2AZWA

Crystal structure of the mutt/nudix family protein from enterococcus faecalis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
146
Chain Sequence
KTPTFGKREETLTYQTRYAAYIIVSKPENNTMVLVQAPNGAYFLPGGEIEGTETKEEAIHREVLEELGISVEIGCYLGEADEYFYSNHRQTAYYNPGYFYVANTWRQLSEPLRTNTLHWVAPEEAVRLLKRGSHRWAVEKWLAAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title The 1.9A crystal structure of the MutT/nudix family protein from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 39
structure length 146
sequence length 147
ec nomenclature
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2azwA00
3EESA 2RRKA 1VK6A 1SJYA 5HZXA 1NQYA 2QJOA 3GRNA 5ANSA 3X0NA 2QKMB 1X84A 1K26A 3Q4IA 2A8PA 3O6ZA 1V8IA 1JRKA 2AZWA 4V14A 5ANWA 1GA7A 1MP2A 1NFZA 2DUKA 2G73A 3E57A 3FFUA 2XSQA 5FSOA 1HZTA 1R67A 1XSAA 3COUA 4JZVA 1MUTA 5I8UA 3DKUA 1PUQA 2YVNA 5FSMA 2DHOA 2CL3A 3GZ8A 1MQWA 3AC9A 3X0PA 5ANUA 2PQVA 3N9UA 1VC8A 1V8RA 4ICKA 2PNYA 5GHOA 5FSNA 3ID9A 4K6EA 2I8TA 3I9XA 2YVOA 2GB5A 5ANVA 5GHQA 5DPKA 2GT4A 4JZSA 4S2WA 2DSBA 2YYHA 3I7VA 2A8TA 2G74A 1PUNA 1KTGA 1Q54A 3H95A 1HX3A 3L85A 2A8RA 4YPHA 2QJTA 1MR2A 1QVJA 3Q2TA 1XSBA 3ZR0A 1VIQA 2KDVA 5DEQA 4JZTA 2KDWA 5FSLA 5GHMA 1RRQA 4NFWA 3A6UA 3U53A 1PPVA 3BM4A 2J8QA 3GG6A 1OW2A 5FSKA 1G9QA 4S2VA 1NFSA 1X83A 1K2EA 3ACAA 3DUPA 3Q2SA 4KYXA 5ANTA 4ZG0A 4JZUA 1Q27A 5FSIA 3WHWA 2O5FA 4IJXA 2B2KA 3X0RA 3A6VA 3EEUA 4MPOA 2Q9PA 1SOIA 3G0QA 5CFIA 3FJYA 3X0SA 5IW5A 3FSPA 3GZ6A 1F3YA 3X0OA 2ICJA 2DSDA 4HFQA 2FMLA 1VHZA 4C9XA 3GWYA 2I8UA 1I9AA 4S2YA 3X0LA 1V8LA 3SMDA 4NFXA 3N77A 3J7Ye 4YPRA 5ISYA 5LPGA 1X51A 1G0SA 4KG4A 1XSCA 1V8YA 1TUMA 1V8WA 3QSJA 2B0VA 1V8MA 3HYQA 3X0JA 1SU2A 1V8TA 4KTBA 2ICKA 1V8SA 1U20A 1RRSA 3I7UA 1PPWA 3CNGA 1MQEA 2DSCA 1V8NA 2W4EA 1RYAA 5C7QA 5C7TA 3MCFA 4DYWA 1PUSA 1VCDA 1VIUA 2GT2A 3F13A 3P6YA 3EF5A 3X0KA 3FK9A 2JVBA 2R5WA 1NQZA 3O69A 5GHJA 1IRYA 4C9WA 2YVMA 3BHOA 3Q93A 5BS6A 3HHJA 1PPXA 3A6SA 5CFJA 3O61A 1V8UA 5IW4A 1SZ3A 3RH7A 3SHDA 4YOQA 2VNPA 