3L85A

Crystal structure of human nudt5 complexed with 8-oxo-dgmp
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
195
structure length
195
Chain Sequence
b'KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-sugar pyrophosphatase
publication title Diverse substrate recognition and hydrolysis mechanisms of human NUDT5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.96: ADP-D-ribose pyrophosphorylase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3l85A00
4KG3A 1I9AA 5FSMA 1V8LA 1VHGA 2GT2A 1MUTA 2VNPA 2YVPA 3COUA 2FMLA 2G73A 3N9UA 5BS6A 4YOQA 4KTBA 2YVNA 3DKUA 5ANUA 1NQZA 3Q93A 3U53A 1SU2A 1MR2A 3HYQA 1V8YA 1SZ3A 2QJTA 3A6TA 3EEUA 2DUKA 5FSNA 5IW5A 3GG6A 3I9XA 2A8TA 4HFQA 3SMDA 3GZ6A 3HHJA 3SONA 1VC9A 1X51A 4JZTA 3GRNA 1MP2A 2G74A 1V8UA 1V8WA 1RRQA 2VNQA 3F6AA 5GHOA 2R5WA 3ZR0A 3FK9A 1PPVA 3J7Ye 2YYHA 3BM4A 5HZXA 1V8TA 3O61A 2AZWA 3RH7A 2FVVA 1KTGA 3X0OA 1VC8A 3GWYA 4ILQA 4K6EA 1OW2A 3R03A 3GZ5A 3X0NA 3ZR1A 5IW4A 1SJYA 1V8IA 2ICJA 3O6ZA 3X0MA 1PUSA 2O5WA 2QJOA 2RRKA 5DD4A 1VRLA 3P6YA 4C9WA 4DYWA 1NFSA 3EXQA 3Q2SA 4S2WA 1K26A 1RYAA 2A8QA 3L85A 1Q54A 2A8RA 5GHPA 1MQWA 4V14A 1V8RA 3I7VA 5GHJA 5BONA 3P5TA 1TUMA 3X0RA 3G0QA 4JZUA 1X83A 2O1CA 4IJXA 1PVFA 4N1UA 5GHIA 2O5FA 1G9QA 1HZTA 5CFIA 3X0JA 2A8PA 3Q4IA 4S2XA 5DDGA 2A8SA 2QKMB 3FFUA 5ANWA 1MK1A 3Q91A 3F13A 2DSDA 2I8TA 3FSPA 1XSAA 2PQVA 1Q33A 3X0SA 1RRSA 1V8VA 4KYXA 3WHWA 5C7QA 5C7TA 1GA7A 2B06A 1F3YA 1VIQA 5FSLA 5I8UA 1X84A 2J8QA 1SOIA 1NQYA 1XSBA 3EESA 2B0VA 4ICKA 3A6VA 3A6SA 4JZVA 1Q27A 1V8SA 3EF5A 5ISYA 5GHNA 1MQEA 3BAPA 4ZG0A 4YPRA 3X0IA 1PUQA 2ICKA 2YVOA 4JZSA 1NFZA 1U20A 3DUPA 3H95A 3I7UA 4KG4A 5ANTA 3O8SA 5ANVA 2PNYA 4NFWA 1PUNA 3ACAA 5CFJA 1PPXA 3BHOA 1R67A 5FSOA 5LPGA 1VCDA 1VK6A 1HX3A 4S2YA 5DPKA 1G0SA 1VIUA 3X0LA 2I6KA 1VHZA 1QVJA 2JVBA 2GB5A 4MPOA 3MGMA 4S2VA 3X0PA 3O69A 5C8LA 3O52A 2DHOA 1JKNA 5GHQA 3ID9A 5DEQA 3X0KA 1PPWA 3N77A 4N1TA 2XSQA 3FCMA 3E57A 3FJYA 3A6UA 2W4EA 2GT4A 5FSKA 3SHDA 1XSCA 2KDWA 3CNGA 1IRYA 5GHMA 2A6TA 3AC9A 1V8MA 1K2EA 4NFXA 1KHZA 3Q2TA 2KDVA 3KVHA 1KT9A 1V8NA 2CL3A 3QSJA 4C9XA 3X0QA 2DSBA 1JRKA 2B2KA 3GZ8A 3MCFA 3Q1PA 2I8UA 5ANSA 3MDIA 2DSCA 2FKBA 2Q9PA 4HVYA 5FSIA 3MDGA 2YVMA 3OGAA 4YPHA
