3L85A

Crystal structure of human nudt5 complexed with 8-oxo-dgmp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-sugar pyrophosphatase
publication title Diverse substrate recognition and hydrolysis mechanisms of human NUDT5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.96: ADP-D-ribose pyrophosphorylase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3l85A00
1KHZA 2O1CA 3MGMA 3Q2SA 1KT9A 2A8PA 1HZTA 2JVBA 3DUPA 4V14A 4C9WA 3E57A 2FVVA 3EEUA 2J8QA 1HX3A 1V8VA 2QKMB 4ZG0A 3I7UA 2DUKA 3EESA 3F6AA 2A8TA 2B0VA 3BAPA 4JZTA 3SMDA 4S2YA 4YPHA 1KTGA 3FJYA 4JZSA 2YVPA 3Q4IA 4K6EA 3ZR1A 1NFSA 5IW5A 1NQZA 3AC9A 1MR2A 3I9XA 4HVYA 1Q27A 5DEQA 5ANWA 3MDIA 5FSIA 1XSAA 3X0IA 1RRSA 5FSNA 3X0NA 5FSKA 3ZR0A 1XSBA 1X83A 2YVMA 3H95A 1V8NA 3ID9A 4KG3A 3EXQA 5GHNA 1JKNA 1PUQA 4YPRA 3O52A 2YVOA 1PPWA 1VRLA 5ANTA 3X0KA 1PUSA 5GHMA 1MQEA 1PUNA 1VC8A 5FSMA 4S2XA 2KDWA 3X0SA 1SU2A 1GA7A 1V8IA 3J7Ye 1Q54A 1RYAA 3MDGA 1V8YA 3COUA 2Q9PA 3P5TA 4DYWA 1QVJA 1V8UA 4KYXA 3G0QA 3U53A 2YVNA 1IRYA 5CFJA 3RH7A 2DSBA 3X0RA 3O69A 2FMLA 2O5FA 5ANUA 1NQYA 5FSOA 2PNYA 3GG6A 5I8UA 1JRKA 2CL3A 2A8QA 5C7QA 2GB5A 5ISYA 1VIQA 3FK9A 5BONA 2O5WA 5C7TA 2B2KA 2A8SA 2A8RA 4ILQA 1MP2A 1TUMA 2GT2A 3A6VA 5DD4A 3A6TA 3FFUA 2B06A 1V8WA 2ICKA 2AZWA 4IJXA 2R5WA 3QSJA 1OW2A 3F13A 2I8UA 4ICKA 3X0JA 3GZ5A 3R03A 1V8TA 2DSCA 1MQWA 3MCFA 3X0PA 5FSLA 5DPKA 3Q93A 3O8SA 5C8LA 3X0MA 1SZ3A 1PPVA 5GHJA 3GWYA 3N9UA 4NFXA 3GZ6A 1G0SA 4S2VA 1VIUA 3DKUA 5ANVA 4JZUA 2A6TA 1VCDA 2ICJA 3SONA 3A6SA 1MUTA 2DSDA 2G73A 2KDVA 4KTBA 4N1UA 2DHOA 2QJOA 3ACAA 4S2WA 3GZ8A 1V8MA 3HYQA 4C9XA 2YYHA 4MPOA 1V8SA 1PVFA 3X0QA 1NFZA 3KVHA 5ANSA 1V8RA 4JZVA 1G9QA 3X0LA 3P6YA 3GRNA 2VNQA 5LPGA 2RRKA 3N77A 5CFIA 2PQVA 3OGAA 2FKBA 2I6KA 3CNGA 3HHJA 5HZXA 3Q2TA 1VK6A 1SOIA 1V8LA 1VHZA 2XSQA 1SJYA 5GHIA 3FSPA 1F3YA 1R67A 1VHGA 2VNPA 3SHDA 4YOQA 3EF5A 1Q33A 2GT4A 3BHOA 3O61A 1U20A 1K26A 3Q1PA 1PPXA 3A6UA 1MK1A 3BM4A 2G74A 3Q91A 4NFWA 3WHWA 1X51A 3FCMA 5GHQA 2QJTA 5BS6A 1VC9A 4HFQA 1I9AA 1XSCA 4KG4A 5GHPA 3X0OA 5DDGA 1K2EA 4N1TA 2I8TA 3L85A 3O6ZA 1RRQA 1X84A 2W4EA 5IW4A 5GHOA 3I7VA
