1NQYA

The structure of a coa pyrophosphatase from d. radiodurans
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
186
structure length
170
Chain Sequence
HDPLDDIQADPWALWLSGYRRAAVLVALTREADPRVLLTVRSKGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDVFTPVGFHVTPVLGRIAPEALDTLRVTPEVAQIITPTLAELRAVPLVRERRTLPDGTEVPLYRYPWRGLDIWGMTARVLHDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CoA pyrophosphatase (MutT/nudix family protein)
publication title Structure of a coenzyme A pyrophosphatase from Deinococcus radiodurans: a member of the Nudix family.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 43
structure length 170
sequence length 186
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1nqyA00
1XSCA 2B2KA 1KT9A 1SOIA 4ILQA 4S2VA 3N77A 5ANTA 1VC8A 3FK9A 4N1TA 1NQYA 5FSKA 4JZTA 1TUMA 3GRNA 3GG6A 3Q1PA 1V8MA 2DHOA 1MUTA 3COUA 2A8PA 3U53A 5BS6A 1G9QA 3FJYA 1V8YA 3HHJA 5DDGA 5DEQA 2JVBA 4JZSA 2YYHA 5FSOA 3ZR0A 2QJTA 3N9UA 1HZTA 2DSBA 3R03A 3MGMA 5GHJA 3X0LA 1VIQA 5CFIA 1KTGA 1PUSA 5GHIA 1VHZA 4NFWA 3MDGA 2YVPA 3Q91A 2W4EA 1G0SA 1VCDA 1SZ3A 1X84A 2B06A 2B0VA 3O69A 4C9WA 3GZ6A 2FVVA 2O5WA 3X0OA 5FSMA 5DPKA 5GHOA 1NFZA 5GHQA 4C9XA 3OGAA 2AZWA 2YVOA 1MK1A 2YVNA 1OW2A 3A6VA 1PPVA 5IW4A 3E57A 1F3YA 4IJXA 4S2WA 3A6TA 3CNGA 1V8NA 2ICJA 2O5FA 1Q27A 4N1UA 5DD4A 1SJYA 5FSIA 3SHDA 1XSAA 5CFJA 1V8UA 2KDWA 3BHOA 3O6ZA 2QJOA 3GZ8A 3O52A 4JZUA 3F13A 4K6EA 4KTBA 3X0JA 1V8SA 3X0PA 5FSNA 5I8UA 5LPGA 3WHWA 2GB5A 3FSPA 2GT4A 5FSLA 4KG4A 3F6AA 2I8TA 2QKMB 1X83A 3J7Ye 1K26A 2FMLA 3X0KA 5C7TA 1MQEA 3I7UA 2A8RA 1V8RA 2A6TA 5IW5A 2ICKA 2DSDA 1KHZA 5ANUA 1Q33A 3H95A 3FCMA 2GT2A 1VIUA 3O61A 3GWYA 4HFQA 1JKNA 2DSCA 2FKBA 1VC9A 2G74A 2A8QA 2J8QA 3Q93A 4ZG0A 1RRSA 3AC9A 5ANWA 1RYAA 3X0MA 3G0QA 1HX3A 2RRKA 2VNQA 4S2YA 2I8UA 4ICKA 2A8SA 3HYQA 3ZR1A 5GHMA 3ID9A 5GHNA 1MQWA 2PQVA 2O1CA 2I6KA 3FFUA 3I9XA 3SMDA 2Q9PA 1V8VA 4V14A 3X0RA 1VK6A 3BM4A 3Q4IA 5C8LA 1NQZA 3X0QA 3EXQA 3X0IA 1PPXA 3O8SA 5ANVA 1MR2A 5ISYA 4S2XA 1X51A 