chains in the Genus database with same CATH superfamily
4KG3A 1I9AA 5FSMA 1V8LA 1VHGA 2GT2A 1MUTA 2VNPA 2YVPA 3COUA 2FMLA 2G73A 3N9UA 5BS6A 4YOQA 4KTBA 2YVNA 3DKUA 5ANUA 1NQZA 3Q93A 3U53A 1SU2A 1MR2A 3HYQA 1V8YA 1SZ3A 2QJTA 3A6TA 3EEUA 2DUKA 5FSNA 5IW5A 3GG6A 3I9XA 2A8TA 4HFQA 3SMDA 3GZ6A 3HHJA 3SONA 1VC9A 1X51A 4JZTA 3GRNA 1MP2A 2G74A 1V8UA 1V8WA 1RRQA 2VNQA 3F6AA 5GHOA 2R5WA 3ZR0A 3FK9A 1PPVA 3J7Ye 2YYHA 3BM4A 5HZXA 1V8TA 3O61A 2AZWA 3RH7A 2FVVA 1KTGA 3X0OA 1VC8A 3GWYA 4ILQA 4K6EA 1OW2A 3R03A 3GZ5A 3X0NA 3ZR1A 5IW4A 1SJYA 1V8IA 2ICJA 3O6ZA 3X0MA 1PUSA 2O5WA 2QJOA 2RRKA 5DD4A 1VRLA 3P6YA 4C9WA 4DYWA 1NFSA 3EXQA 3Q2SA 4S2WA 1K26A 1RYAA 2A8QA 3L85A 1Q54A 2A8RA 5GHPA 1MQWA 4V14A 1V8RA 3I7VA 5GHJA 5BONA 3P5TA 1TUMA 3X0RA 3G0QA 4JZUA 1X83A 2O1CA 4IJXA 1PVFA 4N1UA 5GHIA 2O5FA 1G9QA 1HZTA 5CFIA 3X0JA 2A8PA 3Q4IA 4S2XA 5DDGA 2A8SA 2QKMB 3FFUA 5ANWA 1MK1A 3Q91A 3F13A 2DSDA 2I8TA 3FSPA 1XSAA 2PQVA 1Q33A 3X0SA 1RRSA 1V8VA 4KYXA 3WHWA 5C7QA 4J7HA 1GA7A 2B06A 5C7TA 1F3YA 1VIQA 5FSLA 5I8UA 4J7GA 1X84A 2J8QA 1SOIA 1NQYA 1XSBA 3EESA 2B0VA 4ICKA 3A6VA 3A6SA 4JZVA 1Q27A 1V8SA 3EF5A 5ISYA 5GHNA 1MQEA 3BAPA 4ZG0A 4YPRA 3X0IA 1PUQA 2ICKA 2YVOA 4JZSA 1NFZA 1U20A 3DUPA 3H95A 3I7UA 4KG4A 5ANTA 3O8SA 5ANVA 2PNYA 4NFWA 1PUNA 3ACAA 5CFJA 1PPXA 3BHOA 1R67A 5FSOA 5LPGA 1VCDA 1VK6A 1HX3A 4S2YA 5DPKA 1G0SA 1VIUA 3X0LA 2I6KA 1VHZA 1QVJA 2JVBA 2GB5A 4MPOA 3MGMA 4S2VA 3X0PA 3O69A 5C8LA 3O52A 2DHOA 1JKNA 5GHQA 3ID9A 5DEQA 3X0KA 1PPWA 3N77A 4N1TA 2XSQA 3FCMA 3E57A 3FJYA 3A6UA 2W4EA 2GT4A 5FSKA 3SHDA 1XSCA 2KDWA 3CNGA 1IRYA 5GHMA 2A6TA 3AC9A 1V8MA 1K2EA 4NFXA 1KHZA 3Q2TA 2KDVA 3KVHA 1KT9A 1V8NA 2CL3A 3QSJA 4C9XA 3X0QA 2DSBA 1JRKA 2B2KA 3GZ8A 3MCFA 3Q1PA 2I8UA 5ANSA 2CZRA 3MDIA 2DSCA 2FKBA 2Q9PA 4HVYA 5FSIA 3MDGA 2YVMA 3OGAA 4YPHA
