5BS6A 5GHMA 2DSDA 2QJTA 2O1CA 5IW5A 2I8TA 3I7VA 2YVPA 3FSPA 3MDIA 2RRKA 1NFSA 3OGAA 1HZTA 4IJXA 1V8SA 5IW4A 3AC9A 3GG6A 1X84A 2A8PA 1MQWA 2R5WA 4JZSA 4KTBA 5C8LA 3ACAA 3KVHA 3O6ZA 1SZ3A 1XSBA 3Q4IA 3X0SA 1V8YA 2GT4A 3EESA 3Q91A 1V8RA 2O5FA 3FJYA 3MCFA 4JZTA 4K6EA 5ANWA 3SONA 5FSLA 3Q93A 2GB5A 4HVYA 3X0LA 3Q2SA 3BAPA 1Q27A 1KTGA 1PPVA 2PNYA 4J7GA 3ZR1A 2PQVA 1VIQA 5C7TA 3HYQA 3X0RA 4S2VA 1Q54A 4N1TA 1VHGA 4C9XA 3A6TA 5ANSA 5GHNA 1X51A 5FSKA 2GT2A 5GHIA 1F3YA 1RYAA 3A6UA 3FK9A 1MP2A 2B2KA 3SMDA 1PUSA 5FSNA 2DSCA 2XSQA 1MK1A 3F13A 1MR2A 2A8TA 1VHZA 1HX3A 2B06A 5LPGA 1SOIA 4YPHA 1V8UA 3EXQA 5GHQA 2YYHA 1KT9A 1PPWA 2DUKA 3WHWA 1V8WA 1NFZA 1Q33A 3GZ6A 1SJYA 4YPRA 5ISYA 2CL3A 3DKUA 3RH7A 5DD4A 5FSMA 1IRYA 2Q9PA 1G9QA 3ID9A 4V14A 1MQEA 2JVBA 5DPKA 1R67A 2I6KA 4HFQA 1SU2A 1V8IA 2A8SA 5GHOA 1G0SA 3X0KA 2VNQA 3FCMA 1VIUA 1X83A 5FSOA 4C9WA 3Q2TA 2A6TA 3O61A 3GRNA 1RRSA 2QKMB 3FFUA 4JZVA 5ANVA 2FKBA 3X0IA 3COUA 2YVOA 2YVNA 3X0MA 4S2WA 4KG4A 5GHJA 3GZ8A 3EEUA 1MUTA 1KHZA 3O69A 1JKNA 2CZRA 2ICKA 3QSJA 4ILQA 1K2EA 5GHPA 3I9XA 1PVFA 3I7UA 2QJOA 3Q1PA 1VC8A 2FMLA 3R03A 4ZG0A 1VRLA 1NQYA 2ICJA 1JRKA 1TUMA 1GA7A 1VK6A 2G74A 5DDGA 3G0QA 2DHOA 5BONA 5CFIA 4JZUA 2B0VA 3P5TA 1V8VA 3BM4A 4YOQA 1K26A 1VC9A 4NFWA 1OW2A 1PUNA 3H95A 3X0QA 4ICKA 3MDGA 3X0JA 3SHDA 1XSAA 3A6VA 3BHOA 4S2XA 1QVJA 2AZWA 2J8QA 2KDWA 2A8RA 3E57A 1V8NA 1XSCA 2YVMA 2O5WA 3A6SA 4J7HA 3X0OA 5C7QA 5HZXA 2DSBA 3EF5A 3F6AA 3N9UA 1U20A 5ANUA 5DEQA 3X0PA 1V8LA 3GWYA 5I8UA 3X0NA 5CFJA 3HHJA 2FVVA 1NQZA 3GZ5A 3ZR0A 2KDVA 4KYXA 3P6YA 3CNGA 3N77A 3O52A 3L85A 3J7Ye 2A8QA 4DYWA 4MPOA 1V8TA 1RRQA 1I9AA 5FSIA 4KG3A 3O8SA 1PPXA
chains in the Genus database with same CATH topology