2YVPA 3MGMA 3GZ5A 1KT9A 3SONA 3O8SA 2FKBA 4KG3A 3BAPA 3MDGA 3X0IA 1JKNA 3FCMA 5BONA 2B06A 3R03A 3X0QA 3Q1PA 1V8VA 2A8QA 2O1CA 5GHNA 3EXQA 5GHPA 3O52A 2VNQA 3OGAA 3Q91A 1PVFA 4S2XA 3P5TA 2O5WA 3MDIA 5C8LA 1VRLA 4ILQA 4HVYA 3F6AA 1MK1A 1Q33A 3KVHA 3ZR1A 4N1UA 3X0MA 1VC9A 2I6KA 3A6TA 5DDGA 1KHZA 2FVVA 5DD4A 2A6TA 4N1TA 5GHIA 1VHGA 2A8SA
chains in the Genus database with same CATH superfamily
3EESA 4J7GA 2RRKA 1VK6A 1SJYA 5HZXA 1NQYA 2QJOA 3GRNA 5ANSA 3X0NA 2QKMB 1X84A 1K26A 3Q4IA 2A8PA 3O6ZA 1V8IA 1JRKA 2AZWA 4V14A 5ANWA 1GA7A 1MP2A 1NFZA 2DUKA 2G73A 3E57A 3FFUA 4J7HA 2XSQA 5FSOA 1HZTA 1R67A 1XSAA 3COUA 4JZVA 1MUTA 5I8UA 3DKUA 1PUQA 2YVNA 5FSMA 2DHOA 2CL3A 3GZ8A 1MQWA 3AC9A 3X0PA 5ANUA 2PQVA 3N9UA 1VC8A 1V8RA 4ICKA 2PNYA 5GHOA 5FSNA 3ID9A 4K6EA 2I8TA 3I9XA 2YVOA 2GB5A 5ANVA 5GHQA 5DPKA 2GT4A 4JZSA 4S2WA 2DSBA 2YYHA 3I7VA 2A8TA 2G74A 1PUNA 1KTGA 1Q54A 3H95A 1HX3A 3L85A 2A8RA 4YPHA 2CZRA 1MR2A 1QVJA 2QJTA 3Q2TA 1XSBA 3ZR0A 1VIQA 2KDVA 5DEQA 4JZTA 2KDWA 5FSLA 5GHMA 1RRQA 4NFWA 3A6UA 3U53A 1PPVA 3BM4A 2J8QA 3GG6A 1OW2A 5FSKA 1G9QA 4S2VA 1NFSA 1X83A 1K2EA 3ACAA 3DUPA 3Q2SA 4KYXA 5ANTA 4ZG0A 4JZUA 1Q27A 5FSIA 3WHWA 2O5FA 4IJXA 2B2KA 3X0RA 3A6VA 3EEUA 4MPOA 2Q9PA 1SOIA 3G0QA 5CFIA 3FJYA 3X0SA 5IW5A 3FSPA 3GZ6A 1F3YA 3X0OA 2ICJA 2DSDA 4HFQA 2FMLA 1VHZA 4C9XA 3GWYA 2I8UA 1I9AA 4S2YA 3X0LA 1V8LA 3SMDA 4NFXA 3N77A 3J7Ye 4YPRA 5ISYA 5LPGA 1X51A 1G0SA 4KG4A 1XSCA 1V8YA 1TUMA 1V8WA 3QSJA 2B0VA 1V8MA 3HYQA 3X0JA 1SU2A 1V8TA 4KTBA 2ICKA 1V8SA 1U20A 1RRSA 3I7UA 1PPWA 3CNGA 1MQEA 2DSCA 1V8NA 2W4EA 1RYAA 5C7QA 5C7TA 3MCFA 4DYWA 1PUSA 1VCDA 1VIUA 2GT2A 3F13A 3P6YA 3EF5A 3X0KA 3FK9A 2JVBA 2R5WA 1NQZA 3O69A 5GHJA 1IRYA 4C9WA 2YVMA 3BHOA 3Q93A 5BS6A 3HHJA 1PPXA 3A6SA 5CFJA 3O61A 1V8UA 5IW4A 1SZ3A 3RH7A 3SHDA 4YOQA 2VNPA 2YVPA 3MGMA 3GZ5A 1KT9A 3SONA 3O8SA 2FKBA 4KG3A 3BAPA 3MDGA 3X0IA 1JKNA 3FCMA 5BONA 2B06A 3R03A 3X0QA 3Q1PA 1V8VA 2A8QA 2O1CA 5GHNA 3EXQA 5GHPA 3O52A 2VNQA 3OGAA 3Q91A 1PVFA 4S2XA 3P5TA 2O5WA 3MDIA 5C8LA 1VRLA 4ILQA 4HVYA 3F6AA 1MK1A 1Q33A 3KVHA 3ZR1A 4N1UA 3X0MA 1VC9A 2I6KA 3A6TA 5DDGA 1KHZA 2FVVA 5DD4A 2A6TA 4N1TA 5GHIA 1VHGA 2A8SA
