2AZWA

Crystal structure of the mutt/nudix family protein from enterococcus faecalis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
146
Chain Sequence
b'KTPTFGKREETLTYQTRYAAYIIVSKPENNTMVLVQAPNGAYFLPGGEIEGTETKEEAIHREVLEELGISVEIGCYLGEADEYFYSNHRQTAYYNPGYFYVANTWRQLSEPLRTNTLHWVAPEEAVRLLKRGSHRWAVEKWLAAAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title The 1.9A crystal structure of the MutT/nudix family protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 39
structure length 146
sequence length 147
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2azwA00
1TUMA 3I7VA 3R03A 4N1UA 3QSJA 2A8QA 3X0KA 1XSCA 1VCDA 2ICKA 3O69A 1NQYA 2GT4A 3EEUA 2Q9PA 3AC9A 1PUQA 3ACAA 3N9UA 4S2VA 3O52A 3GZ5A 1G9QA 5FSLA 3Q2TA 2DSBA 1G0SA 3HHJA 5HZXA 3P6YA 1SZ3A 5ANWA 3Q4IA 4NFWA 3X0RA 3X0JA 2QKMB 1V8YA 1V8LA 3X0SA 5I8UA 3SMDA 3FFUA 2I8TA 4V14A 1I9AA 4S2YA 3X0IA 1IRYA 1V8WA 1VK6A 3SHDA 1HZTA 3P5TA 2VNQA 1PPXA 5GHPA 3RH7A 3Q93A 3F6AA 1U20A 1VHGA 1RYAA 1V8UA 1VC8A 3A6VA 2PQVA 3H95A 5GHJA 1KTGA 4KG4A 4NFXA 1GA7A 2YVPA 3EF5A 1SU2A 1X51A 2O1CA 4JZSA 3MDGA 1V8VA 3GG6A 2G74A 2O5WA 1Q27A 3BAPA 3BHOA 3L85A 2A6TA 1MP2A 3HYQA 5FSNA 1RRQA 1VRLA 1SJYA 1Q54A 1JRKA 5GHNA 1PVFA 4S2WA 1PUNA 1V8TA 4C9XA 2A8SA 5FSKA 5IW5A 3DUPA 1RRSA 3ZR1A 5ANSA 3DKUA 3WHWA 1JKNA 3U53A 5CFJA 3FK9A 2B0VA 3O8SA 2A8RA 1MR2A 5ANUA 3A6TA 3SONA 2GT2A 4KYXA 3ZR0A 1R67A 3A6UA 5C8LA 5CFIA 1PPWA 2DHOA 3X0OA 5BS6A 2A8TA 1K26A 1VHZA 1MQWA 1OW2A 5FSOA 4N1TA 2R5WA 3A6SA 3J7Ye 1V8RA 1VIUA 1NQZA 2A8PA 1SOIA 2CL3A 3E57A 4HVYA 4K6EA 1Q33A 2G73A 2JVBA 3FJYA 5FSIA 1X83A 3GZ8A 2AZWA 2VNPA 3EESA 3GRNA 3KVHA 3MGMA 5DDGA 1V8SA 2ICJA 5IW4A 5DEQA 3FSPA 1MUTA 3EXQA 1NFZA 5GHQA 3ID9A 5C7QA 3GZ6A 2QJOA 2DSDA 3MDIA 5C7TA 5DD4A 1XSAA 1V8IA 3COUA 4ILQA 3Q1PA 4C9WA 1VIQA 1XSBA 2YVNA 2YVMA 2GB5A 1MK1A 3Q91A 1PUSA 2FVVA 5LPGA 3F13A 3X0NA 2QJTA 1NFSA 1KT9A 3FCMA 4KG3A 4IJXA 5GHIA 4S2XA 1V8MA 2W4EA 2J8QA 3O61A 3OGAA 3GWYA 4JZTA 4HFQA 4ICKA 3X0PA 3G0QA 3N77A 