chains in the Genus database with same CATH superfamily
1KHZA 2O1CA 3MGMA 3Q2SA 1KT9A 2A8PA 1HZTA 2JVBA 3DUPA 4V14A 4C9WA 3E57A 2FVVA 3EEUA 2J8QA 1HX3A 1V8VA 2QKMB 4ZG0A 3I7UA 2DUKA 3EESA 3F6AA 2A8TA 2B0VA 3BAPA 4JZTA 3SMDA 4S2YA 4YPHA 1KTGA 3FJYA 4JZSA 2YVPA 3Q4IA 4K6EA 3ZR1A 1NFSA 5IW5A 1NQZA 3AC9A 1MR2A 3I9XA 4HVYA 1Q27A 5DEQA 5ANWA 3MDIA 5FSIA 1XSAA 3X0IA 1RRSA 5FSNA 3X0NA 5FSKA 3ZR0A 1XSBA 1X83A 2YVMA 3H95A 1V8NA 3ID9A 4KG3A 3EXQA 5GHNA 1JKNA 1PUQA 4YPRA 3O52A 2YVOA 1PPWA 1VRLA 5ANTA 3X0KA 1PUSA 5GHMA 1MQEA 1PUNA 1VC8A 5FSMA 4S2XA 2KDWA 2CZRA 3X0SA 1SU2A 1GA7A 1V8IA 3J7Ye 1Q54A 1RYAA 3MDGA 1V8YA 3COUA 2Q9PA 3P5TA 4DYWA 1QVJA 1V8UA 4KYXA 3G0QA 3U53A 2YVNA 1IRYA 5CFJA 3RH7A 2DSBA 3X0RA 3O69A 2FMLA 2O5FA 5ANUA 1NQYA 5FSOA 2PNYA 3GG6A 5I8UA 1JRKA 2CL3A 2A8QA 5C7QA 2GB5A 5ISYA 1VIQA 3FK9A 5BONA 2O5WA 5C7TA 2B2KA 2A8SA 2A8RA 4ILQA 1MP2A 1TUMA 2GT2A 3A6VA 5DD4A 3A6TA 3FFUA 2B06A 1V8WA 2ICKA 2AZWA 4IJXA 2R5WA 3QSJA 1OW2A 3F13A 2I8UA 4ICKA 3X0JA 3GZ5A 3R03A 1V8TA 2DSCA 1MQWA 3MCFA 3X0PA 5FSLA 5DPKA 3Q93A 3O8SA 5C8LA 3X0MA 1SZ3A 1PPVA 5GHJA 3GWYA 3N9UA 4NFXA 3GZ6A 1G0SA 4S2VA 1VIUA 3DKUA 4J7HA 5ANVA 2A6TA 1VCDA 2ICJA 3SONA 4JZUA 3A6SA 1MUTA 2DSDA 2G73A 2KDVA 4KTBA 4N1UA 2DHOA 2QJOA 3ACAA 4S2WA 3GZ8A 1V8MA 3HYQA 4C9XA 2YYHA 4MPOA 1V8SA 1PVFA 3X0QA 1NFZA 3KVHA 5ANSA 1V8RA 4JZVA 1G9QA 3X0LA 3P6YA 3GRNA 2VNQA 5LPGA 2RRKA 3N77A 5CFIA 2PQVA 3OGAA 2FKBA 2I6KA 3CNGA 3HHJA 5HZXA 3Q2TA 1VK6A 1SOIA 1V8LA 1VHZA 2XSQA 1SJYA 5GHIA 3FSPA 1F3YA 1R67A 1VHGA 2VNPA 3SHDA 4YOQA 3EF5A 1Q33A 2GT4A 3BHOA 3O61A 1U20A 1K26A 3Q1PA 1PPXA 3A6UA 1MK1A 3BM4A 2G74A 3Q91A 4J7GA 4NFWA 1X51A 3FCMA 5GHQA 3WHWA 2QJTA 5BS6A 1VC9A 4HFQA 1I9AA 1XSCA 4KG4A 5GHPA 3X0OA 5DDGA 1K2EA 4N1TA 2I8TA 3L85A 3O6ZA 1RRQA 1X84A 2W4EA 5IW4A 5GHOA 3I7VA
