1NQYA

The structure of a coa pyrophosphatase from d. radiodurans
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
186
structure length
170
Chain Sequence
HDPLDDIQADPWALWLSGYRRAAVLVALTREADPRVLLTVRSKGQIAFPGGSLDAGETPTQAALREAQEEVALDPAAVTLLGELDDVFTPVGFHVTPVLGRIAPEALDTLRVTPEVAQIITPTLAELRAVPLVRERRTLPDGTEVPLYRYPWRGLDIWGMTARVLHDLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA pyrophosphatase (MutT/nudix family protein)
publication title Structure of a coenzyme A pyrophosphatase from Deinococcus radiodurans: a member of the Nudix family.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
total genus 43
structure length 170
sequence length 186
ec nomenclature ec 3.6.1.9: Nucleotide diphosphatase.
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1nqyA00
3DKUA 2FVVA 1JKNA 5FSKA 2J8QA 3X0KA 1VHZA 3SMDA 1MQWA 1VIQA 3FJYA 3U53A 3WHWA 4JZUA 1MR2A 2I8TA 1RRQA 3GG6A 1V8VA 3BHOA 1K26A 1HZTA 3N9UA 1G9QA 2YVPA 4KG3A 4KYXA 1VC8A 5DPKA 1RRSA 2A8RA 3BAPA 2VNPA 4N1TA 2O5FA 3GZ6A 2R5WA 2FKBA 3Q2TA 1MUTA 1V8UA 1VK6A 3O6ZA 3J7Ye 1IRYA 3MGMA 1VHGA 3QSJA 5FSIA 3RH7A 5C8LA 4HVYA 3MDGA 5GHNA 3R03A 3X0SA 4DYWA 3A6TA 4V14A 5ANVA 2YVMA 3X0LA 2DSCA 2YVOA 5BONA 2A8SA 5ANTA 2O5WA 2A8TA 3P5TA 2AZWA 5GHIA 2DHOA 1XSBA 1VRLA 3ACAA 1PPXA 3EXQA 3O52A 2O1CA 5ANWA 2FMLA 3X0NA 1PVFA 1VCDA 4ILQA 1SOIA 3FFUA 2W4EA 4JZTA 3X0JA 3ZR1A 2G73A 3L85A 1V8RA 3FCMA 1MP2A 5CFIA 3O69A 1V8TA 1V8LA 3Q4IA 5I8UA 1Q27A 5GHOA 2DSBA 3X0MA 5DD4A 4S2VA 3H95A 1NQYA 1GA7A 1PUSA 1MK1A 2JVBA 3EF5A 4JZSA 3O61A 5GHJA 2VNQA 5GHPA 4S2XA 3HYQA 3E57A 3MDIA 1JRKA 1KTGA 4IJXA 2YVNA 1NQZA 3EESA 1KHZA 1Q54A 3GWYA 2DUKA 2KDVA 1QVJA 3CNGA 5C7QA 3P6YA 1F3YA 3ID9A 5DDGA 3F13A 5ISYA 3Q1PA 1MQEA 2ICJA 2GB5A 1PUQA 3OGAA 2RRKA 3Q91A 3FSPA 2A6TA 1X51A 1V8MA 1VIUA 2GT2A 4C9WA 5BS6A 2B0VA 3A6SA 4ICKA 4K6EA 5ANUA 4C9XA 4MPOA 3GZ5A 3N77A 5FSOA 5IW4A 2QKMB 3O8SA 4NFWA 3ZR0A 3X0OA 4HFQA 1TUMA 1NFSA 1RYAA 1VC9A 2GT4A 5GHQA 3COUA 3DUPA 1Q33A 5LPGA 3A6VA 4ZG0A 1G0SA 3A6UA 2XSQA 3G0QA 