2FMLA 5ISYA 4YOQA 1MQEA 1V8NA 1K2EA 5FSMA 4JZVA 1F3YA 1KHZA 2FKBA 2KDVA 3O6ZA 5GHMA 4YPRA 3MCFA 2YYHA 3I9XA 2DSCA 4MPOA 2YVOA 1PPVA 5ANTA 2B2KA 5DPKA 3X0LA 2RRKA 1VC9A 2O5FA 4KTBA 3I7UA 2B06A 2I8UA 5GHOA 3X0MA 2KDWA 5ANVA 4JZUA 2PNYA 1HX3A 3CNGA 2XSQA 3X0QA 4ZG0A 1X84A 5BONA 4YPHA 3BM4A 1QVJA 3Q2SA 2DUKA 2I6KA 4DYWA
chains in the Genus database with same CATH superfamily
1TUMA 3I7VA 3R03A 4N1UA 3QSJA 2A8QA 3X0KA 1XSCA 1VCDA 2ICKA 3O69A 1NQYA 2GT4A 3EEUA 2Q9PA 3AC9A 1PUQA 3ACAA 3N9UA 4S2VA 3O52A 3GZ5A 1G9QA 5FSLA 3Q2TA 2DSBA 1G0SA 3HHJA 5HZXA 3P6YA 1SZ3A 5ANWA 3Q4IA 4NFWA 3X0RA 3X0JA 2QKMB 1V8YA 1V8LA 3X0SA 5I8UA 3SMDA 3FFUA 2I8TA 4V14A 1I9AA 2CZRA 3X0IA 4S2YA 1IRYA 1V8WA 1VK6A 3SHDA 1HZTA 3P5TA 2VNQA 1PPXA 5GHPA 3RH7A 3Q93A 3F6AA 1U20A 1VHGA 1RYAA 1V8UA 1VC8A 3A6VA 2PQVA 3H95A 5GHJA 1KTGA 4KG4A 4NFXA 1GA7A 2YVPA 3EF5A 1SU2A 1X51A 2O1CA 4JZSA 3MDGA 1V8VA 3GG6A 4J7HA 2G74A 2O5WA 1Q27A 3BAPA 3BHOA 3L85A 2A6TA 1MP2A 3HYQA 5FSNA 1RRQA 1VRLA 1SJYA 1Q54A 1JRKA 5GHNA 1PVFA 4S2WA 1PUNA 1V8TA 4C9XA 2A8SA 5FSKA 5IW5A 3DUPA 1RRSA 3ZR1A 5ANSA 3DKUA 3WHWA 1JKNA 3U53A 5CFJA 3FK9A 2B0VA 3O8SA 2A8RA 1MR2A 5ANUA 3A6TA 3SONA 2GT2A 4KYXA 3ZR0A 1R67A 3A6UA 5C8LA 5CFIA 1PPWA 2DHOA 3X0OA 5BS6A 2A8TA 1K26A 1VHZA 1MQWA 1OW2A 5FSOA 4N1TA 2R5WA 3A6SA 3J7Ye 1V8RA 1VIUA 1NQZA 2A8PA 1SOIA 2CL3A 3E57A 4HVYA 4K6EA 1Q33A 2G73A 2JVBA 3FJYA 5FSIA 1X83A 3GZ8A 2AZWA 2VNPA 3EESA 3GRNA 3KVHA 3MGMA 5DDGA 1V8SA 2ICJA 5IW4A 5DEQA 3FSPA 1MUTA 3EXQA 1NFZA 5GHQA 3ID9A 5C7QA 3GZ6A 2QJOA 2DSDA 3MDIA 5C7TA 5DD4A 1XSAA 1V8IA 3COUA 4ILQA 3Q1PA 4C9WA 1VIQA 1XSBA 2YVNA 2YVMA 2GB5A 1MK1A 3Q91A 1PUSA 2FVVA 5LPGA 3F13A 3X0NA 2QJTA 1NFSA 1KT9A 3FCMA 4KG3A 4IJXA 5GHIA 4S2XA 1V8MA 2W4EA 2J8QA 3O61A 3OGAA 3GWYA 4JZTA 4HFQA 4ICKA 3X0PA 3G0QA 3N77A 2FMLA 5ISYA 4YOQA 1MQEA 1V8NA 1K2EA 5FSMA 4JZVA 1F3YA 1KHZA 2FKBA 2KDVA 3O6ZA 5GHMA 4YPRA 3MCFA 2YYHA 3I9XA 2DSCA 4MPOA 2YVOA 1PPVA 5ANTA 2B2KA 5DPKA 3X0LA 2RRKA 1VC9A 2O5FA 4KTBA 3I7UA 2B06A 2I8UA 5GHOA 3X0MA 2KDWA 5ANVA 4J7GA 4JZUA 2PNYA 1HX3A 3CNGA 2XSQA 3X0QA 4ZG0A 1X84A 5BONA 4YPHA 3BM4A 1QVJA 3Q2SA 2DUKA 2I6KA 4DYWA
