4JZUA

Crystal structure of the bacillus subtilis pyrophosphohydrolase bsrpph bound to a non-hydrolysable triphosphorylated dinucleotide rna (pcp-pgpg) - first guanosine residue in guanosine binding pocket
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
157
Chain Sequence
MYEFKDYYQNTVQLSFDDQPFSDSPKHVWVICRFGGKWLLTEHEDRGYEFPGGKVEPMECAEEAALREVKEETGARVKSLKYLGQYKVLGKEKVIVKNIYFADIEKLEKQADYFETKGPVLFHELPENLSRNKKFSFIMKDSVLPISLKKLKESGWI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords RNA PYROPHOSPHOHYDROLASE
publication title Bacillus subtilis RNA deprotection enzyme RppH recognizes guanosine in the second position of its substrates.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 40
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2013-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4jzuA00
3X0IA 3GG6A 4JZTA 3P5TA 1NQZA 5FSOA 1Q54A 4S2XA 1KT9A 2QJOA 1PUSA 2DSBA 3ZR0A 2YYHA 4K6EA 3X0NA 1VHGA 3X0LA 1XSCA 3R03A 4JZVA 1VIQA 2KDVA 3A6SA 2B0VA 5FSKA 3FCMA 3H95A 3X0RA 3X0PA 3KVHA 3FFUA 1HX3A 2A8QA 4YOQA 1GA7A 1VIUA 5C7TA 2FKBA 3EESA 3Q2SA 4KYXA 3FK9A 1RRSA 1NFZA 1PPXA 1PPWA 5I8UA 5BONA 2A8SA 3GZ6A 1MP2A 4IJXA 2VNQA 3L85A 5LPGA 1VK6A 5GHQA 4N1TA 1V8LA 1U20A 2AZWA 3A6TA 2G73A 5BS6A 3SHDA 1V8NA 2ICKA 2KDWA 4HFQA 2A8TA 1TUMA 3ZR1A 3FSPA 3P6YA 2I8UA 2I8TA 2I6KA 3GZ8A 3X0KA 1NQYA 3I9XA 1V8RA 3O61A 3SONA 3HHJA 2RRKA 2ICJA 1JRKA 2PQVA 4YPHA 1MK1A 5ANTA 3Q2TA 2DSDA 1X84A 2G74A 2QKMB 5ANUA 1I9AA 4KTBA 5GHNA 1HZTA 2B2KA 3F6AA 5C7QA 4KG4A 1NFSA 3N9UA 5C8LA 1V8TA 2JVBA 2R5WA 3BM4A 5DD4A 1MR2A 3MDGA 3F13A 5GHJA 4YPRA 1MUTA 1V8YA 1V8MA 3OGAA 3COUA 4S2VA 5FSNA 3Q1PA 2DHOA 1V8WA 3Q4IA 1X83A 3QSJA 1QVJA 3BAPA 5ANSA 5ANWA 3WHWA 3SMDA 5CFIA 1F3YA 1V8SA 3MGMA 1SU2A 1X51A 2A8PA 5FSMA 3RH7A 4S2WA 4C9WA 1XSBA 2O5WA 3O52A 5FSIA 1V8IA 3EXQA 2VNPA 3O69A 2YVPA 2O1CA 3FJYA 3HYQA 4HVYA 5DPKA 3GRNA 2YVOA 1KTGA 1VC9A 2GT4A 3MDIA 4KG3A 2B06A 1VC8A 2FVVA 1MQEA 1V8VA 2PNYA 5GHMA 1RRQA 2XSQA 1XSAA 1Q27A 2YVMA 3Q93A 3Q91A 2O5FA 4MPOA 