3Q2SA 2R5WA 3QSJA 1PPWA 1PUQA 1QVJA 3ACAA 4JZVA 4HVYA 3SONA 2VNPA 1NFSA 1MP2A 4NFXA 3RH7A 3Q2TA 1R67A 1V8IA 2YVMA 3A6SA 1K2EA 5GHPA 5BONA 2PNYA 2CL3A 3I7VA 4MPOA 4YPRA 3EF5A 4DYWA 4YPHA 3EEUA 1RRQA 1SU2A 1IRYA 1VRLA 3X0NA 1GA7A 2A8TA 3DKUA 4KYXA 1Q54A 4KG3A 3X0SA 2KDVA 1V8WA 5C7QA 3P5TA 2XSQA 3EESA 3GZ5A 5HZXA 1VHGA 1PVFA 3MCFA 3BAPA 3DUPA 1JRKA 1PUNA 1U20A 3KVHA 5ANSA 1V8TA 4YOQA 1V8LA 2G73A 3P6YA 2DUKA 1I9AA 3A6UA 3MDIA 1XSBA 3L85A
chains in the Genus database with same CATH superfamily
1XSCA 2B2KA 1KT9A 1SOIA 4ILQA 4S2VA 3N77A 5ANTA 1VC8A 3FK9A 4N1TA 1NQYA 5FSKA 4JZTA 1TUMA 3GRNA 3GG6A 3Q1PA 1V8MA 2DHOA 1MUTA 3COUA 2A8PA 3U53A 5BS6A 1G9QA 3FJYA 1V8YA 3HHJA 5DDGA 5DEQA 2JVBA 4J7GA 4JZSA 2YYHA 5FSOA 3ZR0A 2QJTA 3N9UA 1HZTA 2DSBA 4J7HA 3R03A 3MGMA 5GHJA 3X0LA 1VIQA 5CFIA 1KTGA 1PUSA 5GHIA 1VHZA 4NFWA 3MDGA 2YVPA 3Q91A 2W4EA 1G0SA 1VCDA 1SZ3A 1X84A 2B06A 2B0VA 3O69A 4C9WA 3GZ6A 2FVVA 2O5WA 3X0OA 5FSMA 5DPKA 5GHOA 1NFZA 5GHQA 4C9XA 3OGAA 2AZWA 2YVOA 1MK1A 2YVNA 1OW2A 3A6VA 1PPVA 5IW4A 3E57A 1F3YA 4IJXA 4S2WA 3A6TA 3CNGA 1V8NA 2ICJA 2O5FA 1Q27A 4N1UA 5DD4A 1SJYA 5FSIA 3SHDA 1XSAA 5CFJA 1V8UA 2KDWA 3BHOA 3O6ZA 2QJOA 3GZ8A 3O52A 4JZUA 3F13A 4K6EA 4KTBA 3X0JA 1V8SA 3X0PA 5FSNA 5I8UA 5LPGA 3WHWA 2GB5A 3FSPA 2GT4A 5FSLA 4KG4A 3F6AA 2I8TA 2QKMB 1X83A 3J7Ye 1K26A 2FMLA 3X0KA 5C7TA 2CZRA 1MQEA 3I7UA 2A8RA 1V8RA 2A6TA 5IW5A 2ICKA 2DSDA 1KHZA 5ANUA 1Q33A 3H95A 3FCMA 2GT2A 1VIUA 3O61A 3GWYA 4HFQA 1JKNA 2DSCA 2FKBA 1VC9A 2G74A 2A8QA 2J8QA 3Q93A 4ZG0A 1RRSA 3AC9A 5ANWA 1RYAA 3X0MA 3G0QA 1HX3A 2RRKA 2VNQA 4S2YA 2I8UA 4ICKA 2A8SA 3HYQA 3ZR1A 5GHMA 3ID9A 5GHNA 1MQWA 2PQVA 2O1CA 2I6KA 3FFUA 3I9XA 3SMDA 2Q9PA 1V8VA 4V14A 3X0RA 1VK6A 3BM4A 3Q4IA 5C8LA 1NQZA 3X0QA 3EXQA 3X0IA 1PPXA 3O8SA 5ANVA 1MR2A 5ISYA 4S2XA 1X51A 3Q2SA 2R5WA 3QSJA 1PPWA 1PUQA 1QVJA 3ACAA 4JZVA 4HVYA 3SONA 2VNPA 1NFSA 1MP2A 4NFXA 3RH7A 3Q2TA 1R67A 1V8IA 2YVMA 3A6SA 1K2EA 5GHPA 5BONA 2PNYA 2CL3A 3I7VA 4MPOA 4YPRA 3EF5A 4DYWA 4YPHA 3EEUA 1RRQA 1SU2A 1IRYA 1VRLA 3X0NA 1GA7A 2A8TA 3DKUA 4KYXA 1Q54A 4KG3A 3X0SA 2KDVA 1V8WA 5C7QA 3P5TA 2XSQA 3EESA 3GZ5A 5HZXA 1VHGA 1PVFA 3MCFA 3BAPA 3DUPA 1JRKA 1PUNA 1U20A 3KVHA 5ANSA 1V8TA 4YOQA 1V8LA 2G73A 3P6YA 2DUKA 1I9AA 3A6UA 3MDIA 1XSBA 3L85A