chains in the Genus database with same CATH topology
1KHZA 2O1CA 3MGMA 3Q2SA 1KT9A 2A8PA 1HZTA 2JVBA 3DUPA 4V14A 4C9WA 3E57A 2FVVA 3EEUA 2J8QA 1HX3A 1V8VA 2QKMB 4ZG0A 3I7UA 2DUKA 3EESA 3F6AA 2A8TA 2B0VA 3BAPA 4JZTA 3SMDA 4S2YA 4YPHA 1KTGA 3FJYA 4JZSA 2YVPA 3Q4IA 4K6EA 3ZR1A 1NFSA 5IW5A 1NQZA 3AC9A 1MR2A 3I9XA 4HVYA 1Q27A 5DEQA 5ANWA 3MDIA 5FSIA 1XSAA 3X0IA 1RRSA 5FSNA 3X0NA 5FSKA 3ZR0A 1XSBA 1X83A 2YVMA 3H95A 1V8NA 3ID9A 4KG3A 3EXQA 5GHNA 1JKNA 1PUQA 4YPRA 3O52A 2YVOA 1PPWA 1VRLA 5ANTA 3X0KA 1PUSA 5GHMA 1MQEA 1PUNA 1VC8A 5FSMA 4S2XA 2KDWA 2CZRA 3X0SA 1SU2A 1GA7A 1V8IA 3J7Ye 1Q54A 1RYAA 3MDGA 1V8YA 3COUA 2Q9PA 3P5TA 4DYWA 1QVJA 1V8UA 4KYXA 3G0QA 3U53A 2YVNA 1IRYA 5CFJA 3RH7A 2DSBA 3X0RA 3O69A 2FMLA 2O5FA 5ANUA 1NQYA 5FSOA 2PNYA 3GG6A 5I8UA 1JRKA 2CL3A 2A8QA 5C7QA 2GB5A 5ISYA 1VIQA 3FK9A 5BONA 2O5WA 5C7TA 2B2KA 2A8SA 2A8RA 4ILQA 1MP2A 1TUMA 2GT2A 3A6VA 5DD4A 3A6TA 3FFUA 2B06A 1V8WA 2ICKA 2AZWA 4IJXA 2R5WA 3QSJA 1OW2A 3F13A 2I8UA 4ICKA 3X0JA 3GZ5A 3R03A 1V8TA 2DSCA 1MQWA 3MCFA 3X0PA 5FSLA 5DPKA 3Q93A 3O8SA 5C8LA 3X0MA 1SZ3A 1PPVA 5GHJA 3GWYA 3N9UA 4NFXA 3GZ6A 1G0SA 4S2VA 1VIUA 3DKUA 4J7HA 5ANVA 2A6TA 1VCDA 2ICJA 3SONA 4JZUA 3A6SA 1MUTA 2DSDA 2G73A 2KDVA 4KTBA 4N1UA 2DHOA 2QJOA 3ACAA 4S2WA 3GZ8A 1V8MA 3HYQA 4C9XA 2YYHA 4MPOA 1V8SA 1PVFA 3X0QA 1NFZA 3KVHA 5ANSA 1V8RA 4JZVA 1G9QA 3X0LA 3P6YA 3GRNA 2VNQA 5LPGA 2RRKA 3N77A 5CFIA 2PQVA 3OGAA 2FKBA 2I6KA 3CNGA 3HHJA 5HZXA 3Q2TA 1VK6A 1SOIA 1V8LA 1VHZA 2XSQA 1SJYA 5GHIA 3FSPA 1F3YA 1R67A 1VHGA 2VNPA 3SHDA 4YOQA 3EF5A 1Q33A 2GT4A 3BHOA 3O61A 1U20A 1K26A 3Q1PA 1PPXA 3A6UA 1MK1A 3BM4A 2G74A 3Q91A 4J7GA 4NFWA 1X51A 3FCMA 5GHQA 3WHWA 2QJTA 5BS6A 1VC9A 4HFQA 1I9AA 1XSCA 4KG4A 5GHPA 3X0OA 5DDGA 1K2EA 4N1TA 2I8TA 3L85A 3O6ZA 1RRQA 1X84A 2W4EA 5IW4A 5GHOA 3I7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHZ A;  2O1C A;  3MGM A;  3Q2S A;  1KT9 A;  2A8P A;  1HZT A;  2JVB A;  3DUP A;  4V14 A;  4C9W A;  3E57 A;  2FVV A;  