5GHJA

Crystal structure of human mth1(g2k mutant) in complex with 2-oxo-datp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
b'MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
source organism Homo sapiens
molecule tags Hydrolase
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ghjA00
2A8TA 3A6TA 5DEQA 3AC9A 1X83A 5BS6A 3X0RA 3X0LA 3SMDA 2B2KA 5DDGA 3MDGA 1VIUA 1K2EA 1JRKA 5FSNA 2B0VA 3SONA 1HZTA 1PUQA 3EXQA 5ANVA 4V14A 1VIQA 2G73A 1SJYA 1U20A 3HYQA 4S2XA 2O1CA 5GHQA 4DYWA 2ICJA 1NQZA 1SZ3A 1NQYA 3O52A 3X0IA 3X0PA 3F13A 4HVYA 2DSCA 1VC9A 4KTBA 5GHJA 4MPOA 5IW5A 3P6YA 3GZ6A 5IW4A 1PPXA 3X0JA 1MQEA 4N1TA 3HHJA 2KDWA 1V8UA 1XSAA 3OGAA 5GHMA 3BM4A 5C8LA 1V8TA 3EF5A 5GHNA 5HZXA 1VRLA 3N77A 1V8IA 2YVNA 5GHIA 2PQVA 2O5FA 1QVJA 3X0NA 2JVBA 3BAPA 5ANSA 3FK9A 2FKBA 3N9UA 3KVHA 2DUKA 3Q2SA 4S2VA 4YPRA 3Q2TA 3O6ZA 3A6VA 3SHDA 4KG3A 1IRYA 5C7TA 3I7VA 3Q91A 1X51A 2GT4A 2W4EA 3ACAA 2GT2A 1Q33A 2QJOA 3I7UA 2A8PA 1NFSA 3J7Ye 1VK6A 2PNYA 3F6AA 1K26A 3R03A 5FSOA 5C7QA 1V8RA 3Q4IA 2DSBA 5GHPA 3DKUA 1RRSA 5DPKA 2A8QA 1KTGA 2I6KA 3EESA 3EEUA 1MP2A 4KG4A 3P5TA 4IJXA 3X0QA 2DSDA 3MCFA 1PUNA 1JKNA 3RH7A 1V8LA 4S2WA 3FSPA 1TUMA 2VNQA 1VCDA 2GB5A 5BONA 3G0QA 3FFUA 1XSCA 3Q93A 4ICKA 5DD4A 5FSIA 5I8UA 3ID9A 1V8VA 1PPVA 1V8YA 3U53A 5ANWA 1V8MA 3X0OA 3CNGA 1PUSA 2R5WA 2I8UA 3X0KA 4JZVA 1MR2A 1X84A 3O8SA 3ZR0A 2VNPA 3X0SA 1NFZA 3A6SA 3WHWA 3A6UA 2A6TA 2KDVA 2ICKA 3O61A 3GG6A 5FSKA 4YOQA 4JZTA 2YYHA 4N1UA 3GZ5A 1Q54A 1V8WA 2J8QA 2YVMA 3ZR1A 3GZ8A 4C9WA 3MGMA 2DHOA 1GA7A 3COUA 3FJYA 4JZUA 1RYAA 1SU2A 3H95A 3L85A 4S2YA 1OW2A 4NFXA 1V8SA 1PPWA 4HFQA 4C9XA 1KT9A 3Q1PA 5GHOA 1VHZA 1G9QA 2Q9PA 2QJTA 1VHGA 1MQWA 2RRKA 1Q27A 2YVOA 3DUPA 3QSJA 3MDIA 1VC8A 3GWYA 3I9XA 1MUTA 4ZG0A 2YVPA 4KYXA 4NFWA 5LPGA 3FCMA 3X0MA 5CFJA 1I9AA 1PVFA 3E57A 5FSMA 1XSBA 1HX3A 2A8SA 2I8TA 2CL3A 1MK1A 3BHOA 4ILQA 2AZWA 4K6EA 3GRNA 1SOIA 4YPHA 1RRQA 2QKMB 5ISYA 2FVVA 1F3YA 5FSLA 1G0SA 2A8RA 2XSQA 5ANUA 5ANTA 2G74A 1V8NA 2O5WA 2B06A 3O69A 5CFIA 4JZSA 1KHZA 1R67A 2FMLA
