5GHJA

Crystal structure of human mth1(g2k mutant) in complex with 2-oxo-datp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
156
structure length
156
Chain Sequence
MKASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Studies of the Human Nudix Hydrolase MTH1 Reveal the Mechanism for Its Broad Substrate Specificity
pubmed doi rcsb
molecule keywords 7,8-dihydro-8-oxoguanine triphosphatase
molecule tags Hydrolase
source organism Homo sapiens
total genus 41
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ghjA00
1PPXA 3GZ8A 1PUNA 2YVNA 1MK1A 1MR2A 3GRNA 3I9XA 4JZUA 2DSBA 2O5FA 5FSNA 4YOQA 3GZ6A 5ANSA 5GHOA 3P5TA 2G73A 4ICKA 5IW4A 1PUSA 2FVVA 5DPKA 2GT2A 3I7VA 4ZG0A 1V8RA 3MDGA 3SHDA 5CFIA 1QVJA 4ILQA 3A6UA 1KTGA 2VNQA 2QJOA 3X0JA 5ANVA 3F13A 3O8SA 3EXQA 2A8PA 3Q2TA 5C7TA 2O5WA 2GB5A 3X0OA 3GZ5A 4JZVA 2AZWA 5FSKA 5ANTA 1V8SA 2PNYA 3O69A 5BONA 3Q4IA 3X0SA 1F3YA 3AC9A 1VCDA 1PPWA 2I8TA 1V8YA 1SZ3A 2YVPA 3MGMA 1MUTA 3COUA 1V8NA 4NFXA 4V14A 5GHMA 4C9XA 1JKNA 3BHOA 1VRLA 1VHGA 1KT9A 2CL3A 5C8LA 3FFUA 1R67A 1XSCA 5CFJA 2DUKA 4YPHA 3G0QA 2JVBA 1VIUA 3N77A 2FMLA 4JZSA 1K2EA 1NFZA 4S2VA 3X0NA 4YPRA 4MPOA 3EEUA 3H95A 2RRKA 1HZTA 3Q91A 4KG3A 1PUQA 1IRYA 1XSBA 1NQZA 2R5WA 2KDWA 2A8SA 4K6EA 4HFQA 5BS6A 5HZXA 5LPGA 3FCMA 3A6VA 1VC9A 5DD4A 2FKBA 4DYWA 2A6TA 3A6SA 2I6KA 3I7UA 3KVHA 3O61A 1RRSA 1SOIA 1MP2A 2YVOA 3SONA 1X83A 1NFSA 2J8QA 1JRKA 1I9AA 4KYXA 3J7Ye 3ACAA 2PQVA 1SJYA 3MCFA 3FJYA 3DUPA 4S2XA 5FSLA 1TUMA 2KDVA 3FSPA 2ICKA 1OW2A 5DDGA 1RRQA 3SMDA 4N1TA 1V8VA 1XSAA 1V8WA 3O6ZA 3WHWA 4S2YA 1PVFA 2G74A 3P6YA 2A8QA 1MQWA 2Q9PA 2XSQA 3X0PA 1X51A 5FSOA 5GHQA 1Q27A 5I8UA 5C7QA 2W4EA 1PPVA 3ZR0A 3GG6A 1U20A 3Q1PA 1G9QA 3FK9A 2I8UA 4JZTA 3X0KA 3X0IA 4HVYA 3ZR1A 1V8UA 1X84A 2VNPA 5GHJA 4S2WA 3X0QA 3MDIA 5ANWA 5FSMA 1SU2A 3HHJA 5DEQA 2B06A 2DSCA 1V8LA 5ANUA 5FSIA 4C9WA 3QSJA 2O1CA 2A8TA 3GWYA 1RYAA 4IJXA 5GHNA 3E57A 3EF5A 3F6AA 2YVMA 4NFWA 3X0RA 3X0MA 5IW5A 1HX3A 1K26A 2GT4A 3OGAA 1Q33A 2YYHA 3DKUA 3X0LA 3Q93A 3CNGA 2A8RA 1Q54A 3L85A 1V8IA 4N1UA 1G0SA 1VC8A 5GHPA 1GA7A 1V8TA 3N9UA 3ID9A 2QJTA 4KTBA 3RH7A 5GHIA 3Q2SA 5ISYA 3A6TA 3BM4A 1VK6A 3HYQA 1KHZA 1NQYA 3R03A 1VIQA 2B2KA 4KG4A 2ICJA 3BAPA 3O52A 1MQEA 3U53A 2DHOA 2QKMB 1V8MA 3EESA 2B0VA 2DSDA 1VHZA