3EEU A;  2J8Q A;  1HX3 A;  1V8V A;  2QKM B;  4ZG0 A;  3I7U A;  2DUK A;  3EES A;  3F6A A;  2A8T A;  2B0V A;  3BAP A;  4JZT A;  3SMD A;  4S2Y A;  4YPH A;  1KTG A;  3FJY A;  4JZS A;  2YVP A;  3Q4I A;  4K6E A;  3ZR1 A;  1NFS A;  5IW5 A;  1NQZ A;  3AC9 A;  1MR2 A;  3I9X A;  4HVY A;  1Q27 A;  5DEQ A;  5ANW A;  3MDI A;  5FSI A;  1XSA A;  3X0I A;  1RRS A;  5FSN A;  3X0N A;  5FSK A;  3ZR0 A;  1XSB A;  1X83 A;  2YVM A;  3H95 A;  1V8N A;  3ID9 A;  4KG3 A;  3EXQ A;  5GHN A;  1JKN A;  1PUQ A;  4YPR A;  3O52 A;  2YVO A;  1PPW A;  1VRL A;  5ANT A;  3X0K A;  1PUS A;  5GHM A;  1MQE A;  1PUN A;  1VC8 A;  5FSM A;  4S2X A;  2KDW A;  3X0S A;  1SU2 A;  1GA7 A;  1V8I A;  3J7Y e;  1Q54 A;  1RYA A;  3MDG A;  1V8Y A;  3COU A;  2Q9P A;  3P5T A;  4DYW A;  1QVJ A;  1V8U A;  4KYX A;  3G0Q A;  3U53 A;  2YVN A;  1IRY A;  5CFJ A;  3RH7 A;  2DSB A;  3X0R A;  3O69 A;  2FML A;  2O5F A;  5ANU A;  1NQY A;  5FSO A;  2PNY A;  3GG6 A;  5I8U A;  1JRK A;  2CL3 A;  2A8Q A;  5C7Q A;  2GB5 A;  5ISY A;  1VIQ A;  3FK9 A;  5BON A;  2O5W A;  5C7T A;  2B2K A;  2A8S A;  2A8R A;  4ILQ A;  1MP2 A;  1TUM A;  2GT2 A;  3A6V A;  5DD4 A;  3A6T A;  3FFU A;  2B06 A;  1V8W A;  2ICK A;  2AZW A;  4IJX A;  2R5W A;  3QSJ A;  1OW2 A;  3F13 A;  2I8U A;  4ICK A;  3X0J A;  3GZ5 A;  3R03 A;  1V8T A;  2DSC A;  1MQW A;  3MCF A;  3X0P A;  5FSL A;  5DPK A;  3Q93 A;  3O8S A;  5C8L A;  3X0M A;  1SZ3 A;  1PPV A;  5GHJ A;  3GWY A;  3N9U A;  4NFX A;  3GZ6 A;  1G0S A;  4S2V A;  1VIU A;  3DKU A;  5ANV A;  4JZU A;  2A6T A;  1VCD A;  2ICJ A;  3SON A;  3A6S A;  1MUT A;  2DSD A;  2G73 A;  2KDV A;  4KTB A;  4N1U A;  2DHO A;  2QJO A;  3ACA A;  4S2W A;  3GZ8 A;  1V8M A;  3HYQ A;  4C9X A;  2YYH A;  4MPO A;  1V8S A;  1PVF A;  3X0Q A;  1NFZ A;  3KVH A;  5ANS A;  1V8R A;  4JZV A;  1G9Q A;  3X0L A;  3P6Y A;  3GRN A;  2VNQ A;  5LPG A;  2RRK A;  3N77 A;  5CFI A;  2PQV A;  3OGA A;  2FKB A;  2I6K A;  3CNG A;  3HHJ A;  5HZX A;  3Q2T A;  1VK6 A;  