chains in the Genus database with same CATH topology
1XSCA 2B2KA 1KT9A 1SOIA 4ILQA 4S2VA 3N77A 5ANTA 1VC8A 3FK9A 4N1TA 1NQYA 5FSKA 4JZTA 1TUMA 3GRNA 3GG6A 3Q1PA 1V8MA 2DHOA 1MUTA 3COUA 2A8PA 3U53A 5BS6A 1G9QA 3FJYA 1V8YA 3HHJA 5DDGA 5DEQA 2JVBA 4J7GA 4JZSA 2YYHA 5FSOA 3ZR0A 2QJTA 3N9UA 1HZTA 2DSBA 4J7HA 3R03A 3MGMA 5GHJA 3X0LA 1VIQA 5CFIA 1KTGA 1PUSA 5GHIA 1VHZA 4NFWA 3MDGA 2YVPA 3Q91A 2W4EA 1G0SA 1VCDA 1SZ3A 1X84A 2B06A 2B0VA 3O69A 4C9WA 3GZ6A 2FVVA 2O5WA 3X0OA 5FSMA 5DPKA 5GHOA 1NFZA 5GHQA 4C9XA 3OGAA 2AZWA 2YVOA 1MK1A 2YVNA 1OW2A 3A6VA 1PPVA 5IW4A 3E57A 1F3YA 4IJXA 4S2WA 3A6TA 3CNGA 1V8NA 2ICJA 2O5FA 1Q27A 4N1UA 5DD4A 1SJYA 5FSIA 3SHDA 1XSAA 5CFJA 1V8UA 2KDWA 3BHOA 3O6ZA 2QJOA 3GZ8A 3O52A 4JZUA 3F13A 4K6EA 4KTBA 3X0JA 1V8SA 3X0PA 5FSNA 5I8UA 5LPGA 3WHWA 2GB5A 3FSPA 2GT4A 5FSLA 4KG4A 3F6AA 2I8TA 2QKMB 1X83A 3J7Ye 1K26A 2FMLA 3X0KA 5C7TA 2CZRA 1MQEA 3I7UA 2A8RA 1V8RA 2A6TA 5IW5A 2ICKA 2DSDA 1KHZA 5ANUA 1Q33A 3H95A 3FCMA 2GT2A 1VIUA 3O61A 3GWYA 4HFQA 1JKNA 2DSCA 2FKBA 1VC9A 2G74A 2A8QA 2J8QA 3Q93A 4ZG0A 1RRSA 3AC9A 5ANWA 1RYAA 3X0MA 3G0QA 1HX3A 2RRKA 2VNQA 4S2YA 2I8UA 4ICKA 2A8SA 3HYQA 3ZR1A 5GHMA 3ID9A 5GHNA 1MQWA 2PQVA 2O1CA 2I6KA 3FFUA 3I9XA 3SMDA 2Q9PA 1V8VA 4V14A 3X0RA 1VK6A 3BM4A 3Q4IA 5C8LA 1NQZA 3X0QA 3EXQA 3X0IA 1PPXA 3O8SA 5ANVA 1MR2A 5ISYA 4S2XA 1X51A 3Q2SA 2R5WA 3QSJA 1PPWA 1PUQA 1QVJA 3ACAA 4JZVA 4HVYA 3SONA 2VNPA 1NFSA 1MP2A 4NFXA 3RH7A 3Q2TA 1R67A 1V8IA 2YVMA 3A6SA 1K2EA 5GHPA 5BONA 2PNYA 2CL3A 3I7VA 4MPOA 4YPRA 3EF5A 4DYWA 4YPHA 3EEUA 1RRQA 1SU2A 1IRYA 1VRLA 3X0NA 1GA7A 2A8TA 3DKUA 4KYXA 1Q54A 4KG3A 3X0SA 2KDVA 1V8WA 5C7QA 3P5TA 2XSQA 3EESA 3GZ5A 5HZXA 1VHGA 1PVFA 3MCFA 3BAPA 3DUPA 1JRKA 1PUNA 1U20A 3KVHA 5ANSA 1V8TA 4YOQA 1V8LA 2G73A 3P6YA 2DUKA 1I9AA 