chains in the Genus database with same CATH superfamily
1PPXA 3GZ8A 1PUNA 2YVNA 1MK1A 1MR2A 3GRNA 3I9XA 4JZUA 2DSBA 2O5FA 5FSNA 4YOQA 3GZ6A 5ANSA 5GHOA 3P5TA 2G73A 4ICKA 5IW4A 1PUSA 2FVVA 5DPKA 2GT2A 3I7VA 4ZG0A 1V8RA 3MDGA 3SHDA 5CFIA 1QVJA 4ILQA 3A6UA 1KTGA 2VNQA 2QJOA 3X0JA 5ANVA 3F13A 3O8SA 3EXQA 2A8PA 3Q2TA 5C7TA 2O5WA 2GB5A 3X0OA 3GZ5A 4JZVA 2AZWA 5FSKA 5ANTA 1V8SA 2PNYA 3O69A 5BONA 3Q4IA 3X0SA 1F3YA 3AC9A 1VCDA 1PPWA 2I8TA 1V8YA 1SZ3A 2YVPA 3MGMA 1MUTA 3COUA 1V8NA 4NFXA 4V14A 5GHMA 4C9XA 1JKNA 3BHOA 1VRLA 1VHGA 1KT9A 2CL3A 5C8LA 3FFUA 1R67A 1XSCA 5CFJA 2DUKA 4YPHA 3G0QA 2JVBA 1VIUA 3N77A 2FMLA 4JZSA 1K2EA 1NFZA 4S2VA 3X0NA 4YPRA 4MPOA 3EEUA 3H95A 2RRKA 4J7HA 1HZTA 3Q91A 4KG3A 1PUQA 1IRYA 1XSBA 1NQZA 2R5WA 2KDWA 2A8SA 4K6EA 4HFQA 5BS6A 5HZXA 4J7GA 5LPGA 3FCMA 3A6VA 1VC9A 5DD4A 2FKBA 4DYWA 2A6TA 3A6SA 2I6KA 3I7UA 3KVHA 3O61A 1RRSA 1SOIA 1MP2A 2YVOA 3SONA 1X83A 1NFSA 2J8QA 1JRKA 1I9AA 4KYXA 3J7Ye 3ACAA 2PQVA 1SJYA 3MCFA 3FJYA 3DUPA 4S2XA 5FSLA 1TUMA 2KDVA 3FSPA 2ICKA 1OW2A 5DDGA 1RRQA 3SMDA 4N1TA 1V8VA 1XSAA 1V8WA 3O6ZA 3WHWA 4S2YA 1PVFA 2G74A 3P6YA 2A8QA 1MQWA 2Q9PA 2XSQA 3X0PA 1X51A 5FSOA 5GHQA 1Q27A 5I8UA 5C7QA 2W4EA 1PPVA 3ZR0A 3GG6A 1U20A 3Q1PA 1G9QA 3FK9A 2I8UA 4JZTA 3X0KA 3X0IA 4HVYA 3ZR1A 1V8UA 1X84A 2VNPA 5GHJA 4S2WA 3X0QA 3MDIA 5ANWA 5FSMA 1SU2A 3HHJA 5DEQA 2B06A 2DSCA 1V8LA 5ANUA 5FSIA 4C9WA 3QSJA 2O1CA 2A8TA 3GWYA 1RYAA 4IJXA 5GHNA 3E57A 3EF5A 3F6AA 2YVMA 4NFWA 3X0RA 3X0MA 5IW5A 1HX3A 1K26A 2GT4A 3OGAA 1Q33A 2YYHA 3DKUA 3X0LA 3Q93A 3CNGA 2A8RA 1Q54A 3L85A 1V8IA 4N1UA 1G0SA 1VC8A 5GHPA 1GA7A 1V8TA 3N9UA 3ID9A 2QJTA 4KTBA 3RH7A 5GHIA 3Q2SA 5ISYA 3A6TA 3BM4A 1VK6A 3HYQA 1KHZA 1NQYA 3R03A 1VIQA 2B2KA 4KG4A 2ICJA 3BAPA 2CZRA 1MQEA 3O52A 3U53A 2DHOA 2QKMB 1V8MA 3EESA 2B0VA 2DSDA 1VHZA