1SOI A;  1V8L A;  1VHZ A;  2XSQ A;  1SJY A;  5GHI A;  3FSP A;  1F3Y A;  1R67 A;  1VHG A;  2VNP A;  3SHD A;  4YOQ A;  3EF5 A;  1Q33 A;  2GT4 A;  3BHO A;  3O61 A;  1U20 A;  1K26 A;  3Q1P A;  1PPX A;  3A6U A;  1MK1 A;  3BM4 A;  2G74 A;  3Q91 A;  4NFW A;  3WHW A;  1X51 A;  3FCM A;  5GHQ A;  2QJT A;  5BS6 A;  1VC9 A;  4HFQ A;  1I9A A;  1XSC A;  4KG4 A;  5GHP A;  3X0O A;  5DDG A;  1K2E A;  4N1T A;  2I8T A;  3L85 A;  3O6Z A;  1RRQ A;  1X84 A;  2W4E A;  5IW4 A;  5GHO A;  3I7V A; 
#chains in the Genus database with same CATH topology
 1KHZ A;  2O1C A;  3MGM A;  3Q2S A;  1KT9 A;  2A8P A;  1HZT A;  2JVB A;  3DUP A;  4V14 A;  4C9W A;  3E57 A;  2FVV A;  3EEU A;  2J8Q A;  1HX3 A;  1V8V A;  2QKM B;  4ZG0 A;  3I7U A;  2DUK A;  3EES A;  3F6A A;  2A8T A;  2B0V A;  3BAP A;  4JZT A;  3SMD A;  4S2Y A;  4YPH A;  1KTG A;  3FJY A;  4JZS A;  2YVP A;  3Q4I A;  4K6E A;  3ZR1 A;  1NFS A;  5IW5 A;  1NQZ A;  3AC9 A;  1MR2 A;  3I9X A;  4HVY A;  1Q27 A;  5DEQ A;  5ANW A;  3MDI A;  5FSI A;  1XSA A;  3X0I A;  1RRS A;  5FSN A;  3X0N A;  5FSK A;  3ZR0 A;  1XSB A;  1X83 A;  2YVM A;  3H95 A;  1V8N A;  3ID9 A;  4KG3 A;  3EXQ A;  5GHN A;  1JKN A;  1PUQ A;  4YPR A;  3O52 A;  2YVO A;  1PPW A;  1VRL A;  5ANT A;  3X0K A;  1PUS A;  5GHM A;  1MQE A;  1PUN A;  1VC8 A;  5FSM A;  4S2X A;  2KDW A;  2CZR A;  3X0S A;  1SU2 A;  1GA7 A;  1V8I A;  3J7Y e;  1Q54 A;  1RYA A;  3MDG A;  1V8Y A;  3COU A;  2Q9P A;  3P5T A;  4DYW A;  1QVJ A;  1V8U A;  4KYX A;  3G0Q A;  3U53 A;  2YVN A;  1IRY A;  5CFJ A;  3RH7 A;  2DSB A;  3X0R A;  3O69 A;  2FML A;  2O5F A;  5ANU A;  1NQY A;  5FSO A;  2PNY A;  3GG6 A;  5I8U A;  1JRK A;  2CL3 A;  2A8Q A;  5C7Q A;  2GB5 A;  5ISY A;  1VIQ A;  3FK9 A;  5BON A;  2O5W A;  5C7T A;  2B2K A;  2A8S A;  2A8R A;  4ILQ A;  1MP2 A;  1TUM A;  2GT2 A;  3A6V A;  5DD4 A;  3A6T A;  3FFU A;  2B06 A;  1V8W A;  2ICK A;  2AZW A;  4IJX A;  2R5W A;  3QSJ A;  1OW2 A;  3F13 A;  2I8U A;  4ICK A;  3X0J A;  