chains in the Genus database with same CATH topology
4KG3A 1I9AA 5FSMA 1V8LA 1VHGA 2GT2A 1MUTA 2VNPA 2YVPA 3COUA 2FMLA 2G73A 3N9UA 5BS6A 4YOQA 4KTBA 2YVNA 3DKUA 5ANUA 1NQZA 3Q93A 3U53A 1SU2A 1MR2A 3HYQA 1V8YA 1SZ3A 2QJTA 3A6TA 3EEUA 2DUKA 5FSNA 5IW5A 3GG6A 3I9XA 2A8TA 4HFQA 3SMDA 3GZ6A 3HHJA 3SONA 1VC9A 1X51A 4JZTA 3GRNA 1MP2A 2G74A 1V8UA 1V8WA 1RRQA 2VNQA 3F6AA 5GHOA 2R5WA 3ZR0A 3FK9A 1PPVA 3J7Ye 2YYHA 3BM4A 5HZXA 1V8TA 3O61A 2AZWA 3RH7A 2FVVA 1KTGA 3X0OA 1VC8A 3GWYA 4ILQA 4K6EA 1OW2A 3R03A 3GZ5A 3X0NA 3ZR1A 5IW4A 1SJYA 1V8IA 2ICJA 3O6ZA 3X0MA 1PUSA 2O5WA 2QJOA 2RRKA 5DD4A 1VRLA 3P6YA 4C9WA 4DYWA 1NFSA 3EXQA 3Q2SA 4S2WA 1K26A 1RYAA 2A8QA 3L85A 1Q54A 2A8RA 5GHPA 1MQWA 4V14A 1V8RA 3I7VA 5GHJA 5BONA 3P5TA 1TUMA 3X0RA 3G0QA 4JZUA 1X83A 2O1CA 4IJXA 1PVFA 4N1UA 5GHIA 2O5FA 1G9QA 1HZTA 5CFIA 3X0JA 2A8PA 3Q4IA 4S2XA 5DDGA 2A8SA 2QKMB 3FFUA 5ANWA 1MK1A 3Q91A 3F13A 2DSDA 2I8TA 3FSPA 1XSAA 2PQVA 1Q33A 3X0SA 1RRSA 1V8VA 4KYXA 3WHWA 5C7QA 4J7HA 1GA7A 2B06A 5C7TA 1F3YA 1VIQA 5FSLA 5I8UA 4J7GA 1X84A 2J8QA 1SOIA 1NQYA 1XSBA 3EESA 2B0VA 4ICKA 3A6VA 3A6SA 4JZVA 1Q27A 1V8SA 3EF5A 5ISYA 5GHNA 1MQEA 3BAPA 4ZG0A 4YPRA 3X0IA 1PUQA 2ICKA 2YVOA 4JZSA 1NFZA 1U20A 3DUPA 3H95A 3I7UA 4KG4A 5ANTA 3O8SA 5ANVA 2PNYA 4NFWA 1PUNA 3ACAA 5CFJA 1PPXA 3BHOA 1R67A 5FSOA 5LPGA 1VCDA 1VK6A 1HX3A 4S2YA 5DPKA 1G0SA 1VIUA 3X0LA 2I6KA 1VHZA 1QVJA 2JVBA 2GB5A 4MPOA 3MGMA 4S2VA 3X0PA 3O69A 5C8LA 3O52A 2DHOA 1JKNA 5GHQA 3ID9A 5DEQA 3X0KA 1PPWA 3N77A 4N1TA 2XSQA 3FCMA 3E57A 3FJYA 3A6UA 2W4EA 2GT4A 5FSKA 3SHDA 1XSCA 2KDWA 3CNGA 1IRYA 5GHMA 2A6TA 3AC9A 1V8MA 1K2EA 4NFXA 1KHZA 3Q2TA 2KDVA 3KVHA 1KT9A 1V8NA 2CL3A 3QSJA 4C9XA 3X0QA 2DSBA 1JRKA 2B2KA 3GZ8A 3MCFA 3Q1PA 2I8UA 5ANSA 2CZRA 3MDIA 2DSCA 2FKBA 2Q9PA 4HVYA 5FSIA 3MDGA 2YVMA 3OGAA 4YPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KG3 