3A6UA 3MDIA 1XSBA 3L85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSC A;  2B2K A;  1KT9 A;  1SOI A;  4ILQ A;  4S2V A;  3N77 A;  5ANT A;  1VC8 A;  3FK9 A;  4N1T A;  1NQY A;  5FSK A;  4JZT A;  1TUM A;  3GRN A;  3GG6 A;  3Q1P A;  1V8M A;  2DHO A;  1MUT A;  3COU A;  2A8P A;  3U53 A;  5BS6 A;  1G9Q A;  3FJY A;  1V8Y A;  3HHJ A;  5DDG A;  5DEQ A;  2JVB A;  4JZS A;  2YYH A;  5FSO A;  3ZR0 A;  2QJT A;  3N9U A;  1HZT A;  2DSB A;  3R03 A;  3MGM A;  5GHJ A;  3X0L A;  1VIQ A;  5CFI A;  1KTG A;  1PUS A;  5GHI A;  1VHZ A;  4NFW A;  3MDG A;  2YVP A;  3Q91 A;  2W4E A;  1G0S A;  1VCD A;  1SZ3 A;  1X84 A;  2B06 A;  2B0V A;  3O69 A;  4C9W A;  3GZ6 A;  2FVV A;  2O5W A;  3X0O A;  5FSM A;  5DPK A;  5GHO A;  1NFZ A;  5GHQ A;  4C9X A;  3OGA A;  2AZW A;  2YVO A;  1MK1 A;  2YVN A;  1OW2 A;  3A6V A;  1PPV A;  5IW4 A;  3E57 A;  1F3Y A;  4IJX A;  4S2W A;  3A6T A;  3CNG A;  1V8N A;  2ICJ A;  2O5F A;  1Q27 A;  4N1U A;  5DD4 A;  1SJY A;  5FSI A;  3SHD A;  1XSA A;  5CFJ A;  1V8U A;  2KDW A;  3BHO A;  3O6Z A;  2QJO A;  3GZ8 A;  3O52 A;  4JZU A;  3F13 A;  4K6E A;  4KTB A;  3X0J A;  1V8S A;  3X0P A;  5FSN A;  5I8U A;  5LPG A;  3WHW A;  2GB5 A;  3FSP A;  2GT4 A;  5FSL A;  4KG4 A;  3F6A A;  2I8T A;  2QKM B;  1X83 A;  3J7Y e;  1K26 A;  2FML A;  3X0K A;  5C7T A;  1MQE A;  3I7U A;  2A8R A;  1V8R A;  2A6T A;  5IW5 A;  2ICK A;  2DSD A;  1KHZ A;  5ANU A;  1Q33 A;  3H95 A;  3FCM A;  2GT2 A;  1VIU A;  3O61 A;  3GWY A;  4HFQ A;  1JKN A;  2DSC A;  2FKB A;  1VC9 A;  2G74 A;  2A8Q A;  2J8Q A;  3Q93 A;  4ZG0 A;  1RRS A;  3AC9 A;  5ANW A;  1RYA A;  3X0M A;  3G0Q A;  1HX3 A;  2RRK A;  2VNQ A;  4S2Y A;  2I8U A;  4ICK A;  2A8S A;  3HYQ A;  3ZR1 A;  5GHM A;  3ID9 A;  5GHN A;  1MQW A;  2PQV A;  2O1C A;  2I6K A;  3FFU A;  3I9X A;  3SMD A;  2Q9P A;  1V8V A;  4V14 A;  3X0R A;  1VK6 A;  3BM4 A;  3Q4I A;  5C8L A;  1NQZ A;  3X0Q A;  3EXQ A;  3X0I A;  1PPX A;  3O8S A;  5ANV A;  1MR2 A;  5ISY A;  4S2X A;  1X51 A;  3Q2S A;  2R5W A;  3QSJ A;  1PPW A;  