3ACAA 3A6VA 5DEQA 1K2EA 1MQWA 4NFXA 3I7UA 5HZXA 1VCDA 3EEUA 2QJTA 5IW5A 4ZG0A 3A6UA 3G0QA 1SJYA 2W4EA 3AC9A 3GWYA 1PUNA 3O8SA 3O6ZA 3DUPA 1V8UA 3BHOA 4JZSA 3X0JA 4V14A 4DYWA 5IW4A 4ICKA 5GHPA 3U53A 4JZUA 4N1UA 3I7VA 1RYAA 1JKNA 2DUKA 1OW2A 2FMLA 3CNGA 3ID9A 5DDGA 1Q33A 4S2YA 1SOIA 2Q9PA 4NFWA 1SZ3A 4ILQA 1PPVA 5GHOA 2J8QA 3X0QA 2GB5A 5ANVA 3E57A 5CFJA 4C9XA 3J7Ye 3X0SA 2DSCA 2A6TA 3MCFA 2GT2A 1PVFA 1G9QA 3DKUA 1KHZA 1R67A 5GHIA 3GZ5A 1IRYA 2CL3A 5ISYA 1VRLA 2YVNA 3N77A 1K26A 3X0OA 2A8RA 3EF5A 1G0SA 5FSLA 1VHZA 3X0MA 1PUQA
chains in the Genus database with same CATH superfamily
3X0IA 3GG6A 4JZTA 3P5TA 1NQZA 5FSOA 1Q54A 4S2XA 1KT9A 2QJOA 1PUSA 2DSBA 3ZR0A 2YYHA 4K6EA 3X0NA 1VHGA 3X0LA 1XSCA 3R03A 4JZVA 1VIQA 2KDVA 3A6SA 2B0VA 5FSKA 3FCMA 3H95A 3X0RA 3X0PA 3KVHA 3FFUA 1HX3A 2A8QA 4YOQA 1GA7A 1VIUA 5C7TA 2FKBA 3EESA 3Q2SA 4KYXA 3FK9A 1RRSA 1NFZA 1PPXA 1PPWA 5I8UA 5BONA 2A8SA 3GZ6A 1MP2A 4IJXA 2VNQA 3L85A 4J7GA 5LPGA 1VK6A 5GHQA 4N1TA 1V8LA 1U20A 2AZWA 3A6TA 2G73A 5BS6A 3SHDA 1V8NA 2ICKA 2KDWA 4HFQA 2A8TA 1TUMA 3ZR1A 3FSPA 3P6YA 2I8UA 2I8TA 2I6KA 3GZ8A 3X0KA 1NQYA 3I9XA 1V8RA 3O61A 3SONA 3HHJA 2RRKA 2ICJA 1JRKA 2PQVA 4YPHA 1MK1A 5ANTA 3Q2TA 2DSDA 1X84A 2G74A 2QKMB 5ANUA 1I9AA 4KTBA 5GHNA 1HZTA 2B2KA 3F6AA 5C7QA 4KG4A 1NFSA 3N9UA 2CZRA 1V8TA 5C8LA 2JVBA 2R5WA 3BM4A 5DD4A 1MR2A 3MDGA 3F13A 5GHJA 4YPRA 1MUTA 1V8YA 1V8MA 3OGAA 3COUA 4S2VA 5FSNA 3Q1PA 2DHOA 1V8WA 3Q4IA 1X83A 3QSJA 1QVJA 3BAPA 5ANSA 5ANWA 3WHWA 3SMDA 5CFIA 1F3YA 1V8SA 3MGMA 1SU2A 1X51A 2A8PA 5FSMA 3RH7A 4S2WA 4C9WA 1XSBA 2O5WA 3O52A 5FSIA 1V8IA 3EXQA 2VNPA 3O69A 2YVPA 2O1CA 3FJYA 3HYQA 4HVYA 5DPKA 3GRNA 2YVOA 1KTGA 1VC9A 2GT4A 3MDIA 4KG3A 2B06A 1VC8A 2FVVA 1MQEA 1V8VA 2PNYA 5GHMA 1RRQA 2XSQA 1XSAA 1Q27A 2YVMA 3Q93A 3Q91A 2O5FA 4MPOA 3ACAA 3A6VA 5DEQA 1K2EA 1MQWA 4NFXA 3I7UA 5HZXA 1VCDA 3EEUA 2QJTA 5IW5A 4ZG0A 3A6UA 3G0QA 1SJYA 2W4EA 3AC9A 3GWYA 1PUNA 3O8SA 3O6ZA 3DUPA 1V8UA 3BHOA 4JZSA 3X0JA 4J7HA 4V14A 4DYWA 5IW4A 4ICKA 5GHPA 3U53A 4JZUA 4N1UA 3I7VA 1RYAA 