4NFXA 5ANTA 1PUQA 3MGMA 2W4EA 3DUPA 1VCDA 3U53A 4S2YA 2G73A 2VNPA 1V8MA 2I8UA 4N1UA 5BS6A 5GHMA 2DSDA 2QJTA 2O1CA 5IW5A 2I8TA 3I7VA 2YVPA 3FSPA 3MDIA 2RRKA 1NFSA 3OGAA 1HZTA 4IJXA 1V8SA 5IW4A 3AC9A 3GG6A 1X84A 2A8PA 1MQWA 2R5WA 4JZSA 4KTBA 5C8LA 3ACAA 3KVHA 3O6ZA 1SZ3A 1XSBA 3Q4IA 3X0SA 1V8YA 2GT4A 3EESA 3Q91A 1V8RA 2O5FA 3FJYA 3MCFA 4JZTA 4K6EA 5ANWA 3SONA 5FSLA 3Q93A 2GB5A 4HVYA 3X0LA 3Q2SA 3BAPA 1Q27A 1KTGA 1PPVA 2PNYA 4J7GA 3ZR1A 2PQVA 1VIQA 5C7TA 3HYQA 3X0RA 4S2VA 1Q54A 4N1TA 1VHGA 4C9XA 3A6TA 5ANSA 5GHNA 1X51A 5FSKA 2GT2A 5GHIA 1F3YA 1RYAA 3A6UA 3FK9A 1MP2A 2B2KA 3SMDA 1PUSA 5FSNA 2DSCA 2XSQA 1MK1A 3F13A 1MR2A 2A8TA 1VHZA 1HX3A 2B06A 5LPGA 1SOIA 4YPHA 1V8UA 3EXQA 5GHQA 2YYHA 1KT9A 1PPWA 2DUKA 3WHWA 1V8WA 1NFZA 1Q33A 3GZ6A 1SJYA 4YPRA 5ISYA 2CL3A 3DKUA 3RH7A 5DD4A 5FSMA 1IRYA 2Q9PA 1G9QA 3ID9A 4V14A 1MQEA 2JVBA 5DPKA 1R67A 2I6KA 4HFQA 1SU2A 1V8IA 2A8SA 5GHOA 1G0SA 3X0KA 2VNQA 3FCMA 1VIUA 1X83A 5FSOA 4C9WA 3Q2TA 2A6TA 3O61A 3GRNA 1RRSA 2QKMB 3FFUA 4JZVA 5ANVA 2FKBA 3X0IA 3COUA 2YVOA 2YVNA 3X0MA 4S2WA 4KG4A 5GHJA 3GZ8A 3EEUA 1MUTA 1KHZA 3O69A 1JKNA 2CZRA 2ICKA 3QSJA 4ILQA 1K2EA 5GHPA 3I9XA 1PVFA 3I7UA 2QJOA 3Q1PA 1VC8A 2FMLA 3R03A 4ZG0A 1VRLA 1NQYA 2ICJA 1JRKA 1TUMA 1GA7A 1VK6A 2G74A 5DDGA 3G0QA 2DHOA 5BONA 5CFIA 4JZUA 2B0VA 3P5TA 1V8VA 3BM4A 4YOQA 1K26A 1VC9A 4NFWA 1OW2A 1PUNA 3H95A 3X0QA 4ICKA 3MDGA 3X0JA 3SHDA 1XSAA 3A6VA 3BHOA 4S2XA 1QVJA 2AZWA 2J8QA 2KDWA 2A8RA 3E57A 1V8NA 1XSCA 2YVMA 2O5WA 3A6SA 4J7HA 3X0OA 5C7QA 5HZXA 2DSBA 3EF5A 3F6AA 3N9UA 1U20A 5ANUA 5DEQA 3X0PA 1V8LA 3GWYA 5I8UA 3X0NA 5CFJA 3HHJA 2FVVA 1NQZA 3GZ5A 3ZR0A 2KDVA 4KYXA 3P6YA 3CNGA 3N77A 3O52A 3L85A 3J7Ye 2A8QA 4DYWA 4MPOA 1V8TA 1RRQA 1I9AA 5FSIA 4KG3A 3O8SA 1PPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFX A;  5ANT A;  1PUQ A;  3MGM A;  2W4E A;  3DUP A;  1VCD A;  3U53 A;  4S2Y A;  2G73 A;  2VNP A;  1V8M A;  2I8U A;  4N1U A;  5BS6 A;  5GHM A;  2DSD A;  2QJT A;  2O1C A;  5IW5 A;  2I8T A;  3I7V A;  2YVP A;  3FSP A;  3MDI A;  2RRK A;  1NFS A;  3OGA A;  1HZT A;  4IJX A;  1V8S A;  5IW4 A;  3AC9 A;  3GG6 A;  1X84 