chains in the Genus database with same CATH topology
1PPXA 3GZ8A 1PUNA 2YVNA 1MK1A 1MR2A 3GRNA 3I9XA 4JZUA 2DSBA 2O5FA 5FSNA 4YOQA 3GZ6A 5ANSA 5GHOA 3P5TA 2G73A 4ICKA 5IW4A 1PUSA 2FVVA 5DPKA 2GT2A 3I7VA 4ZG0A 1V8RA 3MDGA 3SHDA 5CFIA 1QVJA 4ILQA 3A6UA 1KTGA 2VNQA 2QJOA 3X0JA 5ANVA 3F13A 3O8SA 3EXQA 2A8PA 3Q2TA 5C7TA 2O5WA 2GB5A 3X0OA 3GZ5A 4JZVA 2AZWA 5FSKA 5ANTA 1V8SA 2PNYA 3O69A 5BONA 3Q4IA 3X0SA 1F3YA 3AC9A 1VCDA 1PPWA 2I8TA 1V8YA 1SZ3A 2YVPA 3MGMA 1MUTA 3COUA 1V8NA 4NFXA 4V14A 5GHMA 4C9XA 1JKNA 3BHOA 1VRLA 1VHGA 1KT9A 2CL3A 5C8LA 3FFUA 1R67A 1XSCA 5CFJA 2DUKA 4YPHA 3G0QA 2JVBA 1VIUA 3N77A 2FMLA 4JZSA 1K2EA 1NFZA 4S2VA 3X0NA 4YPRA 4MPOA 3EEUA 3H95A 2RRKA 4J7HA 1HZTA 3Q91A 4KG3A 1PUQA 1IRYA 1XSBA 1NQZA 2R5WA 2KDWA 2A8SA 4K6EA 4HFQA 5BS6A 5HZXA 4J7GA 5LPGA 3FCMA 3A6VA 1VC9A 5DD4A 2FKBA 4DYWA 2A6TA 3A6SA 2I6KA 3I7UA 3KVHA 3O61A 1RRSA 1SOIA 1MP2A 2YVOA 3SONA 1X83A 1NFSA 2J8QA 1JRKA 1I9AA 4KYXA 3J7Ye 3ACAA 2PQVA 1SJYA 3MCFA 3FJYA 3DUPA 4S2XA 5FSLA 1TUMA 2KDVA 3FSPA 2ICKA 1OW2A 5DDGA 1RRQA 3SMDA 4N1TA 1V8VA 1XSAA 1V8WA 3O6ZA 3WHWA 4S2YA 1PVFA 2G74A 3P6YA 2A8QA 1MQWA 2Q9PA 2XSQA 3X0PA 1X51A 5FSOA 5GHQA 1Q27A 5I8UA 5C7QA 2W4EA 1PPVA 3ZR0A 3GG6A 1U20A 3Q1PA 1G9QA 3FK9A 2I8UA 4JZTA 3X0KA 3X0IA 4HVYA 3ZR1A 1V8UA 1X84A 2VNPA 5GHJA 4S2WA 3X0QA 3MDIA 5ANWA 5FSMA 1SU2A 3HHJA 5DEQA 2B06A 2DSCA 1V8LA 5ANUA 5FSIA 4C9WA 3QSJA 2O1CA 2A8TA 3GWYA 1RYAA 4IJXA 5GHNA 3E57A 3EF5A 3F6AA 2YVMA 4NFWA 3X0RA 3X0MA 5IW5A 1HX3A 1K26A 2GT4A 3OGAA 1Q33A 2YYHA 3DKUA 3X0LA 3Q93A 3CNGA 2A8RA 1Q54A 3L85A 1V8IA 4N1UA 1G0SA 1VC8A 5GHPA 1GA7A 1V8TA 3N9UA 3ID9A 2QJTA 4KTBA 3RH7A 5GHIA 3Q2SA 5ISYA 3A6TA 3BM4A 1VK6A 3HYQA 1KHZA 1NQYA 3R03A 1VIQA 2B2KA 4KG4A 2ICJA 3BAPA 2CZRA 1MQEA 3O52A 3U53A 2DHOA 2QKMB 1V8MA 3EESA 2B0VA 2DSDA 1VHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPX A;  3GZ8 A;  1PUN A;  2YVN