1X84A 2A8QA 2CL3A 3EEUA 2KDWA 1PPVA 3X0QA 1X83A 5DEQA 2QJTA 2PNYA 4KG4A 4YPHA 3F6AA 5FSNA 1PPWA 5HZXA 2Q9PA 4N1UA 5C7TA 1R67A 5FSMA 1OW2A 1V8NA 2B06A 3FK9A 2A8PA 5ANSA 4YOQA 2I8UA 4NFXA 3HHJA 3BM4A 5CFJA 1V8YA 5FSLA 3X0IA 3I7UA 1I9AA 1NFZA 2DSDA 4YPRA 3SONA 1HX3A 3X0PA 4JZVA 1KT9A 3AC9A 1K2EA 3I9XA 4S2WA 1SJYA 2I6KA 2B2KA 2PQVA 3Q2SA 3GRNA 3I7VA 1V8WA 1PUNA 1V8IA 2ICKA 2YYHA 1U20A 3SHDA 5IW5A 3Q93A 1SU2A 1SZ3A 1XSAA 5GHMA 3GZ8A 4S2YA 1XSCA 4KTBA 3X0RA 1V8SA 3MCFA 2G74A 2QJOA 3KVHA
chains in the Genus database with same CATH superfamily
3DKUA 2FVVA 1JKNA 5FSKA 2J8QA 3X0KA 1VHZA 3SMDA 1MQWA 1VIQA 3FJYA 3U53A 3WHWA 4JZUA 1MR2A 2I8TA 1RRQA 3GG6A 1V8VA 3BHOA 1K26A 1HZTA 3N9UA 1G9QA 2YVPA 4KG3A 4KYXA 1VC8A 5DPKA 1RRSA 2A8RA 3BAPA 2VNPA 4N1TA 2O5FA 3GZ6A 2R5WA 2FKBA 3Q2TA 1MUTA 1V8UA 1VK6A 3O6ZA 3J7Ye 1IRYA 3MGMA 1VHGA 3QSJA 5FSIA 3RH7A 5C8LA 4HVYA 3MDGA 5GHNA 3R03A 3X0SA 4DYWA 3A6TA 4V14A 5ANVA 2YVMA 3X0LA 2DSCA 2YVOA 5BONA 2A8SA 5ANTA 2O5WA 2A8TA 3P5TA 2AZWA 5GHIA 2DHOA 1XSBA 1VRLA 3ACAA 1PPXA 3EXQA 3O52A 2O1CA 5ANWA 2FMLA 3X0NA 1PVFA 1VCDA 4ILQA 1SOIA 3FFUA 4J7GA 2W4EA 4JZTA 3X0JA 3ZR1A 2G73A 3L85A 1V8RA 3FCMA 1MP2A 5CFIA 3O69A 1V8TA 1V8LA 3Q4IA 5I8UA 1Q27A 5GHOA 2DSBA 3X0MA 5DD4A 4S2VA 3H95A 1NQYA 1GA7A 1PUSA 1MK1A 2JVBA 3EF5A 4JZSA 3O61A 5GHJA 2VNQA 5GHPA 4S2XA 3HYQA 3E57A 3MDIA 1JRKA 1KTGA 4IJXA 2YVNA 1NQZA 3EESA 1KHZA 1Q54A 3GWYA 2DUKA 2KDVA 1QVJA 3CNGA 5C7QA 3P6YA 1F3YA 3ID9A 5DDGA 3F13A 5ISYA 3Q1PA 1MQEA 2ICJA 2GB5A 1PUQA 3OGAA 2RRKA 3Q91A 3FSPA 2A6TA 1X51A 1V8MA 1VIUA 2GT2A 4C9WA 5BS6A 2B0VA 3A6SA 4ICKA 4K6EA 5ANUA 4C9XA 4MPOA 3GZ5A 3N77A 5FSOA 5IW4A 2QKMB 3O8SA 4NFWA 3ZR0A 3X0OA 4HFQA 1TUMA 1NFSA 1RYAA 1VC9A 2GT4A 5GHQA 3COUA 3DUPA 1Q33A 5LPGA 3A6VA 4ZG0A 1G0SA 3A6UA 2XSQA 3G0QA 1X84A 2A8QA 2CL3A 3EEUA 2KDWA 1PPVA 3X0QA 1X83A 5DEQA 2QJTA 2PNYA 4KG4A 4YPHA 3F6AA 5FSNA 1PPWA 5HZXA 4J7HA 2Q9PA 4N1UA 5C7TA 1R67A 5FSMA 1OW2A 1V8NA 2B06A 3FK9A 2A8PA 5ANSA 4YOQA 2I8UA 4NFXA 3HHJA 3BM4A 5CFJA 1V8YA 5FSLA 3X0IA 3I7UA 1I9AA 1NFZA 2DSDA 4YPRA 3SONA 1HX3A 3X0PA 4JZVA 1KT9A 3AC9A 1K2EA 3I9XA 4S2WA 1SJYA 2I6KA 2B2KA 2PQVA 3Q2SA 3GRNA 3I7VA 1V8WA 1PUNA 1V8IA 2ICKA 2YYHA 1U20A 3SHDA 5IW5A 3Q93A 1SU2A 1SZ3A 1XSAA 5GHMA 3GZ8A 4S2YA 1XSCA 4KTBA 3X0RA 1V8SA 2CZRA 3MCFA 2G74A 2QJOA 3KVHA