chains in the Genus database with same CATH topology
1TUMA 3I7VA 3R03A 4N1UA 3QSJA 2A8QA 3X0KA 1XSCA 1VCDA 2ICKA 3O69A 1NQYA 2GT4A 3EEUA 2Q9PA 3AC9A 1PUQA 3ACAA 3N9UA 4S2VA 3O52A 3GZ5A 1G9QA 5FSLA 3Q2TA 2DSBA 1G0SA 3HHJA 5HZXA 3P6YA 1SZ3A 5ANWA 3Q4IA 4NFWA 3X0RA 3X0JA 2QKMB 1V8YA 1V8LA 3X0SA 5I8UA 3SMDA 3FFUA 2I8TA 4V14A 1I9AA 2CZRA 3X0IA 4S2YA 1IRYA 1V8WA 1VK6A 3SHDA 1HZTA 3P5TA 2VNQA 1PPXA 5GHPA 3RH7A 3Q93A 3F6AA 1U20A 1VHGA 1RYAA 1V8UA 1VC8A 3A6VA 2PQVA 3H95A 5GHJA 1KTGA 4KG4A 4NFXA 1GA7A 2YVPA 3EF5A 1SU2A 1X51A 2O1CA 4JZSA 3MDGA 1V8VA 3GG6A 4J7HA 2G74A 2O5WA 1Q27A 3BAPA 3BHOA 3L85A 2A6TA 1MP2A 3HYQA 5FSNA 1RRQA 1VRLA 1SJYA 1Q54A 1JRKA 5GHNA 1PVFA 4S2WA 1PUNA 1V8TA 4C9XA 2A8SA 5FSKA 5IW5A 3DUPA 1RRSA 3ZR1A 5ANSA 3DKUA 3WHWA 1JKNA 3U53A 5CFJA 3FK9A 2B0VA 3O8SA 2A8RA 1MR2A 5ANUA 3A6TA 3SONA 2GT2A 4KYXA 3ZR0A 1R67A 3A6UA 5C8LA 5CFIA 1PPWA 2DHOA 3X0OA 5BS6A 2A8TA 1K26A 1VHZA 1MQWA 1OW2A 5FSOA 4N1TA 2R5WA 3A6SA 3J7Ye 1V8RA 1VIUA 1NQZA 2A8PA 1SOIA 2CL3A 3E57A 4HVYA 4K6EA 1Q33A 2G73A 2JVBA 3FJYA 5FSIA 1X83A 3GZ8A 2AZWA 2VNPA 3EESA 3GRNA 3KVHA 3MGMA 5DDGA 1V8SA 2ICJA 5IW4A 5DEQA 3FSPA 1MUTA 3EXQA 1NFZA 5GHQA 3ID9A 5C7QA 3GZ6A 2QJOA 2DSDA 3MDIA 5C7TA 5DD4A 1XSAA 1V8IA 3COUA 4ILQA 3Q1PA 4C9WA 1VIQA 1XSBA 2YVNA 2YVMA 2GB5A 1MK1A 3Q91A 1PUSA 2FVVA 5LPGA 3F13A 3X0NA 2QJTA 1NFSA 1KT9A 3FCMA 4KG3A 4IJXA 5GHIA 4S2XA 1V8MA 2W4EA 2J8QA 3O61A 3OGAA 3GWYA 4JZTA 4HFQA 4ICKA 3X0PA 3G0QA 3N77A 2FMLA 5ISYA 4YOQA 1MQEA 1V8NA 1K2EA 5FSMA 4JZVA 1F3YA 1KHZA 2FKBA 2KDVA 3O6ZA 5GHMA 4YPRA 3MCFA 2YYHA 3I9XA 2DSCA 4MPOA 2YVOA 1PPVA 5ANTA 2B2KA 5DPKA 3X0LA 2RRKA 1VC9A 2O5FA 4KTBA 3I7UA 2B06A 2I8UA 5GHOA 3X0MA 2KDWA 5ANVA 4J7GA 4JZUA 2PNYA 1HX3A 3CNGA 2XSQA 3X0QA 4ZG0A 1X84A 5BONA 4YPHA 3BM4A 1QVJA 3Q2SA 2DUKA 2I6KA 4DYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUM A;  3I7V A;  3R03 A;  4N1U A;  3QSJ A;  2A8Q A;  3X0K A;  1XSC A;  1VCD A;  2ICK A;  3O69 A;  1NQY A;  2GT4 A;  3EEU A;  2Q9P A;  3AC9 A;  1PUQ A;  3ACA A;  3N9U A;  4S2V A;  3O52 A;  3GZ5 A;  1G9Q A;  5FSL A;  3Q2T A;  2DSB A;  1G0S A;  3HHJ A;  5HZX A;  3P6Y A;  1SZ3 A;  5ANW A;  3Q4I A;  4NFW A;  3X0R A;  3X0J A;  2QKM B;  1V8Y A;  1V8L A;  3X0S A;  5I8U A;  3SMD A;  3FFU A;  2I8T A;  4V14 A;  1I9A A;  4S2Y A;  3X0I A;  1IRY A;  1V8W A;  1VK6 A;  3SHD A;  1HZT A;  3P5T A;  2VNQ A;  1PPX A;  5GHP A;  3RH7 A;  3Q93 A;  3F6A A;  1U20 A;  1VHG A;  1RYA A;  1V8U A;  1VC8 A;  3A6V A;  2PQV A;  3H95 A;  5GHJ A;  1KTG A;  4KG4 A;  4NFX A;  1GA7 A;  2YVP A;  3EF5 A;  1SU2 A;  1X51 A;  2O1C A;  4JZS A;  3MDG A;  1V8V A;  3GG6 A;  2G74 A;  2O5W A;  1Q27 A;  3BAP A;  3BHO A;  3L85 A;  2A6T A;  1MP2 A;  3HYQ A;  5FSN A;  1RRQ A;  1VRL A;  1SJY A;  1Q54 A;  1JRK A;  5GHN A;  1PVF A;  4S2W A;  1PUN A;  1V8T A;  4C9X A;  2A8S A;  5FSK A;  5IW5 A;  3DUP A;  1RRS A;  3ZR1 A;  5ANS A;  3DKU A;  3WHW A;  1JKN A;  3U53 A;  5CFJ A;  3FK9 A;  2B0V A;  3O8S A;  2A8R A;  1MR2 A;  5ANU A;  3A6T A;  3SON A;  2GT2 A;  4KYX A;  3ZR0 A;  1R67 A;  3A6U A;  5C8L A;  5CFI A;  1PPW A;  2DHO A;  3X0O A;  5BS6 A;  2A8T A;  1K26 A;  1VHZ A;  1MQW A;  1OW2 A;  5FSO A;  4N1T A;  2R5W A;  3A6S A;  3J7Y e;  1V8R A;  1VIU A;  1NQZ A;  2A8P A;  1SOI A;  2CL3 A;  3E57 A;  4HVY A;  4K6E A;  1Q33 A;  2G73 A;  2JVB A;  3FJY A;  5FSI A;  1X83 A;  3GZ8 A;  2AZW A;  2VNP A;  3EES A;  3GRN A;  3KVH A;  3MGM A;  5DDG A;  1V8S A;  2ICJ A;  5IW4 A;  5DEQ A;  3FSP A;  1MUT A;  3EXQ A;  1NFZ A;  5GHQ A;  3ID9 A;  5C7Q A;  3GZ6 A;  2QJO A;  2DSD A;  3MDI A;  5C7T A;  5DD4 A;  1XSA A;  1V8I A;  3COU A;  4ILQ A;  3Q1P A;  4C9W A;  1VIQ A;  1XSB A;  2YVN A;  2YVM A;  2GB5 A;  1MK1 A;  3Q91 A;  1PUS A;  2FVV A;  5LPG A;  3F13 A;  3X0N A;  2QJT A;  1NFS A;  1KT9 A;  3FCM A;  4KG3 A;  4IJX A;  5GHI A;  4S2X A;  1V8M A;  2W4E A;  2J8Q