chains in the Genus database with same CATH superfamily
2A8TA 3A6TA 5DEQA 3AC9A 1X83A 5BS6A 3X0RA 3X0LA 3SMDA 2B2KA 5DDGA 3MDGA 1VIUA 1K2EA 1JRKA 5FSNA 2B0VA 3SONA 1HZTA 1PUQA 3EXQA 5ANVA 4V14A 1VIQA 2G73A 1SJYA 1U20A 3HYQA 4S2XA 2O1CA 5GHQA 4DYWA 2ICJA 1NQZA 1SZ3A 1NQYA 3O52A 3X0IA 3X0PA 3F13A 4HVYA 2DSCA 1VC9A 4KTBA 5GHJA 4MPOA 5IW5A 3P6YA 3GZ6A 5IW4A 1PPXA 3X0JA 1MQEA 4N1TA 3HHJA 2KDWA 1V8UA 1XSAA 3OGAA 5GHMA 3BM4A 5C8LA 1V8TA 3EF5A 5GHNA 5HZXA 1VRLA 3N77A 1V8IA 2YVNA 5GHIA 2PQVA 2O5FA 1QVJA 3X0NA 2JVBA 3BAPA 5ANSA 3FK9A 2FKBA 3N9UA 3KVHA 2DUKA 3Q2SA 4J7HA 4S2VA 4YPRA 3Q2TA 3O6ZA 3A6VA 3SHDA 4KG3A 1IRYA 5C7TA 3I7VA 3Q91A 1X51A 2GT4A 2W4EA 3ACAA 2GT2A 1Q33A 2QJOA 3I7UA 2A8PA 1NFSA 3J7Ye 1VK6A 2PNYA 3F6AA 1K26A 2CZRA 3R03A 5FSOA 5C7QA 1V8RA 3Q4IA 2DSBA 5GHPA 3DKUA 1RRSA 5DPKA 2A8QA 1KTGA 2I6KA 3EESA 3EEUA 1MP2A 4KG4A 3P5TA 4IJXA 3X0QA 2DSDA 3MCFA 1PUNA 1JKNA 3RH7A 1V8LA 4S2WA 3FSPA 1TUMA 2VNQA 1VCDA 2GB5A 5BONA 3G0QA 3FFUA 1XSCA 3Q93A 4ICKA 5DD4A 5FSIA 5I8UA 3ID9A 1V8VA 1PPVA 1V8YA 3U53A 5ANWA 1V8MA 3X0OA 3CNGA 1PUSA 2R5WA 2I8UA 3X0KA 4JZVA 1MR2A 1X84A 3O8SA 3ZR0A 2VNPA 3X0SA 1NFZA 3A6SA 3WHWA 3A6UA 2A6TA 2KDVA 4J7GA 2ICKA 3O61A 3GG6A 5FSKA 4YOQA 4JZTA 2YYHA 4N1UA 3GZ5A 1Q54A 1V8WA 2J8QA 2YVMA 3ZR1A 3GZ8A 4C9WA 3MGMA 2DHOA 1GA7A 3COUA 3FJYA 4JZUA 1RYAA 1SU2A 3H95A 3L85A 4S2YA 1OW2A 4NFXA 1V8SA 1PPWA 4HFQA 4C9XA 1KT9A 3Q1PA 5GHOA 1VHZA 1G9QA 2Q9PA 2QJTA 1VHGA 1MQWA 2RRKA 1Q27A 2YVOA 3DUPA 3QSJA 3MDIA 1VC8A 3GWYA 3I9XA 1MUTA 4ZG0A 2YVPA 4KYXA 4NFWA 5LPGA 3FCMA 3X0MA 5CFJA 1I9AA 1PVFA 3E57A 5FSMA 1XSBA 1HX3A 2A8SA 2I8TA 2CL3A 1MK1A 3BHOA 4ILQA 2AZWA 4K6EA 3GRNA 1SOIA 4YPHA 1RRQA 2QKMB 5ISYA 2FVVA 1F3YA 5FSLA 1G0SA 2A8RA 2XSQA 5ANUA 5ANTA 2G74A 1V8NA 2O5WA 2B06A 3O69A 5CFIA 4JZSA 1KHZA 1R67A 2FMLA
chains in the Genus database with same CATH topology