1JKNA 2DUKA 1OW2A 2FMLA 3CNGA 3ID9A 5DDGA 1Q33A 4S2YA 1SOIA 2Q9PA 4NFWA 1SZ3A 4ILQA 1PPVA 5GHOA 2J8QA 3X0QA 2GB5A 5ANVA 3E57A 5CFJA 4C9XA 3J7Ye 3X0SA 2DSCA 2A6TA 3MCFA 2GT2A 1PVFA 1G9QA 3DKUA 1KHZA 1R67A 5GHIA 3GZ5A 1IRYA 2CL3A 5ISYA 1VRLA 2YVNA 3N77A 1K26A 3X0OA 2A8RA 3EF5A 1G0SA 5FSLA 1VHZA 3X0MA 1PUQA
chains in the Genus database with same CATH topology
3X0IA 3GG6A 4JZTA 3P5TA 1NQZA 5FSOA 1Q54A 4S2XA 1KT9A 2QJOA 1PUSA 2DSBA 3ZR0A 2YYHA 4K6EA 3X0NA 1VHGA 3X0LA 1XSCA 3R03A 4JZVA 1VIQA 2KDVA 3A6SA 2B0VA 5FSKA 3FCMA 3H95A 3X0RA 3X0PA 3KVHA 3FFUA 1HX3A 2A8QA 4YOQA 1GA7A 1VIUA 5C7TA 2FKBA 3EESA 3Q2SA 4KYXA 3FK9A 1RRSA 1NFZA 1PPXA 1PPWA 5I8UA 5BONA 2A8SA 3GZ6A 1MP2A 4IJXA 2VNQA 3L85A 4J7GA 5LPGA 1VK6A 5GHQA 4N1TA 1V8LA 1U20A 2AZWA 3A6TA 2G73A 5BS6A 3SHDA 1V8NA 2ICKA 2KDWA 4HFQA 2A8TA 1TUMA 3ZR1A 3FSPA 3P6YA 2I8UA 2I8TA 2I6KA 3GZ8A 3X0KA 1NQYA 3I9XA 1V8RA 3O61A 3SONA 3HHJA 2RRKA 2ICJA 1JRKA 2PQVA 4YPHA 1MK1A 5ANTA 3Q2TA 2DSDA 1X84A 2G74A 2QKMB 5ANUA 1I9AA 4KTBA 5GHNA 1HZTA 2B2KA 3F6AA 5C7QA 4KG4A 1NFSA 3N9UA 2CZRA 1V8TA 5C8LA 2JVBA 2R5WA 3BM4A 5DD4A 1MR2A 3MDGA 3F13A 5GHJA 4YPRA 1MUTA 1V8YA 1V8MA 3OGAA 3COUA 4S2VA 5FSNA 3Q1PA 2DHOA 1V8WA 3Q4IA 1X83A 3QSJA 1QVJA 3BAPA 5ANSA 5ANWA 3WHWA 3SMDA 5CFIA 1F3YA 1V8SA 3MGMA 1SU2A 1X51A 2A8PA 5FSMA 3RH7A 4S2WA 4C9WA 1XSBA 2O5WA 3O52A 5FSIA 1V8IA 3EXQA 2VNPA 3O69A 2YVPA 2O1CA 3FJYA 3HYQA 4HVYA 5DPKA 3GRNA 2YVOA 1KTGA 1VC9A 2GT4A 3MDIA 4KG3A 2B06A 1VC8A 2FVVA 1MQEA 1V8VA 2PNYA 5GHMA 1RRQA 2XSQA 1XSAA 1Q27A 2YVMA 3Q93A 3Q91A 2O5FA 4MPOA 3ACAA 3A6VA 5DEQA 1K2EA 1MQWA 4NFXA 3I7UA 5HZXA 1VCDA 3EEUA 2QJTA 5IW5A 4ZG0A 3A6UA 3G0QA 1SJYA 2W4EA 3AC9A 3GWYA 1PUNA 3O8SA 3O6ZA 3DUPA 1V8UA 3BHOA 4JZSA 3X0JA 4J7HA 4V14A 4DYWA 5IW4A 4ICKA 5GHPA 3U53A 4JZUA 4N1UA 3I7VA 1RYAA 1JKNA 2DUKA 1OW2A 2FMLA 3CNGA 3ID9A 5DDGA 1Q33A 4S2YA 1SOIA 2Q9PA 4NFWA 1SZ3A 4ILQA 1PPVA 5GHOA 2J8QA 3X0QA 2GB5A 5ANVA 3E57A 5CFJA 4C9XA 3J7Ye 3X0SA 2DSCA 2A6TA 3MCFA 2GT2A 1PVFA 1G9QA 3DKUA 1KHZA 1R67A 5GHIA 3GZ5A 1IRYA 