A;  3O61 A;  3OGA A;  3GWY A;  4JZT A;  4HFQ A;  4ICK A;  3X0P A;  3G0Q A;  3N77 A;  2FML A;  5ISY A;  4YOQ A;  1MQE A;  1V8N A;  1K2E A;  5FSM A;  4JZV A;  1F3Y A;  1KHZ A;  2FKB A;  2KDV A;  3O6Z A;  5GHM A;  4YPR A;  3MCF A;  2YYH A;  3I9X A;  2DSC A;  4MPO A;  2YVO A;  1PPV A;  5ANT A;  2B2K A;  5DPK A;  3X0L A;  2RRK A;  1VC9 A;  2O5F A;  4KTB A;  3I7U A;  2B06 A;  2I8U A;  5GHO A;  3X0M A;  2KDW A;  5ANV A;  4JZU A;  2PNY A;  1HX3 A;  3CNG A;  2XSQ A;  3X0Q A;  4ZG0 A;  1X84 A;  5BON A;  4YPH A;  3BM4 A;  1QVJ A;  3Q2S A;  2DUK A;  2I6K A;  4DYW A; 
#chains in the Genus database with same CATH topology
 1TUM A;  3I7V A;  3R03 A;  4N1U A;  3QSJ A;  2A8Q A;  3X0K A;  1XSC A;  1VCD A;  2ICK A;  3O69 A;  1NQY A;  2GT4 A;  3EEU A;  2Q9P A;  3AC9 A;  1PUQ A;  3ACA A;  3N9U A;  4S2V A;  3O52 A;  3GZ5 A;  1G9Q A;  5FSL A;  3Q2T A;  2DSB A;  1G0S A;  3HHJ A;  5HZX A;  3P6Y A;  1SZ3 A;  5ANW A;  3Q4I A;  4NFW A;  3X0R A;  3X0J A;  2QKM B;  1V8Y A;  1V8L A;  3X0S A;  5I8U A;  3SMD A;  3FFU A;  2I8T A;  4V14 A;  1I9A A;  2CZR A;  3X0I A;  4S2Y A;  1IRY A;  1V8W A;  1VK6 A;  3SHD A;  1HZT A;  3P5T A;  2VNQ A;  1PPX A;  5GHP A;  3RH7 A;  3Q93 A;  3F6A A;  1U20 A;  1VHG A;  1RYA A;  1V8U A;  1VC8 A;  3A6V A;  2PQV A;  3H95 A;  5GHJ A;  1KTG A;  4KG4 A;  4NFX A;  1GA7 A;  2YVP A;  3EF5 A;  1SU2 A;  1X51 A;  2O1C A;  4JZS A;  3MDG A;  1V8V A;  3GG6 A;  4J7H A;  2G74 A;  2O5W A;  1Q27 A;  3BAP A;  3BHO A;  3L85 A;  2A6T A;  1MP2 A;  3HYQ A;  5FSN A;  1RRQ A;  1VRL A;  1SJY A;  1Q54 A;  1JRK A;  5GHN A;  1PVF A;  4S2W A;  1PUN A;  1V8T A;  4C9X A;  2A8S A;  5FSK A;  5IW5 A;  3DUP A;  1RRS A;  3ZR1 A;  5ANS A;  3DKU A;  3WHW A;  1JKN A;  3U53 A;  5CFJ A;  3FK9 A;  2B0V A;  3O8S A;  2A8R A;  1MR2 A;  5ANU A;  3A6T A;  3SON A;  2GT2 A;  4KYX A;  3ZR0 A;  1R67 A;  3A6U A;  5C8L A;  5CFI A;  1PPW A;  2DHO A;  3X0O A;  5BS6 A;  2A8T A;  1K26 A;  1VHZ A;  1MQW A;  1OW2 A;  5FSO A;  4N1T A;  2R5W