A;  1MK1 A;  1MR2 A;  3GRN A;  3I9X A;  4JZU A;  2DSB A;  2O5F A;  5FSN A;  4YOQ A;  3GZ6 A;  5ANS A;  5GHO A;  3P5T A;  2G73 A;  4ICK A;  5IW4 A;  1PUS A;  2FVV A;  5DPK A;  2GT2 A;  3I7V A;  4ZG0 A;  1V8R A;  3MDG A;  3SHD A;  5CFI A;  1QVJ A;  4ILQ A;  3A6U A;  1KTG A;  2VNQ A;  2QJO A;  3X0J A;  5ANV A;  3F13 A;  3O8S A;  3EXQ A;  2A8P A;  3Q2T A;  5C7T A;  2O5W A;  2GB5 A;  3X0O A;  3GZ5 A;  4JZV A;  2AZW A;  5FSK A;  5ANT A;  1V8S A;  2PNY A;  3O69 A;  5BON A;  3Q4I A;  3X0S A;  1F3Y A;  3AC9 A;  1VCD A;  1PPW A;  2I8T A;  1V8Y A;  1SZ3 A;  2YVP A;  3MGM A;  1MUT A;  3COU A;  1V8N A;  4NFX A;  4V14 A;  5GHM A;  4C9X A;  1JKN A;  3BHO A;  1VRL A;  1VHG A;  1KT9 A;  2CL3 A;  5C8L A;  3FFU A;  1R67 A;  1XSC A;  5CFJ A;  2DUK A;  4YPH A;  3G0Q A;  2JVB A;  1VIU A;  3N77 A;  2FML A;  4JZS A;  1K2E A;  1NFZ A;  4S2V A;  3X0N A;  4YPR A;  4MPO A;  3EEU A;  3H95 A;  2RRK A;  1HZT A;  3Q91 A;  4KG3 A;  1PUQ A;  1IRY A;  1XSB A;  1NQZ A;  2R5W A;  2KDW A;  2A8S A;  4K6E A;  4HFQ A;  5BS6 A;  5HZX A;  5LPG A;  3FCM A;  3A6V A;  1VC9 A;  5DD4 A;  2FKB A;  4DYW A;  2A6T A;  3A6S A;  2I6K A;  3I7U A;  3KVH A;  3O61 A;  1RRS A;  1SOI A;  1MP2 A;  2YVO A;  3SON A;  1X83 A;  1NFS A;  2J8Q A;  1JRK A;  1I9A A;  4KYX A;  3J7Y e;  3ACA A;  2PQV A;  1SJY A;  3MCF A;  3FJY A;  3DUP A;  4S2X A;  5FSL A;  1TUM A;  2KDV A;  3FSP A;  2ICK A;  1OW2 A;  5DDG A;  1RRQ A;  3SMD A;  4N1T A;  1V8V A;  1XSA A;  1V8W A;  3O6Z A;  3WHW A;  4S2Y A;  1PVF A;  2G74 A;  3P6Y A;  2A8Q A;  1MQW A;  2Q9P A;  2XSQ A;  3X0P A;  1X51 A;  5FSO A;  5GHQ A;  1Q27 A;  5I8U A;  5C7Q A;  2W4E A;  1PPV A;  3ZR0 A;  3GG6 A;  1U20 A;  3Q1P A;  1G9Q A;  3FK9 A;  2I8U A;  4JZT A;  3X0K A;  3X0I A;  4HVY A;  3ZR1 A;  1V8U A;  1X84 A;  2VNP A;  5GHJ A;  4S2W A;  3X0Q A;  3MDI A;  5ANW A;  5FSM A;  1SU2 A;  3HHJ A;  5DEQ A;  2B06 A;  2DSC A;  1V8L A;  5ANU A;  5FSI A;  4C9W A;  3QSJ A;  2O1C A;  2A8T A;  3GWY A;  1RYA A;  