chains in the Genus database with same CATH topology
3DKUA 2FVVA 1JKNA 5FSKA 2J8QA 3X0KA 1VHZA 3SMDA 1MQWA 1VIQA 3FJYA 3U53A 3WHWA 4JZUA 1MR2A 2I8TA 1RRQA 3GG6A 1V8VA 3BHOA 1K26A 1HZTA 3N9UA 1G9QA 2YVPA 4KG3A 4KYXA 1VC8A 5DPKA 1RRSA 2A8RA 3BAPA 2VNPA 4N1TA 2O5FA 3GZ6A 2R5WA 2FKBA 3Q2TA 1MUTA 1V8UA 1VK6A 3O6ZA 3J7Ye 1IRYA 3MGMA 1VHGA 3QSJA 5FSIA 3RH7A 5C8LA 4HVYA 3MDGA 5GHNA 3R03A 3X0SA 4DYWA 3A6TA 4V14A 5ANVA 2YVMA 3X0LA 2DSCA 2YVOA 5BONA 2A8SA 5ANTA 2O5WA 2A8TA 3P5TA 2AZWA 5GHIA 2DHOA 1XSBA 1VRLA 3ACAA 1PPXA 3EXQA 3O52A 2O1CA 5ANWA 2FMLA 3X0NA 1PVFA 1VCDA 4ILQA 1SOIA 3FFUA 4J7GA 2W4EA 4JZTA 3X0JA 3ZR1A 2G73A 3L85A 1V8RA 3FCMA 1MP2A 5CFIA 3O69A 1V8TA 1V8LA 3Q4IA 5I8UA 1Q27A 5GHOA 2DSBA 3X0MA 5DD4A 4S2VA 3H95A 1NQYA 1GA7A 1PUSA 1MK1A 2JVBA 3EF5A 4JZSA 3O61A 5GHJA 2VNQA 5GHPA 4S2XA 3HYQA 3E57A 3MDIA 1JRKA 1KTGA 4IJXA 2YVNA 1NQZA 3EESA 1KHZA 1Q54A 3GWYA 2DUKA 2KDVA 1QVJA 3CNGA 5C7QA 3P6YA 1F3YA 3ID9A 5DDGA 3F13A 5ISYA 3Q1PA 1MQEA 2ICJA 2GB5A 1PUQA 3OGAA 2RRKA 3Q91A 3FSPA 2A6TA 1X51A 1V8MA 1VIUA 2GT2A 4C9WA 5BS6A 2B0VA 3A6SA 4ICKA 4K6EA 5ANUA 4C9XA 4MPOA 3GZ5A 3N77A 5FSOA 5IW4A 2QKMB 3O8SA 4NFWA 3ZR0A 3X0OA 4HFQA 1TUMA 1NFSA 1RYAA 1VC9A 2GT4A 5GHQA 3COUA 3DUPA 1Q33A 5LPGA 3A6VA 4ZG0A 1G0SA 3A6UA 2XSQA 3G0QA 1X84A 2A8QA 2CL3A 3EEUA 2KDWA 1PPVA 3X0QA 1X83A 5DEQA 2QJTA 2PNYA 4KG4A 4YPHA 3F6AA 5FSNA 1PPWA 5HZXA 4J7HA 2Q9PA 4N1UA 5C7TA 1R67A 5FSMA 1OW2A 1V8NA 2B06A 3FK9A 2A8PA 5ANSA 4YOQA 2I8UA 4NFXA 3HHJA 3BM4A 5CFJA 1V8YA 5FSLA 3X0IA 3I7UA 1I9AA 1NFZA 2DSDA 4YPRA 3SONA 1HX3A 3X0PA 4JZVA 1KT9A 3AC9A 1K2EA 3I9XA 4S2WA 1SJYA 2I6KA 2B2KA 2PQVA 3Q2SA 3GRNA 3I7VA 1V8WA 1PUNA 1V8IA 2ICKA 2YYHA 1U20A 3SHDA 5IW5A 3Q93A 1SU2A 1SZ3A 1XSAA 5GHMA 3GZ8A 