A;  2A8P A;  1MQW A;  2R5W A;  4JZS A;  4KTB A;  5C8L A;  3ACA A;  3KVH A;  3O6Z A;  1SZ3 A;  1XSB A;  3Q4I A;  3X0S A;  1V8Y A;  2GT4 A;  3EES A;  3Q91 A;  1V8R A;  2O5F A;  3FJY A;  3MCF A;  4JZT A;  4K6E A;  5ANW A;  3SON A;  5FSL A;  3Q93 A;  2GB5 A;  4HVY A;  3X0L A;  3Q2S A;  3BAP A;  1Q27 A;  1KTG A;  1PPV A;  2PNY A;  3ZR1 A;  5C7T A;  2PQV A;  1VIQ A;  3HYQ A;  3X0R A;  4S2V A;  1Q54 A;  4N1T A;  1VHG A;  4C9X A;  3A6T A;  5ANS A;  5GHN A;  1X51 A;  5FSK A;  2GT2 A;  5GHI A;  1F3Y A;  1RYA A;  3A6U A;  3FK9 A;  1MP2 A;  2B2K A;  3SMD A;  1PUS A;  5FSN A;  2DSC A;  2XSQ A;  1MK1 A;  3F13 A;  1MR2 A;  2A8T A;  1VHZ A;  1HX3 A;  2B06 A;  5LPG A;  1SOI A;  4YPH A;  1V8U A;  3EXQ A;  5GHQ A;  2YYH A;  1KT9 A;  1PPW A;  2DUK A;  3WHW A;  1V8W A;  1NFZ A;  1Q33 A;  3GZ6 A;  1SJY A;  4YPR A;  5ISY A;  2CL3 A;  3DKU A;  3RH7 A;  5DD4 A;  5FSM A;  1IRY A;  2Q9P A;  1G9Q A;  3ID9 A;  4V14 A;  1MQE A;  2JVB A;  5DPK A;  1R67 A;  2I6K A;  4HFQ A;  1SU2 A;  1V8I A;  2A8S A;  5GHO A;  1G0S A;  3X0K A;  2VNQ A;  3FCM A;  1VIU A;  1X83 A;  5FSO A;  4C9W A;  3Q2T A;  2A6T A;  3O61 A;  3GRN A;  1RRS A;  2QKM B;  3FFU A;  4JZV A;  5ANV A;  2FKB A;  3X0I A;  3COU A;  2YVO A;  2YVN A;  3X0M A;  4S2W A;  4KG4 A;  5GHJ A;  3GZ8 A;  3EEU A;  1MUT A;  1KHZ A;  3O69 A;  1JKN A;  3QSJ A;  2ICK A;  4ILQ A;  1K2E A;  5GHP A;  3I9X A;  1PVF A;  3I7U A;  2QJO A;  3Q1P A;  1VC8 A;  2FML A;  3R03 A;  4ZG0 A;  1VRL A;  1NQY A;  2ICJ A;  1JRK A;  1TUM A;  1GA7 A;  1VK6 A;  2G74 A;  5DDG A;  3G0Q A;  2DHO A;  5BON A;  5CFI A;  4JZU A;  2B0V A;  3P5T A;  1V8V A;  3BM4 A;  4YOQ A;  1K26 A;  1VC9 A;  4NFW A;  1OW2 A;  1PUN A;  3H95 A;  3X0Q A;  4ICK A;  3MDG A;  3X0J A;  3SHD A;  1XSA A;  3A6V A;  3BHO A;  4S2X A;  1QVJ A;  2AZW A;  2J8Q A;  2KDW A;  2A8R A;  3E57 A;  1V8N A;  1XSC A;  2YVM A;  2O5W A;  3A6S A;  3X0O A;  5C7Q A;  