2CL3A 5ISYA 1VRLA 2YVNA 3N77A 1K26A 3X0OA 2A8RA 3EF5A 1G0SA 5FSLA 1VHZA 3X0MA 1PUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X0I A;  3GG6 A;  4JZT A;  3P5T A;  1NQZ A;  5FSO A;  1Q54 A;  4S2X A;  1KT9 A;  2QJO A;  1PUS A;  2DSB A;  3ZR0 A;  2YYH A;  4K6E A;  3X0N A;  1VHG A;  3X0L A;  1XSC A;  3R03 A;  4JZV A;  1VIQ A;  2KDV A;  3A6S A;  2B0V A;  5FSK A;  3FCM A;  3H95 A;  3X0R A;  3X0P A;  3KVH A;  3FFU A;  1HX3 A;  2A8Q A;  4YOQ A;  1GA7 A;  1VIU A;  5C7T A;  2FKB A;  3EES A;  3Q2S A;  4KYX A;  3FK9 A;  1RRS A;  1NFZ A;  1PPX A;  1PPW A;  5I8U A;  5BON A;  2A8S A;  3GZ6 A;  1MP2 A;  4IJX A;  2VNQ A;  3L85 A;  5LPG A;  1VK6 A;  5GHQ A;  4N1T A;  1V8L A;  1U20 A;  2AZW A;  3A6T A;  2G73 A;  5BS6 A;  3SHD A;  1V8N A;  2ICK A;  2KDW A;  4HFQ A;  2A8T A;  1TUM A;  3ZR1 A;  3FSP A;  3P6Y A;  2I8U A;  2I8T A;  2I6K A;  3GZ8 A;  3X0K A;  1NQY A;  3I9X A;  1V8R A;  3O61 A;  3SON A;  3HHJ A;  2RRK A;  2ICJ A;  1JRK A;  2PQV A;  4YPH A;  1MK1 A;  5ANT A;  3Q2T A;  2DSD A;  1X84 A;  2G74 A;  2QKM B;  5ANU A;  1I9A A;  4KTB A;  5GHN A;  1HZT A;  2B2K A;  3F6A A;  5C7Q A;  4KG4 A;  1NFS A;  3N9U A;  5C8L A;  1V8T A;  2JVB A;  2R5W A;  3BM4 A;  5DD4 A;  1MR2 A;  3MDG A;  3F13 A;  5GHJ A;  4YPR A;  1MUT A;  1V8Y A;  1V8M A;  3OGA A;  3COU A;  4S2V A;  5FSN A;  3Q1P A;  2DHO A;  1V8W A;  3Q4I A;  1X83 A;  3QSJ A;  1QVJ A;  3BAP A;  5ANS A;  5ANW A;  3WHW A;  3SMD A;  5CFI A;  1F3Y A;  1V8S A;  3MGM A;  1SU2 A;  1X51 A;  2A8P A;  5FSM A;  3RH7 A;  4S2W A;  4C9W A;  1XSB A;  2O5W A;  3O52 A;  5FSI A;  1V8I A;  3EXQ A;  2VNP A;  3O69 A;  2YVP A;  2O1C A;  3FJY A;  3HYQ A;  4HVY A;  5DPK A;  3GRN A;  2YVO A;  1KTG A;  1VC9 A;  2GT4 A;  3MDI A;  4KG3 A;  2B06 A;  1VC8 A;  2FVV A;  1MQE A;  1V8V A;  2PNY A;  5GHM A;  1RRQ A;  2XSQ A;  1XSA A;  1Q27 A;  2YVM A;  3Q93 A;  3Q91 A;  2O5F A;  4MPO A;  3ACA A;  3A6V A;  5DEQ A;  1K2E A;  1MQW A;  4NFX A;  3I7U A;  5HZX A;  1VCD A;  3EEU A;  2QJT A;  5IW5 A;  4ZG0 A;  3A6U A;  