4IJX A;  5GHN A;  3E57 A;  3EF5 A;  3F6A A;  2YVM A;  4NFW A;  3X0R A;  3X0M A;  5IW5 A;  1HX3 A;  1K26 A;  2GT4 A;  3OGA A;  1Q33 A;  2YYH A;  3DKU A;  3X0L A;  3Q93 A;  3CNG A;  2A8R A;  1Q54 A;  3L85 A;  1V8I A;  4N1U A;  1G0S A;  1VC8 A;  5GHP A;  1GA7 A;  1V8T A;  3N9U A;  3ID9 A;  2QJT A;  4KTB A;  3RH7 A;  5GHI A;  3Q2S A;  5ISY A;  3A6T A;  3BM4 A;  1VK6 A;  3HYQ A;  1KHZ A;  1NQY A;  3R03 A;  1VIQ A;  2B2K A;  4KG4 A;  2ICJ A;  3BAP A;  3O52 A;  1MQE A;  3U53 A;  2DHO A;  2QKM B;  1V8M A;  3EES A;  2B0V A;  2DSD A;  1VHZ A; 
#chains in the Genus database with same CATH topology
 1PPX A;  3GZ8 A;  1PUN A;  2YVN A;  1MK1 A;  1MR2 A;  3GRN A;  3I9X A;  4JZU A;  2DSB A;  2O5F A;  5FSN A;  4YOQ A;  3GZ6 A;  5ANS A;  5GHO A;  3P5T A;  2G73 A;  4ICK A;  5IW4 A;  1PUS A;  2FVV A;  5DPK A;  2GT2 A;  3I7V A;  4ZG0 A;  1V8R A;  3MDG A;  3SHD A;  5CFI A;  1QVJ A;  4ILQ A;  3A6U A;  1KTG A;  2VNQ A;  2QJO A;  3X0J A;  5ANV A;  3F13 A;  3O8S A;  3EXQ A;  2A8P A;  3Q2T A;  5C7T A;  2O5W A;  2GB5 A;  3X0O A;  3GZ5 A;  4JZV A;  2AZW A;  5FSK A;  5ANT A;  1V8S A;  2PNY A;  3O69 A;  5BON A;  3Q4I A;  3X0S A;  1F3Y A;  3AC9 A;  1VCD A;  1PPW A;  2I8T A;  1V8Y A;  1SZ3 A;  2YVP A;  3MGM A;  1MUT A;  3COU A;  1V8N A;  4NFX A;  4V14 A;  5GHM A;  4C9X A;  1JKN A;  3BHO A;  1VRL A;  1VHG A;  1KT9 A;  2CL3 A;  5C8L A;  3FFU A;  1R67 A;  1XSC A;  5CFJ A;  2DUK A;  4YPH A;  3G0Q A;  2JVB A;  1VIU A;  3N77 A;  2FML A;  4JZS A;  1K2E A;  1NFZ A;  4S2V A;  3X0N A;  4YPR A;  4MPO A;  3EEU A;  3H95 A;  2RRK A;  4J7H A;  1HZT A;  3Q91 A;  4KG3 A;  1PUQ A;  1IRY A;  1XSB A;  1NQZ A;  2R5W A;  2KDW A;  2A8S A;  4K6E A;  4HFQ A;  5BS6 A;  5HZX A;  4J7G A;  5LPG A;  3FCM A;  3A6V A;  1VC9 A;  5DD4 A;  2FKB A;  4DYW A;  2A6T A;  3A6S A;  2I6K A;  3I7U A;  3KVH A;  3O61 A;  1RRS A;  1SOI A;  1MP2 A;  2YVO A;  3SON A;  1X83 A;  1NFS A;  2J8Q A;  1JRK A;  1I9A A;  4KYX A;  3J7Y e;  3ACA A;  2PQV A;  