5HZX A;  2DSB A;  3EF5 A;  3F6A A;  3N9U A;  1U20 A;  5ANU A;  5DEQ A;  3X0P A;  1V8L A;  3GWY A;  5I8U A;  3X0N A;  5CFJ A;  3HHJ A;  2FVV A;  1NQZ A;  3GZ5 A;  3ZR0 A;  2KDV A;  4KYX A;  3P6Y A;  3CNG A;  3N77 A;  3O52 A;  3L85 A;  3J7Y e;  2A8Q A;  4DYW A;  4MPO A;  1V8T A;  1RRQ A;  1I9A A;  5FSI A;  4KG3 A;  3O8S A;  1PPX A; 
#chains in the Genus database with same CATH topology
 4NFX A;  5ANT A;  1PUQ A;  3MGM A;  2W4E A;  3DUP A;  1VCD A;  3U53 A;  4S2Y A;  2G73 A;  2VNP A;  1V8M A;  2I8U A;  4N1U A;  5BS6 A;  5GHM A;  2DSD A;  2QJT A;  2O1C A;  5IW5 A;  2I8T A;  3I7V A;  2YVP A;  3FSP A;  3MDI A;  2RRK A;  1NFS A;  3OGA A;  1HZT A;  4IJX A;  1V8S A;  5IW4 A;  3AC9 A;  3GG6 A;  1X84 A;  2A8P A;  1MQW A;  2R5W A;  4JZS A;  4KTB A;  5C8L A;  3ACA A;  3KVH A;  3O6Z A;  1SZ3 A;  1XSB A;  3Q4I A;  3X0S A;  1V8Y A;  2GT4 A;  3EES A;  3Q91 A;  1V8R A;  2O5F A;  3FJY A;  3MCF A;  4JZT A;  4K6E A;  5ANW A;  3SON A;  5FSL A;  3Q93 A;  2GB5 A;  4HVY A;  3X0L A;  3Q2S A;  3BAP A;  1Q27 A;  1KTG A;  1PPV A;  2PNY A;  4J7G A;  3ZR1 A;  2PQV A;  1VIQ A;  5C7T A;  3HYQ A;  3X0R A;  4S2V A;  1Q54 A;  4N1T A;  1VHG A;  4C9X A;  3A6T A;  5ANS A;  5GHN A;  1X51 A;  5FSK A;  2GT2 A;  5GHI A;  1F3Y A;  1RYA A;  3A6U A;  3FK9 A;  1MP2 A;  2B2K A;  3SMD A;  1PUS A;  5FSN A;  2DSC A;  2XSQ A;  1MK1 A;  3F13 A;  1MR2 A;  2A8T A;  1VHZ A;  1HX3 A;  2B06 A;  5LPG A;  1SOI A;  4YPH A;  1V8U A;  3EXQ A;  5GHQ A;  2YYH A;  1KT9 A;  1PPW A;  2DUK A;  3WHW A;  1V8W A;  1NFZ A;  1Q33 A;  3GZ6 A;  1SJY A;  4YPR A;  5ISY A;  2CL3 A;  3DKU A;  3RH7 A;  5DD4 A;  5FSM A;  1IRY A;  2Q9P A;  1G9Q A;  3ID9 A;  4V14 A;  1MQE A;  2JVB A;  5DPK A;  1R67 A;  2I6K A;  4HFQ A;  1SU2 A;  1V8I A;  2A8S A;  5GHO A;  1G0S A;  3X0K A;  2VNQ A;  3FCM A;  1VIU A;  1X83 A;  5FSO A;  4C9W A;  3Q2T A;  2A6T A;  3O61 A;  3GRN A;  1RRS A;  2QKM B;  3FFU