3G0Q A;  1SJY A;  2W4E A;  3AC9 A;  3GWY A;  1PUN A;  3O8S A;  3O6Z A;  3DUP A;  1V8U A;  3BHO A;  4JZS A;  3X0J A;  4V14 A;  4DYW A;  5IW4 A;  4ICK A;  5GHP A;  3U53 A;  4JZU A;  4N1U A;  3I7V A;  1RYA A;  1JKN A;  2DUK A;  1OW2 A;  2FML A;  3CNG A;  3ID9 A;  5DDG A;  1Q33 A;  4S2Y A;  1SOI A;  2Q9P A;  4NFW A;  1SZ3 A;  4ILQ A;  1PPV A;  5GHO A;  2J8Q A;  3X0Q A;  2GB5 A;  5ANV A;  3E57 A;  5CFJ A;  4C9X A;  3J7Y e;  3X0S A;  2DSC A;  2A6T A;  3MCF A;  2GT2 A;  1PVF A;  1G9Q A;  3DKU A;  1KHZ A;  1R67 A;  5GHI A;  3GZ5 A;  1IRY A;  2CL3 A;  5ISY A;  1VRL A;  2YVN A;  3N77 A;  1K26 A;  3X0O A;  2A8R A;  3EF5 A;  1G0S A;  5FSL A;  1VHZ A;  3X0M A;  1PUQ A; 
#chains in the Genus database with same CATH topology
 3X0I A;  3GG6 A;  4JZT A;  3P5T A;  1NQZ A;  5FSO A;  1Q54 A;  4S2X A;  1KT9 A;  2QJO A;  1PUS A;  2DSB A;  3ZR0 A;  2YYH A;  4K6E A;  3X0N A;  1VHG A;  3X0L A;  1XSC A;  3R03 A;  4JZV A;  1VIQ A;  2KDV A;  3A6S A;  2B0V A;  5FSK A;  3FCM A;  3H95 A;  3X0R A;  3X0P A;  3KVH A;  3FFU A;  1HX3 A;  2A8Q A;  4YOQ A;  1GA7 A;  1VIU A;  5C7T A;  2FKB A;  3EES A;  3Q2S A;  4KYX A;  3FK9 A;  1RRS A;  1NFZ A;  1PPX A;  1PPW A;  5I8U A;  5BON A;  2A8S A;  3GZ6 A;  1MP2 A;  4IJX A;  2VNQ A;  3L85 A;  4J7G A;  5LPG A;  1VK6 A;  5GHQ A;  4N1T A;  1V8L A;  1U20 A;  2AZW A;  3A6T A;  2G73 A;  5BS6 A;  3SHD A;  1V8N A;  2ICK A;  2KDW A;  4HFQ A;  2A8T A;  1TUM A;  3ZR1 A;  3FSP A;  3P6Y A;  2I8U A;  2I8T A;  2I6K A;  3GZ8 A;  3X0K A;  1NQY A;  3I9X A;  1V8R A;  3O61 A;  3SON A;  3HHJ A;  2RRK A;  2ICJ A;  1JRK A;  2PQV A;  4YPH A;  1MK1 A;  5ANT A;  3Q2T A;  2DSD A;  1X84 A;  2G74 A;  2QKM B;  5ANU A;  1I9A A;  4KTB A;  5GHN A;  1HZT A;  2B2K A;  3F6A A;  5C7Q A;  4KG4 A;  1NFS A;  3N9U A;  2CZR A;  1V8T A;  5C8L A;  2JVB A;  2R5W A;  3BM4 A;  5DD4 A;  1MR2 A;  3MDG A;  3F13 A;  5GHJ A;  4YPR A;  1MUT A;  1V8Y A;  1V8M A;  3OGA A;  3COU A;  4S2V A;  5FSN A;  3Q1P A;  2DHO A;  1V8W A;  3Q4I A;  1X83 A;  3QSJ A;  1QVJ A;  3BAP A;  5ANS A;  5ANW A;  3WHW A;  3SMD A;  5CFI A;  1F3Y A;  1V8S A;  3MGM A;  1SU2 A;  1X51 A;  2A8P A;  5FSM A;  3RH7 A;  4S2W A;  4C9W A;  1XSB A;  2O5W A;  3O52 A;  5FSI A;  1V8I A;  3EXQ A;  2VNP A;  3O69 A;  2YVP A;  2O1C A;  3FJY A;  3HYQ A;  4HVY A;  5DPK A;  3GRN A;  2YVO A;  1KTG A;  1VC9 A;  2GT4 A;  3MDI A;  4KG3 A;  2B06 A;  1VC8 A;  2FVV A;  1MQE A;  1V8V A;  2PNY A;  5GHM A;  1RRQ A;  2XSQ A;  1XSA A;  1Q27 A;  2YVM A;  3Q93 A;  3Q91 A;  2O5F A;  4MPO A;  3ACA A;  3A6V A;  5DEQ A;  1K2E A;  1MQW A;  4NFX A;  3I7U A;  5HZX A;  1VCD A;  3EEU A;  2QJT A;  5IW5 A;  4ZG0 A;  3A6U A;  3G0Q A;  1SJY A;  2W4E A;  3AC9 A;  3GWY A;  1PUN A;  3O8S A;  3O6Z A;  3DUP A;  1V8U A;  3BHO A;  4JZS A;  3X0J A;  4J7H A;  4V14 A;  4DYW A;  5IW4 A;  4ICK A;  5GHP A;  3U53 A;  4JZU A;  4N1U A;  3I7V A;  1RYA A;  1JKN A;  2DUK A;  1OW2 A;  2FML A;  3CNG A;  3ID9 A;  5DDG A;  1Q33 A;  4S2Y A;  1SOI A;  2Q9P A;  4NFW A;  1SZ3 A;  4ILQ A;  1PPV A;  5GHO A;  2J8Q A;  3X0Q A;  2GB5 A;  5ANV A;  3E57 A;  5CFJ A;  4C9X A;  3J7Y e;  3X0S A;  2DSC A;  2A6T A;  3MCF A;  2GT2 A;  1PVF A;  1G9Q A;  3DKU A;  1KHZ A;  1R67 A;  5GHI A;  3GZ5 A;  1IRY A;  2CL3 A;  5ISY A;  1VRL A;  2YVN A;  3N77 A;  1K26 A;  3X0O A;  2A8R A;  3EF5 A;  1G0S A;  5FSL A;  1VHZ A;  3X0M A;  1PUQ A; 
#chains in the Genus database with same CATH homology
 3X0I A;  3GG6 A;  4JZT A;  3P5T A;  1NQZ A;  5FSO A;  1Q54 A;  4S2X A;  1KT9 A;  2QJO A;  1PUS A;  2DSB A;  3ZR0 A;  2YYH A;  4K6E A;  3X0N A;  1VHG A;  3X0L A;  1XSC A;  3R03 A;  4JZV A;  1VIQ A;  2KDV A;  3A6S A;  2B0V A;  5FSK A;  3FCM A;  3H95 A;  3X0R A;  3X0P A;  3KVH A;  3FFU A;  1HX3 A;  2A8Q A;  4YOQ A;  1GA7 A;  1VIU A;  5C7T A;  2FKB A;  3EES A;  3Q2S A;  4KYX A;  3FK9 A;  1RRS A;  1NFZ A;  1PPX A;  1PPW A;  5I8U A;  5BON A;  2A8S A;  3GZ6 A;  1MP2 A;  4IJX A;  2VNQ A;  3L85 A;  4J7G A;  5LPG A;  1VK6 A;  5GHQ A;  4N1T A;  1V8L A;  1U20 A;  2AZW A;  3A6T A;  2G73 A;  5BS6 A;  3SHD A;  1V8N A;  2ICK A;  2KDW A;  4HFQ A;  2A8T A;  1TUM A;  3ZR1 A;  3FSP A;  3P6Y A;  2I8U A;  2I8T A;  2I6K A;  3GZ8 A;  3X0K A;  1NQY A;  3I9X A;  1V8R A;  3O61 A;  3SON A;  3HHJ A;  2RRK A;  2ICJ A;  1JRK A;  2PQV A;  4YPH A;  1MK1 A;  5ANT A;  3Q2T A;  2DSD A;  1X84 A;  2G74 A;  2QKM B;  5ANU A;  1I9A A;  4KTB A;  5GHN A;  1HZT A;  2B2K A;  3F6A A;  5C7Q A;  4KG4 A;  1NFS A;  3N9U A;  2CZR A;  1V8T A;  5C8L A;  2JVB A;  2R5W A;  3BM4 A;  5DD4 A;  1MR2 A;  3MDG A;  3F13 A;  5GHJ A;  4YPR A;  1MUT A;  1V8Y A;  1V8M A;  3OGA A;  3COU A;  4S2V A;  5FSN A;  3Q1P A;  2DHO A;  1V8W A;  3Q4I A;  1X83 A;  3QSJ A;  1QVJ A;  3BAP A;  5ANS A;  5ANW A;  3WHW A;  3SMD A;  5CFI A;  1F3Y A;  1V8S A;  3MGM A;  1SU2 A;  1X51 A;  2A8P A;  5FSM A;  3RH7 A;  4S2W A;  4C9W A;  1XSB A;  2O5W A;  3O52 A;  5FSI A;  1V8I A;  3EXQ A;  2VNP A;  3O69 A;  2YVP A;  2O1C A;  3FJY A;  3HYQ A;  4HVY A;  5DPK A;  3GRN A;  2YVO A;  1KTG A;  1VC9 A;  2GT4 A;  3MDI A;  4KG3 A;  2B06 A;  1VC8 A;  2FVV A;  1MQE A;  1V8V A;  2PNY A;  5GHM A;  1RRQ A;  2XSQ A;  1XSA A;  1Q27 A;  2YVM A;  3Q93 A;  3Q91 A;  2O5F A;  4MPO A;  3ACA A;  3A6V A;  5DEQ A;  1K2E A;  1MQW A;  4NFX A;  3I7U A;  5HZX A;  1VCD A;  3EEU A;  2QJT A;  5IW5 A;  4ZG0 A;  3A6U A;  3G0Q A;  1SJY A;  2W4E A;  3AC9 A;  3GWY A;  1PUN A;  3O8S A;  3O6Z A;  3DUP A;  1V8U A;  3BHO A;  4JZS A;  3X0J A;  4J7H A;  4V14 A;  4DYW A;  5IW4 A;  4ICK A;  5GHP A;  3U53 A;  4JZU A;  4N1U A;  3I7V A;  1RYA A;  1JKN A;  2DUK A;  1OW2 A;  2FML A;  3CNG A;  3ID9 A;  5DDG A;  1Q33 A;  4S2Y A;  1SOI A;  2Q9P A;  4NFW A;  1SZ3 A;  4ILQ A;  1PPV A;  5GHO A;  2J8Q A;  3X0Q A;  2GB5 A;  5ANV A;  3E57 A;  5CFJ A;  4C9X A;  3J7Y e;  3X0S A;  2DSC A;  2A6T A;  3MCF A;  2GT2 A;  1PVF A;  1G9Q A;  3DKU A;  1KHZ A;  1R67 A;  5GHI A;  3GZ5 A;  1IRY A;  2CL3 A;  5ISY A;  1VRL A;  2YVN A;  3N77 A;  1K26 A;  3X0O A;  2A8R A;  3EF5 A;  1G0S A;  5FSL A;  1VHZ A;  3X0M A;  1PUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...