4S2YA 1XSCA 4KTBA 3X0RA 1V8SA 2CZRA 3MCFA 2G74A 2QJOA 3KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKU A;  2FVV A;  1JKN A;  5FSK A;  2J8Q A;  3X0K A;  1VHZ A;  3SMD A;  1MQW A;  1VIQ A;  3FJY A;  3U53 A;  3WHW A;  4JZU A;  1MR2 A;  2I8T A;  1RRQ A;  3GG6 A;  1V8V A;  3BHO A;  1K26 A;  1HZT A;  3N9U A;  1G9Q A;  2YVP A;  4KG3 A;  4KYX A;  1VC8 A;  5DPK A;  1RRS A;  2A8R A;  3BAP A;  2VNP A;  4N1T A;  2O5F A;  3GZ6 A;  2R5W A;  2FKB A;  3Q2T A;  1MUT A;  1V8U A;  1VK6 A;  3O6Z A;  3J7Y e;  1IRY A;  3MGM A;  1VHG A;  3QSJ A;  5FSI A;  3RH7 A;  5C8L A;  4HVY A;  3MDG A;  5GHN A;  3R03 A;  3X0S A;  4DYW A;  3A6T A;  4V14 A;  5ANV A;  2YVM A;  3X0L A;  2DSC A;  2YVO A;  5BON A;  2A8S A;  5ANT A;  2O5W A;  2A8T A;  3P5T A;  2AZW A;  5GHI A;  2DHO A;  1XSB A;  1VRL A;  3ACA A;  1PPX A;  3EXQ A;  3O52 A;  2O1C A;  5ANW A;  2FML A;  3X0N A;  1PVF A;  1VCD A;  4ILQ A;  1SOI A;  3FFU A;  2W4E A;  4JZT A;  3X0J A;  3ZR1 A;  2G73 A;  3L85 A;  1V8R A;  3FCM A;  1MP2 A;  5CFI A;  3O69 A;  1V8T A;  1V8L A;  3Q4I A;  5I8U A;  1Q27 A;  5GHO A;  2DSB A;  3X0M A;  5DD4 A;  4S2V A;  3H95 A;  1NQY A;  1GA7 A;  1PUS A;  1MK1 A;  2JVB A;  3EF5 A;  4JZS A;  3O61 A;  5GHJ A;  2VNQ A;  5GHP A;  4S2X A;  3HYQ A;  3E57 A;  3MDI A;  1JRK A;  1KTG A;  4IJX A;  2YVN A;  1NQZ A;  3EES A;  1KHZ A;  1Q54 A;  3GWY A;  2DUK A;  2KDV A;  1QVJ A;  3CNG A;  5C7Q A;  3P6Y A;  1F3Y A;  3ID9 A;  5DDG A;  3F13 A;  5ISY A;  3Q1P A;  1MQE A;  2ICJ A;  2GB5 A;  1PUQ A;  3OGA A;  2RRK A;  3Q91 A;  3FSP A;  2A6T A;  1X51 A;  1V8M A;  1VIU A;  2GT2 A;  4C9W A;  5BS6 A;  2B0V A;  3A6S A;  4ICK A;  4K6E A;  5ANU A;  4C9X A;  4MPO A;  3GZ5 A;  3N77 A;  5FSO A;  5IW4 A;  2QKM B;  3O8S A;  4NFW A;  3ZR0 A;  3X0O A;  4HFQ A;  1TUM A;  1NFS A;  1RYA A;  1VC9 A;  2GT4 A;  5GHQ A;  3COU A;  3DUP A;  1Q33 A;  5LPG A;  3A6V A;  4ZG0 A;  1G0S A;  3A6U A;  2XSQ A;  3G0Q A;  1X84 A;  2A8Q A;  2CL3 A;  3EEU A;  2KDW A;  1PPV A;  3X0Q A;  1X83 A;  5DEQ A;  2QJT