chains in the Genus database with same CATH topology
3EESA 4J7GA 2RRKA 1VK6A 1SJYA 5HZXA 1NQYA 2QJOA 3GRNA 5ANSA 3X0NA 2QKMB 1X84A 1K26A 3Q4IA 2A8PA 3O6ZA 1V8IA 1JRKA 2AZWA 4V14A 5ANWA 1GA7A 1MP2A 1NFZA 2DUKA 2G73A 3E57A 3FFUA 4J7HA 2XSQA 5FSOA 1HZTA 1R67A 1XSAA 3COUA 4JZVA 1MUTA 5I8UA 3DKUA 1PUQA 2YVNA 5FSMA 2DHOA 2CL3A 3GZ8A 1MQWA 3AC9A 3X0PA 5ANUA 2PQVA 3N9UA 1VC8A 1V8RA 4ICKA 2PNYA 5GHOA 5FSNA 3ID9A 4K6EA 2I8TA 3I9XA 2YVOA 2GB5A 5ANVA 5GHQA 5DPKA 2GT4A 4JZSA 4S2WA 2DSBA 2YYHA 3I7VA 2A8TA 2G74A 1PUNA 1KTGA 1Q54A 3H95A 1HX3A 3L85A 2A8RA 4YPHA 2CZRA 1MR2A 1QVJA 2QJTA 3Q2TA 1XSBA 3ZR0A 1VIQA 2KDVA 5DEQA 4JZTA 2KDWA 5FSLA 5GHMA 1RRQA 4NFWA 3A6UA 3U53A 1PPVA 3BM4A 2J8QA 3GG6A 1OW2A 5FSKA 1G9QA 4S2VA 1NFSA 1X83A 1K2EA 3ACAA 3DUPA 3Q2SA 4KYXA 5ANTA 4ZG0A 4JZUA 1Q27A 5FSIA 3WHWA 2O5FA 4IJXA 2B2KA 3X0RA 3A6VA 3EEUA 4MPOA 2Q9PA 1SOIA 3G0QA 5CFIA 3FJYA 3X0SA 5IW5A 3FSPA 3GZ6A 1F3YA 3X0OA 2ICJA 2DSDA 4HFQA 2FMLA 1VHZA 4C9XA 3GWYA 2I8UA 1I9AA 4S2YA 3X0LA 1V8LA 3SMDA 4NFXA 3N77A 3J7Ye 4YPRA 5ISYA 5LPGA 1X51A 1G0SA 4KG4A 1XSCA 1V8YA 1TUMA 1V8WA 3QSJA 2B0VA 1V8MA 3HYQA 3X0JA 1SU2A 1V8TA 4KTBA 2ICKA 1V8SA 1U20A 1RRSA 3I7UA 1PPWA 3CNGA 1MQEA 2DSCA 1V8NA 2W4EA 1RYAA 5C7QA 5C7TA 3MCFA 4DYWA 1PUSA 1VCDA 1VIUA 2GT2A 3F13A 3P6YA 3EF5A 3X0KA 3FK9A 2JVBA 2R5WA 1NQZA 3O69A 5GHJA 1IRYA 4C9WA 2YVMA 3BHOA 3Q93A 5BS6A 3HHJA 1PPXA 3A6SA 5CFJA 3O61A 1V8UA 5IW4A 1SZ3A 3RH7A 3SHDA 4YOQA 2VNPA 2YVPA 3MGMA 3GZ5A 1KT9A 3SONA 3O8SA 2FKBA 4KG3A 3BAPA 3MDGA 3X0IA 1JKNA 3FCMA 5BONA 2B06A 3R03A 3X0QA 3Q1PA 1V8VA 2A8QA 2O1CA 5GHNA 3EXQA 5GHPA 3O52A 2VNQA 3OGAA 3Q91A 1PVFA 4S2XA 3P5TA 2O5WA 3MDIA 5C8LA 1VRLA 4ILQA 4HVYA 3F6AA 1MK1A 1Q33A 3KVHA 3ZR1A 4N1UA 3X0MA 1VC9A 2I6KA 3A6TA 5DDGA 1KHZA 2FVVA 5DD4A 2A6TA 4N1TA 5GHIA 1VHGA 2A8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EES A;  2RRK A;  1VK6 A;  1SJY A;  5HZX A;  1NQY A;  2QJO A;  3GRN A;  5ANS A;  3X0N A;  2QKM B;  1X84 A;  1K26 A;  3Q4I A;  2A8P A;  3O6Z A;  1V8I A;  1JRK A;  2AZW A;  4V14 A;  5ANW A;  1GA7 A;  1MP2 A;  1NFZ A;  2DUK A;  2G73 A;  3E57 A;  3FFU A;  2XSQ A;  5FSO A;  1HZT A;  1R67 A;  1XSA A;  3COU A;  4JZV A;  1MUT A;  5I8U A;  3DKU A;  1PUQ A;  2YVN A;  5FSM A;  2DHO A;  2CL3 A;  3GZ8 A;  1MQW A;  3AC9 A;  3X0P A;  5ANU A;  2PQV A;  3N9U A;  1VC8 A;  1V8R A;  4ICK A;  2PNY A;  5GHO A;  5FSN A;  3ID9 A;  4K6E A;  2I8T A;  3I9X A;  2YVO A;  2GB5 A;  5ANV A;  5GHQ A;  5DPK A;  2GT4 A;  4JZS A;  4S2W A;  2DSB A;  2YYH A;  3I7V A;  2A8T A;  2G74 A;  1PUN A;  1KTG A;  1Q54 A;  3H95 A;  1HX3 A;  3L85 A;  2A8R A;  4YPH A;  2QJT A;  1MR2 A;  1QVJ A;  3Q2T A;  1XSB A;  3ZR0 A;  1VIQ A;  2KDV A;  5DEQ A;  4JZT A;  2KDW A;  5FSL A;  5GHM A;  1RRQ A;  4NFW A;  3A6U A;  3U53 A;  1PPV A;  3BM4 A;  2J8Q A;  3GG6 A;  1OW2 A;  5FSK A;  1G9Q A;  4S2V A;  1NFS A;  1X83 A;  1K2E A;  3ACA A;  3DUP A;  3Q2S A;  4KYX A;  5ANT A;  4ZG0 A;  4JZU A;  1Q27 A;  5FSI A;  3WHW A;  2O5F A;  4IJX A;  2B2K A;  3X0R A;  3A6V A;  3EEU A;  4MPO A;  2Q9P A;  1SOI A;  3G0Q A;  5CFI A;  3FJY A;  3X0S A;  5IW5 A;  3FSP A;  3GZ6 A;  1F3Y A;  3X0O A;  2ICJ A;  2DSD A;  4HFQ A;  2FML A;  1VHZ A;  4C9X A;  3GWY A;  2I8U A;  1I9A A;  4S2Y A;  3X0L A;  1V8L A;  3SMD A;  4NFX A;  3N77 A;  3J7Y e;  4YPR A;  5ISY A;  5LPG A;  1X51 A;  1G0S A;  4KG4 A;  1XSC A;  1V8Y A;  1TUM A;  1V8W A;  3QSJ A;  2B0V A;  1V8M A;  3HYQ A;  3X0J A;  1SU2 A;  1V8T A;  4KTB A;  2ICK A;  1V8S A;  1U20 A;  1RRS A;  3I7U A;  1PPW A;  3CNG A;  1MQE A;  2DSC A;  1V8N A;  2W4E A;  1RYA A;  5C7Q A;  5C7T A;  3MCF A;  4DYW A;  1PUS A;  1VCD A;  1VIU A;  2GT2 A;  3F13 A;  3P6Y A;  3EF5 A;  3X0K A;  3FK9 A;  2JVB A;  2R5W A;  1NQZ A;  3O69 A;  5GHJ A;  1IRY A;  4C9W A;  2YVM A;  3BHO A;  3Q93 A;  5BS6 A;  3HHJ A;  1PPX A;  3A6S A;  5CFJ A;  3O61 