A;  3A6S A;  3J7Y e;  1V8R A;  1VIU A;  1NQZ A;  2A8P A;  1SOI A;  2CL3 A;  3E57 A;  4HVY A;  4K6E A;  1Q33 A;  2G73 A;  2JVB A;  3FJY A;  5FSI A;  1X83 A;  3GZ8 A;  2AZW A;  2VNP A;  3EES A;  3GRN A;  3KVH A;  3MGM A;  5DDG A;  1V8S A;  2ICJ A;  5IW4 A;  5DEQ A;  3FSP A;  1MUT A;  3EXQ A;  1NFZ A;  5GHQ A;  3ID9 A;  5C7Q A;  3GZ6 A;  2QJO A;  2DSD A;  3MDI A;  5C7T A;  5DD4 A;  1XSA A;  1V8I A;  3COU A;  4ILQ A;  3Q1P A;  4C9W A;  1VIQ A;  1XSB A;  2YVN A;  2YVM A;  2GB5 A;  1MK1 A;  3Q91 A;  1PUS A;  2FVV A;  5LPG A;  3F13 A;  3X0N A;  2QJT A;  1NFS A;  1KT9 A;  3FCM A;  4KG3 A;  4IJX A;  5GHI A;  4S2X A;  1V8M A;  2W4E A;  2J8Q A;  3O61 A;  3OGA A;  3GWY A;  4JZT A;  4HFQ A;  4ICK A;  3X0P A;  3G0Q A;  3N77 A;  2FML A;  5ISY A;  4YOQ A;  1MQE A;  1V8N A;  1K2E A;  5FSM A;  4JZV A;  1F3Y A;  1KHZ A;  2FKB A;  2KDV A;  3O6Z A;  5GHM A;  4YPR A;  3MCF A;  2YYH A;  3I9X A;  2DSC A;  4MPO A;  2YVO A;  1PPV A;  5ANT A;  2B2K A;  5DPK A;  3X0L A;  2RRK A;  1VC9 A;  2O5F A;  4KTB A;  3I7U A;  2B06 A;  2I8U A;  5GHO A;  3X0M A;  2KDW A;  5ANV A;  4J7G A;  4JZU A;  2PNY A;  1HX3 A;  3CNG A;  2XSQ A;  3X0Q A;  4ZG0 A;  1X84 A;  5BON A;  4YPH A;  3BM4 A;  1QVJ A;  3Q2S A;  2DUK A;  2I6K A;  4DYW A; 
#chains in the Genus database with same CATH homology
 1TUM A;  3I7V A;  3R03 A;  4N1U A;  3QSJ A;  2A8Q A;  3X0K A;  1XSC A;  1VCD A;  2ICK A;  3O69 A;  1NQY A;  2GT4 A;  3EEU A;  2Q9P A;  3AC9 A;  1PUQ A;  3ACA A;  3N9U A;  4S2V A;  3O52 A;  3GZ5 A;  1G9Q A;  5FSL A;  3Q2T A;  2DSB A;  1G0S A;  3HHJ A;  5HZX A;  3P6Y A;  1SZ3 A;  5ANW A;  3Q4I A;  4NFW A;  3X0R A;  3X0J A;  2QKM B;  1V8Y A;  1V8L A;  3X0S A;  5I8U A;  3SMD A;  3FFU A;  2I8T A;  4V14 A;  1I9A A;  2CZR A;  3X0I A;  4S2Y A;  1IRY A;  1V8W A;  1VK6 A;  3SHD A;  1HZT A;  3P5T A;  2VNQ A;  1PPX A;  5GHP A;  3RH7 A;  3Q93 A;  3F6A A;  1U20 A;  1VHG A;  1RYA A;  1V8U A;  1VC8 A;  3A6V A;  2PQV A;  3H95 A;  5GHJ A;  1KTG A;  4KG4 