1PUQ A;  1QVJ A;  3ACA A;  4JZV A;  4HVY A;  3SON A;  2VNP A;  1NFS A;  1MP2 A;  4NFX A;  3RH7 A;  3Q2T A;  1R67 A;  1V8I A;  2YVM A;  3A6S A;  1K2E A;  5GHP A;  5BON A;  2PNY A;  2CL3 A;  3I7V A;  4MPO A;  4YPR A;  3EF5 A;  4DYW A;  4YPH A;  3EEU A;  1RRQ A;  1SU2 A;  1IRY A;  1VRL A;  3X0N A;  1GA7 A;  2A8T A;  3DKU A;  4KYX A;  1Q54 A;  4KG3 A;  3X0S A;  2KDV A;  1V8W A;  5C7Q A;  3P5T A;  2XSQ A;  3EES A;  3GZ5 A;  5HZX A;  1VHG A;  1PVF A;  3MCF A;  3BAP A;  3DUP A;  1JRK A;  1PUN A;  1U20 A;  3KVH A;  5ANS A;  1V8T A;  4YOQ A;  1V8L A;  2G73 A;  3P6Y A;  2DUK A;  1I9A A;  3A6U A;  3MDI A;  1XSB A;  3L85 A; 
#chains in the Genus database with same CATH topology
 1XSC A;  2B2K A;  1KT9 A;  1SOI A;  4ILQ A;  4S2V A;  3N77 A;  5ANT A;  1VC8 A;  3FK9 A;  4N1T A;  1NQY A;  5FSK A;  4JZT A;  1TUM A;  3GRN A;  3GG6 A;  3Q1P A;  1V8M A;  2DHO A;  1MUT A;  3COU A;  2A8P A;  3U53 A;  5BS6 A;  1G9Q A;  3FJY A;  1V8Y A;  3HHJ A;  5DDG A;  5DEQ A;  2JVB A;  4J7G A;  4JZS A;  2YYH A;  5FSO A;  3ZR0 A;  2QJT A;  3N9U A;  1HZT A;  2DSB A;  4J7H A;  3R03 A;  3MGM A;  5GHJ A;  3X0L A;  1VIQ A;  5CFI A;  1KTG A;  1PUS A;  5GHI A;  1VHZ A;  4NFW A;  3MDG A;  2YVP A;  3Q91 A;  2W4E A;  1G0S A;  1VCD A;  1SZ3 A;  1X84 A;  2B06 A;  2B0V A;  3O69 A;  4C9W A;  3GZ6 A;  2FVV A;  2O5W A;  3X0O A;  5FSM A;  5DPK A;  5GHO A;  1NFZ A;  5GHQ A;  4C9X A;  3OGA A;  2AZW A;  2YVO A;  1MK1 A;  2YVN A;  1OW2 A;  3A6V A;  1PPV A;  5IW4 A;  3E57 A;  1F3Y A;  4IJX A;  4S2W A;  3A6T A;  3CNG A;  1V8N A;  2ICJ A;  2O5F A;  1Q27 A;  4N1U A;  5DD4 A;  1SJY A;  5FSI A;  3SHD A;  1XSA A;  5CFJ A;  1V8U A;  2KDW A;  3BHO A;  3O6Z A;  2QJO A;  3GZ8 A;  3O52 A;  4JZU A;  3F13 A;  4K6E A;  4KTB A;  3X0J A;  1V8S A;  3X0P A;  5FSN A;  5I8U A;  5LPG A;  3WHW A;  2GB5 A;  3FSP A;  2GT4 A;  5FSL A;  4KG4 A;  3F6A A;  2I8T A;  2QKM B;  1X83 A;  3J7Y e;  1K26 A;  2FML A;  3X0K A;  5C7T A;  2CZR A;  1MQE A;  3I7U A;  2A8R A;  1V8R A;  2A6T A;  