A;  1I9A A;  5FSM A;  1V8L A;  1VHG A;  2GT2 A;  1MUT A;  2VNP A;  2YVP A;  3COU A;  2FML A;  2G73 A;  3N9U A;  5BS6 A;  4YOQ A;  4KTB A;  2YVN A;  3DKU A;  5ANU A;  1NQZ A;  3Q93 A;  3U53 A;  1SU2 A;  1MR2 A;  3HYQ A;  1V8Y A;  1SZ3 A;  2QJT A;  3A6T A;  3EEU A;  2DUK A;  5FSN A;  5IW5 A;  3GG6 A;  3I9X A;  2A8T A;  4HFQ A;  3SMD A;  3GZ6 A;  3HHJ A;  3SON A;  1VC9 A;  1X51 A;  4JZT A;  3GRN A;  1MP2 A;  2G74 A;  1V8U A;  1V8W A;  1RRQ A;  2VNQ A;  3F6A A;  5GHO A;  2R5W A;  3ZR0 A;  3FK9 A;  1PPV A;  3J7Y e;  2YYH A;  3BM4 A;  5HZX A;  1V8T A;  3O61 A;  2AZW A;  3RH7 A;  2FVV A;  1KTG A;  3X0O A;  1VC8 A;  3GWY A;  4ILQ A;  4K6E A;  1OW2 A;  3R03 A;  3GZ5 A;  3X0N A;  3ZR1 A;  5IW4 A;  1SJY A;  1V8I A;  2ICJ A;  3O6Z A;  3X0M A;  1PUS A;  2O5W A;  2QJO A;  2RRK A;  5DD4 A;  1VRL A;  3P6Y A;  4C9W A;  4DYW A;  1NFS A;  3EXQ A;  3Q2S A;  4S2W A;  1K26 A;  1RYA A;  2A8Q A;  3L85 A;  1Q54 A;  2A8R A;  5GHP A;  1MQW A;  4V14 A;  1V8R A;  3I7V A;  5GHJ A;  5BON A;  3P5T A;  1TUM A;  3X0R A;  3G0Q A;  4JZU A;  1X83 A;  2O1C A;  4IJX A;  1PVF A;  4N1U A;  5GHI A;  2O5F A;  1G9Q A;  1HZT A;  5CFI A;  3X0J A;  2A8P A;  3Q4I A;  4S2X A;  5DDG A;  2A8S A;  2QKM B;  3FFU A;  5ANW A;  1MK1 A;  3Q91 A;  3F13 A;  2DSD A;  2I8T A;  3FSP A;  1XSA A;  2PQV A;  1Q33 A;  3X0S A;  1RRS A;  1V8V A;  4KYX A;  3WHW A;  5C7Q A;  5C7T A;  1GA7 A;  2B06 A;  1F3Y A;  1VIQ A;  5FSL A;  5I8U A;  1X84 A;  2J8Q A;  1SOI A;  1NQY A;  1XSB A;  3EES A;  2B0V A;  4ICK A;  3A6V A;  3A6S A;  4JZV A;  1Q27 A;  1V8S A;  3EF5 A;  5ISY A;  5GHN A;  1MQE A;  3BAP A;  4ZG0 A;  4YPR A;  3X0I A;  1PUQ A;  2ICK A;  2YVO A;  4JZS A;  1NFZ A;  1U20 A;  3DUP A;  3H95 A;  3I7U A;  4KG4 A;  5ANT A;  3O8S A;  5ANV A;  2PNY A;  4NFW A;  1PUN A;  3ACA A;  5CFJ A;  1PPX A;  3BHO A;  1R67 A;  5FSO A;  5LPG A;  1VCD A;  1VK6 A;  1HX3 A;  4S2Y A;  5DPK A;  1G0S A;  