2A8TA 3A6TA 5DEQA 3AC9A 1X83A 5BS6A 3X0RA 3X0LA 3SMDA 2B2KA 5DDGA 3MDGA 1VIUA 1K2EA 1JRKA 5FSNA 2B0VA 3SONA 1HZTA 1PUQA 3EXQA 5ANVA 4V14A 1VIQA 2G73A 1SJYA 1U20A 3HYQA 4S2XA 2O1CA 5GHQA 4DYWA 2ICJA 1NQZA 1SZ3A 1NQYA 3O52A 3X0IA 3X0PA 3F13A 4HVYA 2DSCA 1VC9A 4KTBA 5GHJA 4MPOA 5IW5A 3P6YA 3GZ6A 5IW4A 1PPXA 3X0JA 1MQEA 4N1TA 3HHJA 2KDWA 1V8UA 1XSAA 3OGAA 5GHMA 3BM4A 5C8LA 1V8TA 3EF5A 5GHNA 5HZXA 1VRLA 3N77A 1V8IA 2YVNA 5GHIA 2PQVA 2O5FA 1QVJA 3X0NA 2JVBA 3BAPA 5ANSA 3FK9A 2FKBA 3N9UA 3KVHA 2DUKA 3Q2SA 4J7HA 4S2VA 4YPRA 3Q2TA 3O6ZA 3A6VA 3SHDA 4KG3A 1IRYA 5C7TA 3I7VA 3Q91A 1X51A 2GT4A 2W4EA 3ACAA 2GT2A 1Q33A 2QJOA 3I7UA 2A8PA 1NFSA 3J7Ye 1VK6A 2PNYA 3F6AA 1K26A 2CZRA 3R03A 5FSOA 5C7QA 1V8RA 3Q4IA 2DSBA 5GHPA 3DKUA 1RRSA 5DPKA 2A8QA 1KTGA 2I6KA 3EESA 3EEUA 1MP2A 4KG4A 3P5TA 4IJXA 3X0QA 2DSDA 3MCFA 1PUNA 1JKNA 3RH7A 1V8LA 4S2WA 3FSPA 1TUMA 2VNQA 1VCDA 2GB5A 5BONA 3G0QA 3FFUA 1XSCA 3Q93A 4ICKA 5DD4A 5FSIA 5I8UA 3ID9A 1V8VA 1PPVA 1V8YA 3U53A 5ANWA 1V8MA 3X0OA 3CNGA 1PUSA 2R5WA 2I8UA 3X0KA 4JZVA 1MR2A 1X84A 3O8SA 3ZR0A 2VNPA 3X0SA 1NFZA 3A6SA 3WHWA 3A6UA 2A6TA 2KDVA 4J7GA 2ICKA 3O61A 3GG6A 5FSKA 4YOQA 4JZTA 2YYHA 4N1UA 3GZ5A 1Q54A 1V8WA 2J8QA 2YVMA 3ZR1A 3GZ8A 4C9WA 3MGMA 2DHOA 1GA7A 3COUA 3FJYA 4JZUA 1RYAA 1SU2A 3H95A 3L85A 4S2YA 1OW2A 4NFXA 1V8SA 1PPWA 4HFQA 4C9XA 1KT9A 3Q1PA 5GHOA 1VHZA 1G9QA 2Q9PA 2QJTA 1VHGA 1MQWA 2RRKA 1Q27A 2YVOA 3DUPA 3QSJA 3MDIA 1VC8A 3GWYA 3I9XA 1MUTA 4ZG0A 2YVPA 4KYXA 4NFWA 5LPGA 3FCMA 3X0MA 5CFJA 1I9AA 1PVFA 3E57A 5FSMA 1XSBA 1HX3A 2A8SA 2I8TA 2CL3A 1MK1A 3BHOA 4ILQA 2AZWA 4K6EA 3GRNA 1SOIA 4YPHA 1RRQA 2QKMB 5ISYA 2FVVA 1F3YA 5FSLA 1G0SA 2A8RA 2XSQA 5ANUA 5ANTA 2G74A 1V8NA 2O5WA 2B06A 3O69A 5CFIA 4JZSA 1KHZA 1R67A 2FMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8T A;  3A6T A;  5DEQ A;  3AC9 A;  1X83 A;  5BS6 A;  3X0R A;  3X0L A;  3SMD A;  2B2K A;  5DDG A;  3MDG A;  1VIU A;  1K2E A;  1JRK A;  5FSN A;  2B0V A;  3SON A;  