1SJY A;  3MCF A;  3FJY A;  3DUP A;  4S2X A;  5FSL A;  1TUM A;  2KDV A;  3FSP A;  2ICK A;  1OW2 A;  5DDG A;  1RRQ A;  3SMD A;  4N1T A;  1V8V A;  1XSA A;  1V8W A;  3O6Z A;  3WHW A;  4S2Y A;  1PVF A;  2G74 A;  3P6Y A;  2A8Q A;  1MQW A;  2Q9P A;  2XSQ A;  3X0P A;  1X51 A;  5FSO A;  5GHQ A;  1Q27 A;  5I8U A;  5C7Q A;  2W4E A;  1PPV A;  3ZR0 A;  3GG6 A;  1U20 A;  3Q1P A;  1G9Q A;  3FK9 A;  2I8U A;  4JZT A;  3X0K A;  3X0I A;  4HVY A;  3ZR1 A;  1V8U A;  1X84 A;  2VNP A;  5GHJ A;  4S2W A;  3X0Q A;  3MDI A;  5ANW A;  5FSM A;  1SU2 A;  3HHJ A;  5DEQ A;  2B06 A;  2DSC A;  1V8L A;  5ANU A;  5FSI A;  4C9W A;  3QSJ A;  2O1C A;  2A8T A;  3GWY A;  1RYA A;  4IJX A;  5GHN A;  3E57 A;  3EF5 A;  3F6A A;  2YVM A;  4NFW A;  3X0R A;  3X0M A;  5IW5 A;  1HX3 A;  1K26 A;  2GT4 A;  3OGA A;  1Q33 A;  2YYH A;  3DKU A;  3X0L A;  3Q93 A;  3CNG A;  2A8R A;  1Q54 A;  3L85 A;  1V8I A;  4N1U A;  1G0S A;  1VC8 A;  5GHP A;  1GA7 A;  1V8T A;  3N9U A;  3ID9 A;  2QJT A;  4KTB A;  3RH7 A;  5GHI A;  3Q2S A;  5ISY A;  3A6T A;  3BM4 A;  1VK6 A;  3HYQ A;  1KHZ A;  1NQY A;  3R03 A;  1VIQ A;  2B2K A;  4KG4 A;  2ICJ A;  3BAP A;  2CZR A;  1MQE A;  3O52 A;  3U53 A;  2DHO A;  2QKM B;  1V8M A;  3EES A;  2B0V A;  2DSD A;  1VHZ A; 
#chains in the Genus database with same CATH homology
 1PPX A;  3GZ8 A;  1PUN A;  2YVN A;  1MK1 A;  1MR2 A;  3GRN A;  3I9X A;  4JZU A;  2DSB A;  2O5F A;  5FSN A;  4YOQ A;  3GZ6 A;  5ANS A;  5GHO A;  3P5T A;  2G73 A;  4ICK A;  5IW4 A;  1PUS A;  2FVV A;  5DPK A;  2GT2 A;  3I7V A;  4ZG0 A;  1V8R A;  3MDG A;  3SHD A;  5CFI A;  1QVJ A;  4ILQ A;  3A6U A;  1KTG A;  2VNQ A;  2QJO A;  3X0J A;  5ANV A;  3F13 A;  3O8S A;  3EXQ A;  2A8P A;  3Q2T A;  5C7T A;  2O5W A;  2GB5 A;  3X0O A;  3GZ5 A;  4JZV A;  2AZW A;  5FSK A;  5ANT A;  1V8S A;  2PNY A;  3O69 A;  5BON A;  3Q4I A;  3X0S A;  1F3Y A;  3AC9 A;  1VCD A;  1PPW A;  2I8T A;  1V8Y A;  1SZ3 A;  2YVP A;  3MGM A;  1MUT A;  3COU A;  1V8N A;  4NFX A;  4V14 A;  