1VIU A;  3X0L A;  2I6K A;  1VHZ A;  1QVJ A;  2JVB A;  2GB5 A;  4MPO A;  3MGM A;  4S2V A;  3X0P A;  3O69 A;  5C8L A;  3O52 A;  2DHO A;  1JKN A;  5GHQ A;  3ID9 A;  5DEQ A;  3X0K A;  1PPW A;  3N77 A;  4N1T A;  2XSQ A;  3FCM A;  3E57 A;  3FJY A;  3A6U A;  2W4E A;  2GT4 A;  5FSK A;  3SHD A;  1XSC A;  2KDW A;  3CNG A;  1IRY A;  5GHM A;  2A6T A;  3AC9 A;  1V8M A;  1K2E A;  4NFX A;  1KHZ A;  3Q2T A;  2KDV A;  3KVH A;  1KT9 A;  1V8N A;  2CL3 A;  3QSJ A;  4C9X A;  3X0Q A;  2DSB A;  1JRK A;  2B2K A;  3GZ8 A;  3MCF A;  3Q1P A;  2I8U A;  5ANS A;  3MDI A;  2DSC A;  2FKB A;  2Q9P A;  4HVY A;  5FSI A;  3MDG A;  2YVM A;  3OGA A;  4YPH A; 
#chains in the Genus database with same CATH topology
 4KG3 A;  1I9A A;  5FSM A;  1V8L A;  1VHG A;  2GT2 A;  1MUT A;  2VNP A;  2YVP A;  3COU A;  2FML A;  2G73 A;  3N9U A;  5BS6 A;  4YOQ A;  4KTB A;  2YVN A;  3DKU A;  5ANU A;  1NQZ A;  3Q93 A;  3U53 A;  1SU2 A;  1MR2 A;  3HYQ A;  1V8Y A;  1SZ3 A;  2QJT A;  3A6T A;  3EEU A;  2DUK A;  5FSN A;  5IW5 A;  3GG6 A;  3I9X A;  2A8T A;  4HFQ A;  3SMD A;  3GZ6 A;  3HHJ A;  3SON A;  1VC9 A;  1X51 A;  4JZT A;  3GRN A;  1MP2 A;  2G74 A;  1V8U A;  1V8W A;  1RRQ A;  2VNQ A;  3F6A A;  5GHO A;  2R5W A;  3ZR0 A;  3FK9 A;  1PPV A;  3J7Y e;  2YYH A;  3BM4 A;  5HZX A;  1V8T A;  3O61 A;  2AZW A;  3RH7 A;  2FVV A;  1KTG A;  3X0O A;  1VC8 A;  3GWY A;  4ILQ A;  4K6E A;  1OW2 A;  3R03 A;  3GZ5 A;  3X0N A;  3ZR1 A;  5IW4 A;  1SJY A;  1V8I A;  2ICJ A;  3O6Z A;  3X0M A;  1PUS A;  2O5W A;  2QJO A;  2RRK A;  5DD4 A;  1VRL A;  3P6Y A;  4C9W A;  4DYW A;  1NFS A;  3EXQ A;  3Q2S A;  4S2W A;  1K26 A;  1RYA A;  2A8Q A;  3L85 A;  1Q54 A;  2A8R A;  5GHP A;  1MQW A;  4V14 A;  1V8R A;  3I7V A;  5GHJ A;  5BON A;  3P5T A;  1TUM A;  3X0R A;  3G0Q A;  4JZU A;  1X83 A;  2O1C A;  4IJX A;  1PVF A;  4N1U A;  5GHI A;  2O5F A;  1G9Q A;  1HZT A;  5CFI A;  3X0J A;  2A8P A;  3Q4I A;  4S2X A;  5DDG A;  2A8S A;  2QKM B;  3FFU