1HZT A;  1PUQ A;  3EXQ A;  5ANV A;  4V14 A;  1VIQ A;  2G73 A;  1SJY A;  1U20 A;  3HYQ A;  4S2X A;  2O1C A;  5GHQ A;  4DYW A;  2ICJ A;  1NQZ A;  1SZ3 A;  1NQY A;  3O52 A;  3X0I A;  3X0P A;  3F13 A;  4HVY A;  2DSC A;  1VC9 A;  4KTB A;  5GHJ A;  4MPO A;  5IW5 A;  3P6Y A;  3GZ6 A;  5IW4 A;  1PPX A;  3X0J A;  1MQE A;  4N1T A;  3HHJ A;  2KDW A;  1V8U A;  1XSA A;  3OGA A;  5GHM A;  3BM4 A;  5C8L A;  1V8T A;  3EF5 A;  5GHN A;  5HZX A;  1VRL A;  3N77 A;  1V8I A;  2YVN A;  5GHI A;  2PQV A;  2O5F A;  1QVJ A;  3X0N A;  2JVB A;  3BAP A;  5ANS A;  3FK9 A;  2FKB A;  3N9U A;  3KVH A;  2DUK A;  3Q2S A;  4S2V A;  4YPR A;  3Q2T A;  3O6Z A;  3A6V A;  3SHD A;  4KG3 A;  1IRY A;  5C7T A;  3I7V A;  3Q91 A;  1X51 A;  2GT4 A;  2W4E A;  3ACA A;  2GT2 A;  1Q33 A;  2QJO A;  3I7U A;  2A8P A;  1NFS A;  3J7Y e;  1VK6 A;  2PNY A;  3F6A A;  1K26 A;  3R03 A;  5FSO A;  5C7Q A;  1V8R A;  3Q4I A;  2DSB A;  5GHP A;  3DKU A;  1RRS A;  5DPK A;  2A8Q A;  1KTG A;  2I6K A;  3EES A;  3EEU A;  1MP2 A;  4KG4 A;  3P5T A;  4IJX A;  3X0Q A;  2DSD A;  3MCF A;  1PUN A;  1JKN A;  3RH7 A;  1V8L A;  4S2W A;  3FSP A;  1TUM A;  2VNQ A;  1VCD A;  2GB5 A;  5BON A;  3G0Q A;  3FFU A;  1XSC A;  3Q93 A;  4ICK A;  5DD4 A;  5FSI A;  5I8U A;  3ID9 A;  1V8V A;  1PPV A;  1V8Y A;  3U53 A;  5ANW A;  1V8M A;  3X0O A;  3CNG A;  1PUS A;  2R5W A;  2I8U A;  3X0K A;  4JZV A;  1MR2 A;  1X84 A;  3O8S A;  3ZR0 A;  2VNP A;  3X0S A;  1NFZ A;  3A6S A;  3WHW A;  3A6U A;  2A6T A;  2KDV A;  2ICK A;  3O61 A;  3GG6 A;  5FSK A;  4YOQ A;  4JZT A;  2YYH A;  4N1U A;  3GZ5 A;  1Q54 A;  1V8W A;  2J8Q A;  2YVM A;  3ZR1 A;  3GZ8 A;  4C9W A;  3MGM A;  2DHO A;  1GA7 A;  3COU A;  3FJY A;  4JZU A;  1RYA A;  1SU2 A;  3H95 A;  3L85 A;  4S2Y A;  1OW2 A;  4NFX A;  1V8S A;  1PPW A;  4HFQ A;  4C9X A;  1KT9 A;  3Q1P A;  5GHO A;  1VHZ A;  1G9Q A;  2Q9P A;  2QJT A;  1VHG A;  1MQW A;  2RRK A;  1Q27 A;  2YVO A;  3DUP A;  3QSJ A;  3MDI A;  1VC8 A;  