5IW5 A;  2ICK A;  2DSD A;  1KHZ A;  5ANU A;  1Q33 A;  3H95 A;  3FCM A;  2GT2 A;  1VIU A;  3O61 A;  3GWY A;  4HFQ A;  1JKN A;  2DSC A;  2FKB A;  1VC9 A;  2G74 A;  2A8Q A;  2J8Q A;  3Q93 A;  4ZG0 A;  1RRS A;  3AC9 A;  5ANW A;  1RYA A;  3X0M A;  3G0Q A;  1HX3 A;  2RRK A;  2VNQ A;  4S2Y A;  2I8U A;  4ICK A;  2A8S A;  3HYQ A;  3ZR1 A;  5GHM A;  3ID9 A;  5GHN A;  1MQW A;  2PQV A;  2O1C A;  2I6K A;  3FFU A;  3I9X A;  3SMD A;  2Q9P A;  1V8V A;  4V14 A;  3X0R A;  1VK6 A;  3BM4 A;  3Q4I A;  5C8L A;  1NQZ A;  3X0Q A;  3EXQ A;  3X0I A;  1PPX A;  3O8S A;  5ANV A;  1MR2 A;  5ISY A;  4S2X A;  1X51 A;  3Q2S A;  2R5W A;  3QSJ A;  1PPW A;  1PUQ A;  1QVJ A;  3ACA A;  4JZV A;  4HVY A;  3SON A;  2VNP A;  1NFS A;  1MP2 A;  4NFX A;  3RH7 A;  3Q2T A;  1R67 A;  1V8I A;  2YVM A;  3A6S A;  1K2E A;  5GHP A;  5BON A;  2PNY A;  2CL3 A;  3I7V A;  4MPO A;  4YPR A;  3EF5 A;  4DYW A;  4YPH A;  3EEU A;  1RRQ A;  1SU2 A;  1IRY A;  1VRL A;  3X0N A;  1GA7 A;  2A8T A;  3DKU A;  4KYX A;  1Q54 A;  4KG3 A;  3X0S A;  2KDV A;  1V8W A;  5C7Q A;  3P5T A;  2XSQ A;  3EES A;  3GZ5 A;  5HZX A;  1VHG A;  1PVF A;  3MCF A;  3BAP A;  3DUP A;  1JRK A;  1PUN A;  1U20 A;  3KVH A;  5ANS A;  1V8T A;  4YOQ A;  1V8L A;  2G73 A;  3P6Y A;  2DUK A;  1I9A A;  3A6U A;  3MDI A;  1XSB A;  3L85 A; 
#chains in the Genus database with same CATH homology
 1XSC A;  2B2K A;  1KT9 A;  1SOI A;  4ILQ A;  4S2V A;  3N77 A;  5ANT A;  1VC8 A;  3FK9 A;  4N1T A;  1NQY A;  5FSK A;  4JZT A;  1TUM A;  3GRN A;  3GG6 A;  3Q1P A;  1V8M A;  2DHO A;  1MUT A;  3COU A;  2A8P A;  3U53 A;  5BS6 A;  1G9Q A;  3FJY A;  1V8Y A;  3HHJ A;  5DDG A;  5DEQ A;  2JVB A;  4J7G A;  4JZS A;  2YYH A;  5FSO A;  3ZR0 A;  2QJT A;  3N9U A;  1HZT A;  2DSB A;  4J7H A;  3R03 A;  3MGM A;  5GHJ A;  3X0L A;  1VIQ A;  5CFI A;  1KTG A;  1PUS A;  5GHI A;  1VHZ A;  4NFW A;  3MDG A;  2YVP A;  3Q91 A;  2W4E A;  1G0S A;  1VCD A;  1SZ3 A;  1X84 A;  2B06 A;  2B0V A;  3O69 A;  4C9W A;  3GZ6 A;  2FVV A;  2O5W A;  3X0O A;  5FSM