A;  1V8U A;  5IW4 A;  1SZ3 A;  3RH7 A;  3SHD A;  4YOQ A;  2VNP A;  2YVP A;  3MGM A;  3GZ5 A;  1KT9 A;  3SON A;  3O8S A;  2FKB A;  4KG3 A;  3BAP A;  3MDG A;  3X0I A;  1JKN A;  3FCM A;  5BON A;  2B06 A;  3R03 A;  3X0Q A;  3Q1P A;  1V8V A;  2A8Q A;  2O1C A;  5GHN A;  3EXQ A;  5GHP A;  3O52 A;  2VNQ A;  3OGA A;  3Q91 A;  1PVF A;  4S2X A;  3P5T A;  2O5W A;  3MDI A;  5C8L A;  1VRL A;  4ILQ A;  4HVY A;  3F6A A;  1MK1 A;  1Q33 A;  3KVH A;  3ZR1 A;  4N1U A;  3X0M A;  1VC9 A;  2I6K A;  3A6T A;  5DDG A;  1KHZ A;  2FVV A;  5DD4 A;  2A6T A;  4N1T A;  5GHI A;  1VHG A;  2A8S A; 
#chains in the Genus database with same CATH topology
 3EES A;  4J7G A;  2RRK A;  1VK6 A;  1SJY A;  5HZX A;  1NQY A;  2QJO A;  3GRN A;  5ANS A;  3X0N A;  2QKM B;  1X84 A;  1K26 A;  3Q4I A;  2A8P A;  3O6Z A;  1V8I A;  1JRK A;  2AZW A;  4V14 A;  5ANW A;  1GA7 A;  1MP2 A;  1NFZ A;  2DUK A;  2G73 A;  3E57 A;  3FFU A;  4J7H A;  2XSQ A;  5FSO A;  1HZT A;  1R67 A;  1XSA A;  3COU A;  4JZV A;  1MUT A;  5I8U A;  3DKU A;  1PUQ A;  2YVN A;  5FSM A;  2DHO A;  2CL3 A;  3GZ8 A;  1MQW A;  3AC9 A;  3X0P A;  5ANU A;  2PQV A;  3N9U A;  1VC8 A;  1V8R A;  4ICK A;  2PNY A;  5GHO A;  5FSN A;  3ID9 A;  4K6E A;  2I8T A;  3I9X A;  2YVO A;  2GB5 A;  5ANV A;  5GHQ A;  5DPK A;  2GT4 A;  4JZS A;  4S2W A;  2DSB A;  2YYH A;  3I7V A;  2A8T A;  2G74 A;  1PUN A;  1KTG A;  1Q54 A;  3H95 A;  1HX3 A;  3L85 A;  2A8R A;  4YPH A;  2CZR A;  1MR2 A;  1QVJ A;  2QJT A;  3Q2T A;  1XSB A;  3ZR0 A;  1VIQ A;  2KDV A;  5DEQ A;  4JZT A;  2KDW A;  5FSL A;  5GHM A;  1RRQ A;  4NFW A;  3A6U A;  3U53 A;  1PPV A;  3BM4 A;  2J8Q A;  3GG6 A;  1OW2 A;  5FSK A;  1G9Q A;  4S2V A;  1NFS A;  1X83 A;  1K2E A;  3ACA A;  3DUP A;  3Q2S A;  4KYX A;  5ANT A;  4ZG0 A;  4JZU A;  1Q27 A;  5FSI A;  3WHW A;  2O5F A;  4IJX A;  2B2K A;  3X0R A;  3A6V A;  3EEU A;  4MPO A;  2Q9P A;  1SOI A;  3G0Q A;  5CFI A;  3FJY A;  3X0S A;  5IW5 A;  3FSP A;  3GZ6 A;  1F3Y A;  3X0O A;  2ICJ A;  2DSD A;  4HFQ A;  