3GWY A;  3I9X A;  1MUT A;  4ZG0 A;  2YVP A;  4KYX A;  4NFW A;  5LPG A;  3FCM A;  3X0M A;  5CFJ A;  1I9A A;  1PVF A;  3E57 A;  5FSM A;  1XSB A;  1HX3 A;  2A8S A;  2I8T A;  2CL3 A;  1MK1 A;  3BHO A;  4ILQ A;  2AZW A;  4K6E A;  3GRN A;  1SOI A;  4YPH A;  1RRQ A;  2QKM B;  5ISY A;  2FVV A;  1F3Y A;  5FSL A;  1G0S A;  2A8R A;  2XSQ A;  5ANU A;  5ANT A;  2G74 A;  1V8N A;  2O5W A;  2B06 A;  3O69 A;  5CFI A;  4JZS A;  1KHZ A;  1R67 A;  2FML A; 
#chains in the Genus database with same CATH topology
 2A8T A;  3A6T A;  5DEQ A;  3AC9 A;  1X83 A;  5BS6 A;  3X0R A;  3X0L A;  3SMD A;  2B2K A;  5DDG A;  3MDG A;  1VIU A;  1K2E A;  1JRK A;  5FSN A;  2B0V A;  3SON A;  1HZT A;  1PUQ A;  3EXQ A;  5ANV A;  4V14 A;  1VIQ A;  2G73 A;  1SJY A;  1U20 A;  3HYQ A;  4S2X A;  2O1C A;  5GHQ A;  4DYW A;  2ICJ A;  1NQZ A;  1SZ3 A;  1NQY A;  3O52 A;  3X0I A;  3X0P A;  3F13 A;  4HVY A;  2DSC A;  1VC9 A;  4KTB A;  5GHJ A;  4MPO A;  5IW5 A;  3P6Y A;  3GZ6 A;  5IW4 A;  1PPX A;  3X0J A;  1MQE A;  4N1T A;  3HHJ A;  2KDW A;  1V8U A;  1XSA A;  3OGA A;  5GHM A;  3BM4 A;  5C8L A;  1V8T A;  3EF5 A;  5GHN A;  5HZX A;  1VRL A;  3N77 A;  1V8I A;  2YVN A;  5GHI A;  2PQV A;  2O5F A;  1QVJ A;  3X0N A;  2JVB A;  3BAP A;  5ANS A;  3FK9 A;  2FKB A;  3N9U A;  3KVH A;  2DUK A;  3Q2S A;  4J7H A;  4S2V A;  4YPR A;  3Q2T A;  3O6Z A;  3A6V A;  3SHD A;  4KG3 A;  1IRY A;  5C7T A;  3I7V A;  3Q91 A;  1X51 A;  2GT4 A;  2W4E A;  3ACA A;  2GT2 A;  1Q33 A;  2QJO A;  3I7U A;  2A8P A;  1NFS A;  3J7Y e;  1VK6 A;  2PNY A;  3F6A A;  1K26 A;  2CZR A;  3R03 A;  5FSO A;  5C7Q A;  1V8R A;  3Q4I A;  2DSB A;  5GHP A;  3DKU A;  1RRS A;  5DPK A;  2A8Q A;  1KTG A;  2I6K A;  3EES A;  3EEU A;  1MP2 A;  4KG4 A;  3P5T A;  4IJX A;  3X0Q A;  2DSD A;  3MCF A;  1PUN A;  1JKN A;  3RH7 A;  1V8L A;  4S2W A;  3FSP A;  1TUM A;  2VNQ A;  1VCD A;  2GB5 A;  5BON A;  3G0Q A;  3FFU A;  1XSC A;  3Q93 A;  4ICK A;  5DD4 A;  5FSI A;  5I8U