A;  2PNY A;  4KG4 A;  4YPH A;  3F6A A;  5FSN A;  1PPW A;  5HZX A;  2Q9P A;  4N1U A;  5C7T A;  1R67 A;  5FSM A;  1OW2 A;  1V8N A;  2B06 A;  3FK9 A;  2A8P A;  5ANS A;  4YOQ A;  2I8U A;  4NFX A;  3HHJ A;  3BM4 A;  5CFJ A;  1V8Y A;  5FSL A;  3X0I A;  3I7U A;  1I9A A;  1NFZ A;  2DSD A;  4YPR A;  3SON A;  1HX3 A;  3X0P A;  4JZV A;  1KT9 A;  3AC9 A;  1K2E A;  3I9X A;  4S2W A;  1SJY A;  2I6K A;  2B2K A;  2PQV A;  3Q2S A;  3GRN A;  3I7V A;  1V8W A;  1PUN A;  1V8I A;  2ICK A;  2YYH A;  1U20 A;  3SHD A;  5IW5 A;  3Q93 A;  1SU2 A;  1SZ3 A;  1XSA A;  5GHM A;  3GZ8 A;  4S2Y A;  1XSC A;  4KTB A;  3X0R A;  1V8S A;  3MCF A;  2G74 A;  2QJO A;  3KVH A; 
#chains in the Genus database with same CATH topology
 3DKU A;  2FVV A;  1JKN A;  5FSK A;  2J8Q A;  3X0K A;  1VHZ A;  3SMD A;  1MQW A;  1VIQ A;  3FJY A;  3U53 A;  3WHW A;  4JZU A;  1MR2 A;  2I8T A;  1RRQ A;  3GG6 A;  1V8V A;  3BHO A;  1K26 A;  1HZT A;  3N9U A;  1G9Q A;  2YVP A;  4KG3 A;  4KYX A;  1VC8 A;  5DPK A;  1RRS A;  2A8R A;  3BAP A;  2VNP A;  4N1T A;  2O5F A;  3GZ6 A;  2R5W A;  2FKB A;  3Q2T A;  1MUT A;  1V8U A;  1VK6 A;  3O6Z A;  3J7Y e;  1IRY A;  3MGM A;  1VHG A;  3QSJ A;  5FSI A;  3RH7 A;  5C8L A;  4HVY A;  3MDG A;  5GHN A;  3R03 A;  3X0S A;  4DYW A;  3A6T A;  4V14 A;  5ANV A;  2YVM A;  3X0L A;  2DSC A;  2YVO A;  5BON A;  2A8S A;  5ANT A;  2O5W A;  2A8T A;  3P5T A;  2AZW A;  5GHI A;  2DHO A;  1XSB A;  1VRL A;  3ACA A;  1PPX A;  3EXQ A;  3O52 A;  2O1C A;  5ANW A;  2FML A;  3X0N A;  1PVF A;  1VCD A;  4ILQ A;  1SOI A;  3FFU A;  4J7G A;  2W4E A;  4JZT A;  3X0J A;  3ZR1 A;  2G73 A;  3L85 A;  1V8R A;  3FCM A;  1MP2 A;  5CFI A;  3O69 A;  1V8T A;  1V8L A;  3Q4I A;  5I8U A;  1Q27 A;  5GHO A;  2DSB A;  3X0M A;  5DD4 A;  4S2V A;  3H95 A;  1NQY A;  1GA7 A;  1PUS A;  1MK1 A;  2JVB A;  3EF5 A;  4JZS A;  3O61 A;  5GHJ A;  2VNQ A;  5GHP A;  4S2X A;  3HYQ A;  3E57 A;  3MDI A;  1JRK A;  1KTG A;  4IJX A;  2YVN A;  1NQZ A;  3EES A;  1KHZ A;  1Q54 A;  3GWY A;  2DUK A;  2KDV A;  1QVJ A;  3CNG A;  5C7Q A;  3P6Y A;  1F3Y A;  3ID9 A;  5DDG A;  3F13 A;  5ISY A;  3Q1P A;  1MQE A;  2ICJ A;  2GB5 A;  1PUQ A;  3OGA A;  2RRK A;  3Q91 A;  3FSP A;  2A6T A;  1X51 A;  1V8M A;  1VIU A;  2GT2 A;  4C9W A;  5BS6 A;  2B0V A;  3A6S A;  4ICK A;  4K6E A;  5ANU A;  4C9X A;  4MPO A;  3GZ5 A;  3N77 A;  5FSO A;  5IW4 A;  2QKM B;  3O8S A;  4NFW A;  3ZR0 A;  3X0O A;  4HFQ A;  1TUM A;  1NFS A;  1RYA A;  1VC9 A;  2GT4 A;  5GHQ A;  3COU A;  3DUP A;  1Q33 A;  5LPG A;  3A6V A;  4ZG0 A;  1G0S A;  3A6U A;  2XSQ A;  3G0Q A;  1X84 A;  2A8Q A;  2CL3 A;  3EEU A;  2KDW A;  1PPV A;  3X0Q A;  1X83 A;  5DEQ A;  2QJT A;  2PNY A;  4KG4 A;  4YPH A;  3F6A A;  5FSN A;  1PPW A;  5HZX A;  4J7H A;  2Q9P A;  4N1U A;  5C7T A;  1R67 A;  5FSM A;  1OW2 A;  1V8N A;  2B06 A;  3FK9 A;  2A8P A;  5ANS A;  4YOQ A;  2I8U A;  4NFX A;  3HHJ A;  3BM4 A;  5CFJ A;  1V8Y A;  5FSL A;  3X0I A;  3I7U A;  1I9A A;  1NFZ A;  2DSD A;  4YPR A;  3SON A;  1HX3 A;  3X0P A;  4JZV A;  1KT9 A;  3AC9 A;  1K2E A;  3I9X A;  4S2W A;  1SJY A;  2I6K A;  2B2K A;  2PQV A;  3Q2S A;  3GRN A;  3I7V A;  1V8W A;  1PUN A;  1V8I A;  2ICK A;  2YYH A;  1U20 A;  3SHD A;  5IW5 A;  3Q93 A;  1SU2 A;  1SZ3 A;  1XSA A;  5GHM A;  3GZ8 A;  4S2Y A;  1XSC A;  4KTB A;  3X0R A;  1V8S A;  2CZR A;  3MCF A;  2G74 A;  2QJO A;  3KVH A; 
#chains in the Genus database with same CATH homology
 3DKU A;  2FVV A;  1JKN A;  5FSK A;  2J8Q A;  3X0K A;  1VHZ A;  3SMD A;  1MQW A;  1VIQ A;  3FJY A;  3U53 A;  3WHW A;  4JZU A;  1MR2 A;  2I8T A;  1RRQ A;  3GG6 A;  1V8V A;  3BHO A;  1K26 A;  1HZT A;  3N9U A;  1G9Q A;  2YVP A;  4KG3 A;  4KYX A;  1VC8 A;  5DPK A;  1RRS A;  2A8R A;  3BAP A;  2VNP A;  4N1T A;  2O5F A;  3GZ6 A;  2R5W A;  2FKB A;  3Q2T A;  1MUT A;  1V8U A;  1VK6 A;  3O6Z A;  3J7Y e;  1IRY A;  3MGM A;  1VHG A;  3QSJ A;  5FSI A;  3RH7 A;  5C8L A;  4HVY A;  3MDG A;  5GHN A;  3R03 A;  3X0S A;  4DYW A;  3A6T A;  4V14 A;  5ANV A;  2YVM A;  3X0L A;  2DSC A;  2YVO A;  5BON A;  2A8S A;  5ANT A;  2O5W A;  2A8T