A;  4NFX A;  1GA7 A;  2YVP A;  3EF5 A;  1SU2 A;  1X51 A;  2O1C A;  4JZS A;  3MDG A;  1V8V A;  3GG6 A;  4J7H A;  2G74 A;  2O5W A;  1Q27 A;  3BAP A;  3BHO A;  3L85 A;  2A6T A;  1MP2 A;  3HYQ A;  5FSN A;  1RRQ A;  1VRL A;  1SJY A;  1Q54 A;  1JRK A;  5GHN A;  1PVF A;  4S2W A;  1PUN A;  1V8T A;  4C9X A;  2A8S A;  5FSK A;  5IW5 A;  3DUP A;  1RRS A;  3ZR1 A;  5ANS A;  3DKU A;  3WHW A;  1JKN A;  3U53 A;  5CFJ A;  3FK9 A;  2B0V A;  3O8S A;  2A8R A;  1MR2 A;  5ANU A;  3A6T A;  3SON A;  2GT2 A;  4KYX A;  3ZR0 A;  1R67 A;  3A6U A;  5C8L A;  5CFI A;  1PPW A;  2DHO A;  3X0O A;  5BS6 A;  2A8T A;  1K26 A;  1VHZ A;  1MQW A;  1OW2 A;  5FSO A;  4N1T A;  2R5W A;  3A6S A;  3J7Y e;  1V8R A;  1VIU A;  1NQZ A;  2A8P A;  1SOI A;  2CL3 A;  3E57 A;  4HVY A;  4K6E A;  1Q33 A;  2G73 A;  2JVB A;  3FJY A;  5FSI A;  1X83 A;  3GZ8 A;  2AZW A;  2VNP A;  3EES A;  3GRN A;  3KVH A;  3MGM A;  5DDG A;  1V8S A;  2ICJ A;  5IW4 A;  5DEQ A;  3FSP A;  1MUT A;  3EXQ A;  1NFZ A;  5GHQ A;  3ID9 A;  5C7Q A;  3GZ6 A;  2QJO A;  2DSD A;  3MDI A;  5C7T A;  5DD4 A;  1XSA A;  1V8I A;  3COU A;  4ILQ A;  3Q1P A;  4C9W A;  1VIQ A;  1XSB A;  2YVN A;  2YVM A;  2GB5 A;  1MK1 A;  3Q91 A;  1PUS A;  2FVV A;  5LPG A;  3F13 A;  3X0N A;  2QJT A;  1NFS A;  1KT9 A;  3FCM A;  4KG3 A;  4IJX A;  5GHI A;  4S2X A;  1V8M A;  2W4E A;  2J8Q A;  3O61 A;  3OGA A;  3GWY A;  4JZT A;  4HFQ A;  4ICK A;  3X0P A;  3G0Q A;  3N77 A;  2FML A;  5ISY A;  4YOQ A;  1MQE A;  1V8N A;  1K2E A;  5FSM A;  4JZV A;  1F3Y A;  1KHZ A;  2FKB A;  2KDV A;  3O6Z A;  5GHM A;  4YPR A;  3MCF A;  2YYH A;  3I9X A;  2DSC A;  4MPO A;  2YVO A;  1PPV A;  5ANT A;  2B2K A;  5DPK A;  3X0L A;  2RRK A;  1VC9 A;  2O5F A;  4KTB A;  3I7U A;  2B06 A;  2I8U A;  5GHO A;  3X0M A;  2KDW A;  5ANV A;  4J7G A;  4JZU A;  2PNY A;  1HX3 A;  3CNG A;  2XSQ A;  3X0Q A;  4ZG0 A;  1X84 A;  5BON A;  4YPH A;  3BM4 A;  1QVJ A;  3Q2S A;  2DUK A;  2I6K A;  4DYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...