A;  3ID9 A;  1V8V A;  1PPV A;  1V8Y A;  3U53 A;  5ANW A;  1V8M A;  3X0O A;  3CNG A;  1PUS A;  2R5W A;  2I8U A;  3X0K A;  4JZV A;  1MR2 A;  1X84 A;  3O8S A;  3ZR0 A;  2VNP A;  3X0S A;  1NFZ A;  3A6S A;  3WHW A;  3A6U A;  2A6T A;  2KDV A;  4J7G A;  2ICK A;  3O61 A;  3GG6 A;  5FSK A;  4YOQ A;  4JZT A;  2YYH A;  4N1U A;  3GZ5 A;  1Q54 A;  1V8W A;  2J8Q A;  2YVM A;  3ZR1 A;  3GZ8 A;  4C9W A;  3MGM A;  2DHO A;  1GA7 A;  3COU A;  3FJY A;  4JZU A;  1RYA A;  1SU2 A;  3H95 A;  3L85 A;  4S2Y A;  1OW2 A;  4NFX A;  1V8S A;  1PPW A;  4HFQ A;  4C9X A;  1KT9 A;  3Q1P A;  5GHO A;  1VHZ A;  1G9Q A;  2Q9P A;  2QJT A;  1VHG A;  1MQW A;  2RRK A;  1Q27 A;  2YVO A;  3DUP A;  3QSJ A;  3MDI A;  1VC8 A;  3GWY A;  3I9X A;  1MUT A;  4ZG0 A;  2YVP A;  4KYX A;  4NFW A;  5LPG A;  3FCM A;  3X0M A;  5CFJ A;  1I9A A;  1PVF A;  3E57 A;  5FSM A;  1XSB A;  1HX3 A;  2A8S A;  2I8T A;  2CL3 A;  1MK1 A;  3BHO A;  4ILQ A;  2AZW A;  4K6E A;  3GRN A;  1SOI A;  4YPH A;  1RRQ A;  2QKM B;  5ISY A;  2FVV A;  1F3Y A;  5FSL A;  1G0S A;  2A8R A;  2XSQ A;  5ANU A;  5ANT A;  2G74 A;  1V8N A;  2O5W A;  2B06 A;  3O69 A;  5CFI A;  4JZS A;  1KHZ A;  1R67 A;  2FML A; 
#chains in the Genus database with same CATH homology
 2A8T A;  3A6T A;  5DEQ A;  3AC9 A;  1X83 A;  5BS6 A;  3X0R A;  3X0L A;  3SMD A;  2B2K A;  5DDG A;  3MDG A;  1VIU A;  1K2E A;  1JRK A;  5FSN A;  2B0V A;  3SON A;  1HZT A;  1PUQ A;  3EXQ A;  5ANV A;  4V14 A;  1VIQ A;  2G73 A;  1SJY A;  1U20 A;  3HYQ A;  4S2X A;  2O1C A;  5GHQ A;  4DYW A;  2ICJ A;  1NQZ A;  1SZ3 A;  1NQY A;  3O52 A;  3X0I A;  3X0P A;  3F13 A;  4HVY A;  2DSC A;  1VC9 A;  4KTB A;  5GHJ A;  4MPO A;  5IW5 A;  3P6Y A;  3GZ6 A;  5IW4 A;  1PPX A;  3X0J A;  1MQE A;  4N1T A;  3HHJ A;  2KDW A;  1V8U A;  1XSA A;  3OGA A;  5GHM A;  3BM4 A;  5C8L A;  1V8T A;  3EF5 A;  5GHN A;  5HZX A;  1VRL A;  3N77 A;  1V8I A;  2YVN A;  5GHI A;  2PQV A;  2O5F A;  1QVJ A;  3X0N A;  2JVB A;  