A;  3P5T A;  2AZW A;  5GHI A;  2DHO A;  1XSB A;  1VRL A;  3ACA A;  1PPX A;  3EXQ A;  3O52 A;  2O1C A;  5ANW A;  2FML A;  3X0N A;  1PVF A;  1VCD A;  4ILQ A;  1SOI A;  3FFU A;  4J7G A;  2W4E A;  4JZT A;  3X0J A;  3ZR1 A;  2G73 A;  3L85 A;  1V8R A;  3FCM A;  1MP2 A;  5CFI A;  3O69 A;  1V8T A;  1V8L A;  3Q4I A;  5I8U A;  1Q27 A;  5GHO A;  2DSB A;  3X0M A;  5DD4 A;  4S2V A;  3H95 A;  1NQY A;  1GA7 A;  1PUS A;  1MK1 A;  2JVB A;  3EF5 A;  4JZS A;  3O61 A;  5GHJ A;  2VNQ A;  5GHP A;  4S2X A;  3HYQ A;  3E57 A;  3MDI A;  1JRK A;  1KTG A;  4IJX A;  2YVN A;  1NQZ A;  3EES A;  1KHZ A;  1Q54 A;  3GWY A;  2DUK A;  2KDV A;  1QVJ A;  3CNG A;  5C7Q A;  3P6Y A;  1F3Y A;  3ID9 A;  5DDG A;  3F13 A;  5ISY A;  3Q1P A;  1MQE A;  2ICJ A;  2GB5 A;  1PUQ A;  3OGA A;  2RRK A;  3Q91 A;  3FSP A;  2A6T A;  1X51 A;  1V8M A;  1VIU A;  2GT2 A;  4C9W A;  5BS6 A;  2B0V A;  3A6S A;  4ICK A;  4K6E A;  5ANU A;  4C9X A;  4MPO A;  3GZ5 A;  3N77 A;  5FSO A;  5IW4 A;  2QKM B;  3O8S A;  4NFW A;  3ZR0 A;  3X0O A;  4HFQ A;  1TUM A;  1NFS A;  1RYA A;  1VC9 A;  2GT4 A;  5GHQ A;  3COU A;  3DUP A;  1Q33 A;  5LPG A;  3A6V A;  4ZG0 A;  1G0S A;  3A6U A;  2XSQ A;  3G0Q A;  1X84 A;  2A8Q A;  2CL3 A;  3EEU A;  2KDW A;  1PPV A;  3X0Q A;  1X83 A;  5DEQ A;  2QJT A;  2PNY A;  4KG4 A;  4YPH A;  3F6A A;  5FSN A;  1PPW A;  5HZX A;  4J7H A;  2Q9P A;  4N1U A;  5C7T A;  1R67 A;  5FSM A;  1OW2 A;  1V8N A;  2B06 A;  3FK9 A;  2A8P A;  5ANS A;  4YOQ A;  2I8U A;  4NFX A;  3HHJ A;  3BM4 A;  5CFJ A;  1V8Y A;  5FSL A;  3X0I A;  3I7U A;  1I9A A;  1NFZ A;  2DSD A;  4YPR A;  3SON A;  1HX3 A;  3X0P A;  4JZV A;  1KT9 A;  3AC9 A;  1K2E A;  3I9X A;  4S2W A;  1SJY A;  2I6K A;  2B2K A;  2PQV A;  3Q2S A;  3GRN A;  3I7V A;  1V8W A;  1PUN A;  1V8I A;  2ICK A;  2YYH A;  1U20 A;  3SHD A;  5IW5 A;  3Q93 A;  1SU2 A;  1SZ3 A;  1XSA A;  5GHM A;  3GZ8 A;  4S2Y A;  1XSC A;  4KTB A;  3X0R A;  1V8S A;  2CZR A;  3MCF A;  2G74 A;  2QJO A;  3KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...