A;  4JZV A;  5ANV A;  2FKB A;  3X0I A;  3COU A;  2YVO A;  2YVN A;  3X0M A;  4S2W A;  4KG4 A;  5GHJ A;  3GZ8 A;  3EEU A;  1MUT A;  1KHZ A;  3O69 A;  1JKN A;  2CZR A;  2ICK A;  3QSJ A;  4ILQ A;  1K2E A;  5GHP A;  3I9X A;  1PVF A;  3I7U A;  2QJO A;  3Q1P A;  1VC8 A;  2FML A;  3R03 A;  4ZG0 A;  1VRL A;  1NQY A;  2ICJ A;  1JRK A;  1TUM A;  1GA7 A;  1VK6 A;  2G74 A;  5DDG A;  3G0Q A;  2DHO A;  5BON A;  5CFI A;  4JZU A;  2B0V A;  3P5T A;  1V8V A;  3BM4 A;  4YOQ A;  1K26 A;  1VC9 A;  4NFW A;  1OW2 A;  1PUN A;  3H95 A;  3X0Q A;  4ICK A;  3MDG A;  3X0J A;  3SHD A;  1XSA A;  3A6V A;  3BHO A;  4S2X A;  1QVJ A;  2AZW A;  2J8Q A;  2KDW A;  2A8R A;  3E57 A;  1V8N A;  1XSC A;  2YVM A;  2O5W A;  3A6S A;  4J7H A;  3X0O A;  5C7Q A;  5HZX A;  2DSB A;  3EF5 A;  3F6A A;  3N9U A;  1U20 A;  5ANU A;  5DEQ A;  3X0P A;  1V8L A;  3GWY A;  5I8U A;  3X0N A;  5CFJ A;  3HHJ A;  2FVV A;  1NQZ A;  3GZ5 A;  3ZR0 A;  2KDV A;  4KYX A;  3P6Y A;  3CNG A;  3N77 A;  3O52 A;  3L85 A;  3J7Y e;  2A8Q A;  4DYW A;  4MPO A;  1V8T A;  1RRQ A;  1I9A A;  5FSI A;  4KG3 A;  3O8S A;  1PPX A; 
#chains in the Genus database with same CATH homology
 4NFX A;  5ANT A;  1PUQ A;  3MGM A;  2W4E A;  3DUP A;  1VCD A;  3U53 A;  4S2Y A;  2G73 A;  2VNP A;  1V8M A;  2I8U A;  4N1U A;  5BS6 A;  5GHM A;  2DSD A;  2QJT A;  2O1C A;  5IW5 A;  2I8T A;  3I7V A;  2YVP A;  3FSP A;  3MDI A;  2RRK A;  1NFS A;  3OGA A;  1HZT A;  4IJX A;  1V8S A;  5IW4 A;  3AC9 A;  3GG6 A;  1X84 A;  2A8P A;  1MQW A;  2R5W A;  4JZS A;  4KTB A;  5C8L A;  3ACA A;  3KVH A;  3O6Z A;  1SZ3 A;  1XSB A;  3Q4I A;  3X0S A;  1V8Y A;  2GT4 A;  3EES A;  3Q91 A;  1V8R A;  2O5F A;  3FJY A;  3MCF A;  4JZT A;  4K6E A;  5ANW A;  3SON A;  5FSL A;  3Q93 A;  2GB5 A;  4HVY A;  3X0L A;  3Q2S A;  3BAP A;  1Q27 A;  1KTG A;  1PPV A;  2PNY A;  4J7G A;  3ZR1 A;  2PQV A;  1VIQ A;  5C7T A;  3HYQ A;  3X0R A;  4S2V A;  1Q54 A;  