3BAP A;  5ANS A;  3FK9 A;  2FKB A;  3N9U A;  3KVH A;  2DUK A;  3Q2S A;  4J7H A;  4S2V A;  4YPR A;  3Q2T A;  3O6Z A;  3A6V A;  3SHD A;  4KG3 A;  1IRY A;  5C7T A;  3I7V A;  3Q91 A;  1X51 A;  2GT4 A;  2W4E A;  3ACA A;  2GT2 A;  1Q33 A;  2QJO A;  3I7U A;  2A8P A;  1NFS A;  3J7Y e;  1VK6 A;  2PNY A;  3F6A A;  1K26 A;  2CZR A;  3R03 A;  5FSO A;  5C7Q A;  1V8R A;  3Q4I A;  2DSB A;  5GHP A;  3DKU A;  1RRS A;  5DPK A;  2A8Q A;  1KTG A;  2I6K A;  3EES A;  3EEU A;  1MP2 A;  4KG4 A;  3P5T A;  4IJX A;  3X0Q A;  2DSD A;  3MCF A;  1PUN A;  1JKN A;  3RH7 A;  1V8L A;  4S2W A;  3FSP A;  1TUM A;  2VNQ A;  1VCD A;  2GB5 A;  5BON A;  3G0Q A;  3FFU A;  1XSC A;  3Q93 A;  4ICK A;  5DD4 A;  5FSI A;  5I8U A;  3ID9 A;  1V8V A;  1PPV A;  1V8Y A;  3U53 A;  5ANW A;  1V8M A;  3X0O A;  3CNG A;  1PUS A;  2R5W A;  2I8U A;  3X0K A;  4JZV A;  1MR2 A;  1X84 A;  3O8S A;  3ZR0 A;  2VNP A;  3X0S A;  1NFZ A;  3A6S A;  3WHW A;  3A6U A;  2A6T A;  2KDV A;  4J7G A;  2ICK A;  3O61 A;  3GG6 A;  5FSK A;  4YOQ A;  4JZT A;  2YYH A;  4N1U A;  3GZ5 A;  1Q54 A;  1V8W A;  2J8Q A;  2YVM A;  3ZR1 A;  3GZ8 A;  4C9W A;  3MGM A;  2DHO A;  1GA7 A;  3COU A;  3FJY A;  4JZU A;  1RYA A;  1SU2 A;  3H95 A;  3L85 A;  4S2Y A;  1OW2 A;  4NFX A;  1V8S A;  1PPW A;  4HFQ A;  4C9X A;  1KT9 A;  3Q1P A;  5GHO A;  1VHZ A;  1G9Q A;  2Q9P A;  2QJT A;  1VHG A;  1MQW A;  2RRK A;  1Q27 A;  2YVO A;  3DUP A;  3QSJ A;  3MDI A;  1VC8 A;  3GWY A;  3I9X A;  1MUT A;  4ZG0 A;  2YVP A;  4KYX A;  4NFW A;  5LPG A;  3FCM A;  3X0M A;  5CFJ A;  1I9A A;  1PVF A;  3E57 A;  5FSM A;  1XSB A;  1HX3 A;  2A8S A;  2I8T A;  2CL3 A;  1MK1 A;  3BHO A;  4ILQ A;  2AZW A;  4K6E A;  3GRN A;  1SOI A;  4YPH A;  1RRQ A;  2QKM B;  5ISY A;  2FVV A;  1F3Y A;  5FSL A;  1G0S A;  2A8R A;  2XSQ A;  5ANU A;  5ANT A;  2G74 A;  1V8N A;  2O5W A;  2B06 A;  3O69 A;  5CFI A;  4JZS A;  1KHZ A;  1R67 A;  2FML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...