A;  5DPK A;  5GHO A;  1NFZ A;  5GHQ A;  4C9X A;  3OGA A;  2AZW A;  2YVO A;  1MK1 A;  2YVN A;  1OW2 A;  3A6V A;  1PPV A;  5IW4 A;  3E57 A;  1F3Y A;  4IJX A;  4S2W A;  3A6T A;  3CNG A;  1V8N A;  2ICJ A;  2O5F A;  1Q27 A;  4N1U A;  5DD4 A;  1SJY A;  5FSI A;  3SHD A;  1XSA A;  5CFJ A;  1V8U A;  2KDW A;  3BHO A;  3O6Z A;  2QJO A;  3GZ8 A;  3O52 A;  4JZU A;  3F13 A;  4K6E A;  4KTB A;  3X0J A;  1V8S A;  3X0P A;  5FSN A;  5I8U A;  5LPG A;  3WHW A;  2GB5 A;  3FSP A;  2GT4 A;  5FSL A;  4KG4 A;  3F6A A;  2I8T A;  2QKM B;  1X83 A;  3J7Y e;  1K26 A;  2FML A;  3X0K A;  5C7T A;  2CZR A;  1MQE A;  3I7U A;  2A8R A;  1V8R A;  2A6T A;  5IW5 A;  2ICK A;  2DSD A;  1KHZ A;  5ANU A;  1Q33 A;  3H95 A;  3FCM A;  2GT2 A;  1VIU A;  3O61 A;  3GWY A;  4HFQ A;  1JKN A;  2DSC A;  2FKB A;  1VC9 A;  2G74 A;  2A8Q A;  2J8Q A;  3Q93 A;  4ZG0 A;  1RRS A;  3AC9 A;  5ANW A;  1RYA A;  3X0M A;  3G0Q A;  1HX3 A;  2RRK A;  2VNQ A;  4S2Y A;  2I8U A;  4ICK A;  2A8S A;  3HYQ A;  3ZR1 A;  5GHM A;  3ID9 A;  5GHN A;  1MQW A;  2PQV A;  2O1C A;  2I6K A;  3FFU A;  3I9X A;  3SMD A;  2Q9P A;  1V8V A;  4V14 A;  3X0R A;  1VK6 A;  3BM4 A;  3Q4I A;  5C8L A;  1NQZ A;  3X0Q A;  3EXQ A;  3X0I A;  1PPX A;  3O8S A;  5ANV A;  1MR2 A;  5ISY A;  4S2X A;  1X51 A;  3Q2S A;  2R5W A;  3QSJ A;  1PPW A;  1PUQ A;  1QVJ A;  3ACA A;  4JZV A;  4HVY A;  3SON A;  2VNP A;  1NFS A;  1MP2 A;  4NFX A;  3RH7 A;  3Q2T A;  1R67 A;  1V8I A;  2YVM A;  3A6S A;  1K2E A;  5GHP A;  5BON A;  2PNY A;  2CL3 A;  3I7V A;  4MPO A;  4YPR A;  3EF5 A;  4DYW A;  4YPH A;  3EEU A;  1RRQ A;  1SU2 A;  1IRY A;  1VRL A;  3X0N A;  1GA7 A;  2A8T A;  3DKU A;  4KYX A;  1Q54 A;  4KG3 A;  3X0S A;  2KDV A;  1V8W A;  5C7Q A;  3P5T A;  2XSQ A;  3EES A;  3GZ5 A;  5HZX A;  1VHG A;  1PVF A;  3MCF A;  3BAP A;  3DUP A;  1JRK A;  1PUN A;  1U20 A;  3KVH A;  5ANS A;  1V8T A;  4YOQ A;  1V8L A;  2G73 A;  3P6Y A;  2DUK A;  1I9A A;  3A6U A;  3MDI A;  1XSB A;  3L85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...