4N1T A;  1VHG A;  4C9X A;  3A6T A;  5ANS A;  5GHN A;  1X51 A;  5FSK A;  2GT2 A;  5GHI A;  1F3Y A;  1RYA A;  3A6U A;  3FK9 A;  1MP2 A;  2B2K A;  3SMD A;  1PUS A;  5FSN A;  2DSC A;  2XSQ A;  1MK1 A;  3F13 A;  1MR2 A;  2A8T A;  1VHZ A;  1HX3 A;  2B06 A;  5LPG A;  1SOI A;  4YPH A;  1V8U A;  3EXQ A;  5GHQ A;  2YYH A;  1KT9 A;  1PPW A;  2DUK A;  3WHW A;  1V8W A;  1NFZ A;  1Q33 A;  3GZ6 A;  1SJY A;  4YPR A;  5ISY A;  2CL3 A;  3DKU A;  3RH7 A;  5DD4 A;  5FSM A;  1IRY A;  2Q9P A;  1G9Q A;  3ID9 A;  4V14 A;  1MQE A;  2JVB A;  5DPK A;  1R67 A;  2I6K A;  4HFQ A;  1SU2 A;  1V8I A;  2A8S A;  5GHO A;  1G0S A;  3X0K A;  2VNQ A;  3FCM A;  1VIU A;  1X83 A;  5FSO A;  4C9W A;  3Q2T A;  2A6T A;  3O61 A;  3GRN A;  1RRS A;  2QKM B;  3FFU A;  4JZV A;  5ANV A;  2FKB A;  3X0I A;  3COU A;  2YVO A;  2YVN A;  3X0M A;  4S2W A;  4KG4 A;  5GHJ A;  3GZ8 A;  3EEU A;  1MUT A;  1KHZ A;  3O69 A;  1JKN A;  2CZR A;  2ICK A;  3QSJ A;  4ILQ A;  1K2E A;  5GHP A;  3I9X A;  1PVF A;  3I7U A;  2QJO A;  3Q1P A;  1VC8 A;  2FML A;  3R03 A;  4ZG0 A;  1VRL A;  1NQY A;  2ICJ A;  1JRK A;  1TUM A;  1GA7 A;  1VK6 A;  2G74 A;  5DDG A;  3G0Q A;  2DHO A;  5BON A;  5CFI A;  4JZU A;  2B0V A;  3P5T A;  1V8V A;  3BM4 A;  4YOQ A;  1K26 A;  1VC9 A;  4NFW A;  1OW2 A;  1PUN A;  3H95 A;  3X0Q A;  4ICK A;  3MDG A;  3X0J A;  3SHD A;  1XSA A;  3A6V A;  3BHO A;  4S2X A;  1QVJ A;  2AZW A;  2J8Q A;  2KDW A;  2A8R A;  3E57 A;  1V8N A;  1XSC A;  2YVM A;  2O5W A;  3A6S A;  4J7H A;  3X0O A;  5C7Q A;  5HZX A;  2DSB A;  3EF5 A;  3F6A A;  3N9U A;  1U20 A;  5ANU A;  5DEQ A;  3X0P A;  1V8L A;  3GWY A;  5I8U A;  3X0N A;  5CFJ A;  3HHJ A;  2FVV A;  1NQZ A;  3GZ5 A;  3ZR0 A;  2KDV A;  4KYX A;  3P6Y A;  3CNG A;  3N77 A;  3O52 A;  3L85 A;  3J7Y e;  2A8Q A;  4DYW A;  4MPO A;  1V8T A;  1RRQ A;  1I9A A;  5FSI A;  4KG3 A;  3O8S A;  1PPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...