3GZ5 A;  3R03 A;  1V8T A;  2DSC A;  1MQW A;  3MCF A;  3X0P A;  5FSL A;  5DPK A;  3Q93 A;  3O8S A;  5C8L A;  3X0M A;  1SZ3 A;  1PPV A;  5GHJ A;  3GWY A;  3N9U A;  4NFX A;  3GZ6 A;  1G0S A;  4S2V A;  1VIU A;  3DKU A;  4J7H A;  5ANV A;  2A6T A;  1VCD A;  2ICJ A;  3SON A;  4JZU A;  3A6S A;  1MUT A;  2DSD A;  2G73 A;  2KDV A;  4KTB A;  4N1U A;  2DHO A;  2QJO A;  3ACA A;  4S2W A;  3GZ8 A;  1V8M A;  3HYQ A;  4C9X A;  2YYH A;  4MPO A;  1V8S A;  1PVF A;  3X0Q A;  1NFZ A;  3KVH A;  5ANS A;  1V8R A;  4JZV A;  1G9Q A;  3X0L A;  3P6Y A;  3GRN A;  2VNQ A;  5LPG A;  2RRK A;  3N77 A;  5CFI A;  2PQV A;  3OGA A;  2FKB A;  2I6K A;  3CNG A;  3HHJ A;  5HZX A;  3Q2T A;  1VK6 A;  1SOI A;  1V8L A;  1VHZ A;  2XSQ A;  1SJY A;  5GHI A;  3FSP A;  1F3Y A;  1R67 A;  1VHG A;  2VNP A;  3SHD A;  4YOQ A;  3EF5 A;  1Q33 A;  2GT4 A;  3BHO A;  3O61 A;  1U20 A;  1K26 A;  3Q1P A;  1PPX A;  3A6U A;  1MK1 A;  3BM4 A;  2G74 A;  3Q91 A;  4J7G A;  4NFW A;  1X51 A;  3FCM A;  5GHQ A;  3WHW A;  2QJT A;  5BS6 A;  1VC9 A;  4HFQ A;  1I9A A;  1XSC A;  4KG4 A;  5GHP A;  3X0O A;  5DDG A;  1K2E A;  4N1T A;  2I8T A;  3L85 A;  3O6Z A;  1RRQ A;  1X84 A;  2W4E A;  5IW4 A;  5GHO A;  3I7V A; 
#chains in the Genus database with same CATH homology
 1KHZ A;  2O1C A;  3MGM A;  3Q2S A;  1KT9 A;  2A8P A;  1HZT A;  2JVB A;  3DUP A;  4V14 A;  4C9W A;  3E57 A;  2FVV A;  3EEU A;  2J8Q A;  1HX3 A;  1V8V A;  2QKM B;  4ZG0 A;  3I7U A;  2DUK A;  3EES A;  3F6A A;  2A8T A;  2B0V A;  3BAP A;  4JZT A;  3SMD A;  4S2Y A;  4YPH A;  1KTG A;  3FJY A;  4JZS A;  2YVP A;  3Q4I A;  4K6E A;  3ZR1 A;  1NFS A;  5IW5 A;  1NQZ A;  3AC9 A;  1MR2 A;  3I9X A;  4HVY A;  1Q27 A;  5DEQ A;  5ANW A;  3MDI A;  5FSI A;  1XSA A;  3X0I A;  1RRS A;  5FSN A;  3X0N A;  5FSK A;  3ZR0 A;  1XSB A;  1X83 A;  2YVM A;  3H95 A;  1V8N A;  3ID9 A;  4KG3 A;  3EXQ A;  5GHN A;  1JKN A;  1PUQ A;  4YPR A;  3O52 A;  2YVO A;  1PPW A;  1VRL A;  5ANT A;  3X0K A;  1PUS