5GHM A;  4C9X A;  1JKN A;  3BHO A;  1VRL A;  1VHG A;  1KT9 A;  2CL3 A;  5C8L A;  3FFU A;  1R67 A;  1XSC A;  5CFJ A;  2DUK A;  4YPH A;  3G0Q A;  2JVB A;  1VIU A;  3N77 A;  2FML A;  4JZS A;  1K2E A;  1NFZ A;  4S2V A;  3X0N A;  4YPR A;  4MPO A;  3EEU A;  3H95 A;  2RRK A;  4J7H A;  1HZT A;  3Q91 A;  4KG3 A;  1PUQ A;  1IRY A;  1XSB A;  1NQZ A;  2R5W A;  2KDW A;  2A8S A;  4K6E A;  4HFQ A;  5BS6 A;  5HZX A;  4J7G A;  5LPG A;  3FCM A;  3A6V A;  1VC9 A;  5DD4 A;  2FKB A;  4DYW A;  2A6T A;  3A6S A;  2I6K A;  3I7U A;  3KVH A;  3O61 A;  1RRS A;  1SOI A;  1MP2 A;  2YVO A;  3SON A;  1X83 A;  1NFS A;  2J8Q A;  1JRK A;  1I9A A;  4KYX A;  3J7Y e;  3ACA A;  2PQV A;  1SJY A;  3MCF A;  3FJY A;  3DUP A;  4S2X A;  5FSL A;  1TUM A;  2KDV A;  3FSP A;  2ICK A;  1OW2 A;  5DDG A;  1RRQ A;  3SMD A;  4N1T A;  1V8V A;  1XSA A;  1V8W A;  3O6Z A;  3WHW A;  4S2Y A;  1PVF A;  2G74 A;  3P6Y A;  2A8Q A;  1MQW A;  2Q9P A;  2XSQ A;  3X0P A;  1X51 A;  5FSO A;  5GHQ A;  1Q27 A;  5I8U A;  5C7Q A;  2W4E A;  1PPV A;  3ZR0 A;  3GG6 A;  1U20 A;  3Q1P A;  1G9Q A;  3FK9 A;  2I8U A;  4JZT A;  3X0K A;  3X0I A;  4HVY A;  3ZR1 A;  1V8U A;  1X84 A;  2VNP A;  5GHJ A;  4S2W A;  3X0Q A;  3MDI A;  5ANW A;  5FSM A;  1SU2 A;  3HHJ A;  5DEQ A;  2B06 A;  2DSC A;  1V8L A;  5ANU A;  5FSI A;  4C9W A;  3QSJ A;  2O1C A;  2A8T A;  3GWY A;  1RYA A;  4IJX A;  5GHN A;  3E57 A;  3EF5 A;  3F6A A;  2YVM A;  4NFW A;  3X0R A;  3X0M A;  5IW5 A;  1HX3 A;  1K26 A;  2GT4 A;  3OGA A;  1Q33 A;  2YYH A;  3DKU A;  3X0L A;  3Q93 A;  3CNG A;  2A8R A;  1Q54 A;  3L85 A;  1V8I A;  4N1U A;  1G0S A;  1VC8 A;  5GHP A;  1GA7 A;  1V8T A;  3N9U A;  3ID9 A;  2QJT A;  4KTB A;  3RH7 A;  5GHI A;  3Q2S A;  5ISY A;  3A6T A;  3BM4 A;  1VK6 A;  3HYQ A;  1KHZ A;  1NQY A;  3R03 A;  1VIQ A;  2B2K A;  4KG4 A;  2ICJ A;  3BAP A;  2CZR A;  1MQE A;  3O52 A;  3U53 A;  2DHO A;  2QKM B;  1V8M A;  3EES A;  2B0V A;  2DSD A;  1VHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...