2FML A;  1VHZ A;  4C9X A;  3GWY A;  2I8U A;  1I9A A;  4S2Y A;  3X0L A;  1V8L A;  3SMD A;  4NFX A;  3N77 A;  3J7Y e;  4YPR A;  5ISY A;  5LPG A;  1X51 A;  1G0S A;  4KG4 A;  1XSC A;  1V8Y A;  1TUM A;  1V8W A;  3QSJ A;  2B0V A;  1V8M A;  3HYQ A;  3X0J A;  1SU2 A;  1V8T A;  4KTB A;  2ICK A;  1V8S A;  1U20 A;  1RRS A;  3I7U A;  1PPW A;  3CNG A;  1MQE A;  2DSC A;  1V8N A;  2W4E A;  1RYA A;  5C7Q A;  5C7T A;  3MCF A;  4DYW A;  1PUS A;  1VCD A;  1VIU A;  2GT2 A;  3F13 A;  3P6Y A;  3EF5 A;  3X0K A;  3FK9 A;  2JVB A;  2R5W A;  1NQZ A;  3O69 A;  5GHJ A;  1IRY A;  4C9W A;  2YVM A;  3BHO A;  3Q93 A;  5BS6 A;  3HHJ A;  1PPX A;  3A6S A;  5CFJ A;  3O61 A;  1V8U A;  5IW4 A;  1SZ3 A;  3RH7 A;  3SHD A;  4YOQ A;  2VNP A;  2YVP A;  3MGM A;  3GZ5 A;  1KT9 A;  3SON A;  3O8S A;  2FKB A;  4KG3 A;  3BAP A;  3MDG A;  3X0I A;  1JKN A;  3FCM A;  5BON A;  2B06 A;  3R03 A;  3X0Q A;  3Q1P A;  1V8V A;  2A8Q A;  2O1C A;  5GHN A;  3EXQ A;  5GHP A;  3O52 A;  2VNQ A;  3OGA A;  3Q91 A;  1PVF A;  4S2X A;  3P5T A;  2O5W A;  3MDI A;  5C8L A;  1VRL A;  4ILQ A;  4HVY A;  3F6A A;  1MK1 A;  1Q33 A;  3KVH A;  3ZR1 A;  4N1U A;  3X0M A;  1VC9 A;  2I6K A;  3A6T A;  5DDG A;  1KHZ A;  2FVV A;  5DD4 A;  2A6T A;  4N1T A;  5GHI A;  1VHG A;  2A8S A; 
#chains in the Genus database with same CATH homology
 3EES A;  4J7G A;  2RRK A;  1VK6 A;  1SJY A;  5HZX A;  1NQY A;  2QJO A;  3GRN A;  5ANS A;  3X0N A;  2QKM B;  1X84 A;  1K26 A;  3Q4I A;  2A8P A;  3O6Z A;  1V8I A;  1JRK A;  2AZW A;  4V14 A;  5ANW A;  1GA7 A;  1MP2 A;  1NFZ A;  2DUK A;  2G73 A;  3E57 A;  3FFU A;  4J7H A;  2XSQ A;  5FSO A;  1HZT A;  1R67 A;  1XSA A;  3COU A;  4JZV A;  1MUT A;  5I8U A;  3DKU A;  1PUQ A;  2YVN A;  5FSM A;  2DHO A;  2CL3 A;  3GZ8 A;  1MQW A;  3AC9 A;  3X0P A;  5ANU A;  2PQV A;  3N9U A;  1VC8 A;  1V8R A;  4ICK A;  2PNY A;  5GHO A;  5FSN A;  3ID9 A;  4K6E A;  2I8T A;  3I9X A;  2YVO A;  2GB5 A;  5ANV A;  5GHQ A;  5DPK A;  2GT4 A;  4JZS A;  4S2W A;  2DSB A;  