A;  5GHM A;  1MQE A;  1PUN A;  1VC8 A;  5FSM A;  4S2X A;  2KDW A;  2CZR A;  3X0S A;  1SU2 A;  1GA7 A;  1V8I A;  3J7Y e;  1Q54 A;  1RYA A;  3MDG A;  1V8Y A;  3COU A;  2Q9P A;  3P5T A;  4DYW A;  1QVJ A;  1V8U A;  4KYX A;  3G0Q A;  3U53 A;  2YVN A;  1IRY A;  5CFJ A;  3RH7 A;  2DSB A;  3X0R A;  3O69 A;  2FML A;  2O5F A;  5ANU A;  1NQY A;  5FSO A;  2PNY A;  3GG6 A;  5I8U A;  1JRK A;  2CL3 A;  2A8Q A;  5C7Q A;  2GB5 A;  5ISY A;  1VIQ A;  3FK9 A;  5BON A;  2O5W A;  5C7T A;  2B2K A;  2A8S A;  2A8R A;  4ILQ A;  1MP2 A;  1TUM A;  2GT2 A;  3A6V A;  5DD4 A;  3A6T A;  3FFU A;  2B06 A;  1V8W A;  2ICK A;  2AZW A;  4IJX A;  2R5W A;  3QSJ A;  1OW2 A;  3F13 A;  2I8U A;  4ICK A;  3X0J A;  3GZ5 A;  3R03 A;  1V8T A;  2DSC A;  1MQW A;  3MCF A;  3X0P A;  5FSL A;  5DPK A;  3Q93 A;  3O8S A;  5C8L A;  3X0M A;  1SZ3 A;  1PPV A;  5GHJ A;  3GWY A;  3N9U A;  4NFX A;  3GZ6 A;  1G0S A;  4S2V A;  1VIU A;  3DKU A;  4J7H A;  5ANV A;  2A6T A;  1VCD A;  2ICJ A;  3SON A;  4JZU A;  3A6S A;  1MUT A;  2DSD A;  2G73 A;  2KDV A;  4KTB A;  4N1U A;  2DHO A;  2QJO A;  3ACA A;  4S2W A;  3GZ8 A;  1V8M A;  3HYQ A;  4C9X A;  2YYH A;  4MPO A;  1V8S A;  1PVF A;  3X0Q A;  1NFZ A;  3KVH A;  5ANS A;  1V8R A;  4JZV A;  1G9Q A;  3X0L A;  3P6Y A;  3GRN A;  2VNQ A;  5LPG A;  2RRK A;  3N77 A;  5CFI A;  2PQV A;  3OGA A;  2FKB A;  2I6K A;  3CNG A;  3HHJ A;  5HZX A;  3Q2T A;  1VK6 A;  1SOI A;  1V8L A;  1VHZ A;  2XSQ A;  1SJY A;  5GHI A;  3FSP A;  1F3Y A;  1R67 A;  1VHG A;  2VNP A;  3SHD A;  4YOQ A;  3EF5 A;  1Q33 A;  2GT4 A;  3BHO A;  3O61 A;  1U20 A;  1K26 A;  3Q1P A;  1PPX A;  3A6U A;  1MK1 A;  3BM4 A;  2G74 A;  3Q91 A;  4J7G A;  4NFW A;  1X51 A;  3FCM A;  5GHQ A;  3WHW A;  2QJT A;  5BS6 A;  1VC9 A;  4HFQ A;  1I9A A;  1XSC A;  4KG4 A;  5GHP A;  3X0O A;  5DDG A;  1K2E A;  4N1T A;  2I8T A;  3L85 A;  3O6Z A;  1RRQ A;  1X84 A;  2W4E A;  5IW4 A;  5GHO A;  3I7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...