2YYH A;  3I7V A;  2A8T A;  2G74 A;  1PUN A;  1KTG A;  1Q54 A;  3H95 A;  1HX3 A;  3L85 A;  2A8R A;  4YPH A;  2CZR A;  1MR2 A;  1QVJ A;  2QJT A;  3Q2T A;  1XSB A;  3ZR0 A;  1VIQ A;  2KDV A;  5DEQ A;  4JZT A;  2KDW A;  5FSL A;  5GHM A;  1RRQ A;  4NFW A;  3A6U A;  3U53 A;  1PPV A;  3BM4 A;  2J8Q A;  3GG6 A;  1OW2 A;  5FSK A;  1G9Q A;  4S2V A;  1NFS A;  1X83 A;  1K2E A;  3ACA A;  3DUP A;  3Q2S A;  4KYX A;  5ANT A;  4ZG0 A;  4JZU A;  1Q27 A;  5FSI A;  3WHW A;  2O5F A;  4IJX A;  2B2K A;  3X0R A;  3A6V A;  3EEU A;  4MPO A;  2Q9P A;  1SOI A;  3G0Q A;  5CFI A;  3FJY A;  3X0S A;  5IW5 A;  3FSP A;  3GZ6 A;  1F3Y A;  3X0O A;  2ICJ A;  2DSD A;  4HFQ A;  2FML A;  1VHZ A;  4C9X A;  3GWY A;  2I8U A;  1I9A A;  4S2Y A;  3X0L A;  1V8L A;  3SMD A;  4NFX A;  3N77 A;  3J7Y e;  4YPR A;  5ISY A;  5LPG A;  1X51 A;  1G0S A;  4KG4 A;  1XSC A;  1V8Y A;  1TUM A;  1V8W A;  3QSJ A;  2B0V A;  1V8M A;  3HYQ A;  3X0J A;  1SU2 A;  1V8T A;  4KTB A;  2ICK A;  1V8S A;  1U20 A;  1RRS A;  3I7U A;  1PPW A;  3CNG A;  1MQE A;  2DSC A;  1V8N A;  2W4E A;  1RYA A;  5C7Q A;  5C7T A;  3MCF A;  4DYW A;  1PUS A;  1VCD A;  1VIU A;  2GT2 A;  3F13 A;  3P6Y A;  3EF5 A;  3X0K A;  3FK9 A;  2JVB A;  2R5W A;  1NQZ A;  3O69 A;  5GHJ A;  1IRY A;  4C9W A;  2YVM A;  3BHO A;  3Q93 A;  5BS6 A;  3HHJ A;  1PPX A;  3A6S A;  5CFJ A;  3O61 A;  1V8U A;  5IW4 A;  1SZ3 A;  3RH7 A;  3SHD A;  4YOQ A;  2VNP A;  2YVP A;  3MGM A;  3GZ5 A;  1KT9 A;  3SON A;  3O8S A;  2FKB A;  4KG3 A;  3BAP A;  3MDG A;  3X0I A;  1JKN A;  3FCM A;  5BON A;  2B06 A;  3R03 A;  3X0Q A;  3Q1P A;  1V8V A;  2A8Q A;  2O1C A;  5GHN A;  3EXQ A;  5GHP A;  3O52 A;  2VNQ A;  3OGA A;  3Q91 A;  1PVF A;  4S2X A;  3P5T A;  2O5W A;  3MDI A;  5C8L A;  1VRL A;  4ILQ A;  4HVY A;  3F6A A;  1MK1 A;  1Q33 A;  3KVH A;  3ZR1 A;  4N1U A;  3X0M A;  1VC9 A;  2I6K A;  3A6T A;  5DDG A;  1KHZ A;  2FVV A;  5DD4 A;  2A6T A;  4N1T A;  5GHI A;  1VHG A;  2A8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...