A;  5ANW A;  1MK1 A;  3Q91 A;  3F13 A;  2DSD A;  2I8T A;  3FSP A;  1XSA A;  2PQV A;  1Q33 A;  3X0S A;  1RRS A;  1V8V A;  4KYX A;  3WHW A;  5C7Q A;  4J7H A;  1GA7 A;  2B06 A;  5C7T A;  1F3Y A;  1VIQ A;  5FSL A;  5I8U A;  4J7G A;  1X84 A;  2J8Q A;  1SOI A;  1NQY A;  1XSB A;  3EES A;  2B0V A;  4ICK A;  3A6V A;  3A6S A;  4JZV A;  1Q27 A;  1V8S A;  3EF5 A;  5ISY A;  5GHN A;  1MQE A;  3BAP A;  4ZG0 A;  4YPR A;  3X0I A;  1PUQ A;  2ICK A;  2YVO A;  4JZS A;  1NFZ A;  1U20 A;  3DUP A;  3H95 A;  3I7U A;  4KG4 A;  5ANT A;  3O8S A;  5ANV A;  2PNY A;  4NFW A;  1PUN A;  3ACA A;  5CFJ A;  1PPX A;  3BHO A;  1R67 A;  5FSO A;  5LPG A;  1VCD A;  1VK6 A;  1HX3 A;  4S2Y A;  5DPK A;  1G0S A;  1VIU A;  3X0L A;  2I6K A;  1VHZ A;  1QVJ A;  2JVB A;  2GB5 A;  4MPO A;  3MGM A;  4S2V A;  3X0P A;  3O69 A;  5C8L A;  3O52 A;  2DHO A;  1JKN A;  5GHQ A;  3ID9 A;  5DEQ A;  3X0K A;  1PPW A;  3N77 A;  4N1T A;  2XSQ A;  3FCM A;  3E57 A;  3FJY A;  3A6U A;  2W4E A;  2GT4 A;  5FSK A;  3SHD A;  1XSC A;  2KDW A;  3CNG A;  1IRY A;  5GHM A;  2A6T A;  3AC9 A;  1V8M A;  1K2E A;  4NFX A;  1KHZ A;  3Q2T A;  2KDV A;  3KVH A;  1KT9 A;  1V8N A;  2CL3 A;  3QSJ A;  4C9X A;  3X0Q A;  2DSB A;  1JRK A;  2B2K A;  3GZ8 A;  3MCF A;  3Q1P A;  2I8U A;  5ANS A;  2CZR A;  3MDI A;  2DSC A;  2FKB A;  2Q9P A;  4HVY A;  5FSI A;  3MDG A;  2YVM A;  3OGA A;  4YPH A; 
#chains in the Genus database with same CATH homology
 4KG3 A;  1I9A A;  5FSM A;  1V8L A;  1VHG A;  2GT2 A;  1MUT A;  2VNP A;  2YVP A;  3COU A;  2FML A;  2G73 A;  3N9U A;  5BS6 A;  4YOQ A;  4KTB A;  2YVN A;  3DKU A;  5ANU A;  1NQZ A;  3Q93 A;  3U53 A;  1SU2 A;  1MR2 A;  3HYQ A;  1V8Y A;  1SZ3 A;  2QJT A;  3A6T A;  3EEU A;  2DUK A;  5FSN A;  5IW5 A;  3GG6 A;  3I9X A;  2A8T A;  4HFQ A;  3SMD A;  3GZ6 A;  3HHJ A;  3SON A;  1VC9 A;  1X51 A;  4JZT A;  3GRN A;  1MP2 A;  2G74 A;  1V8U A;  1V8W A;  1RRQ A;  2VNQ A;  3F6A A;  5GHO A;  2R5W A;  3ZR0 A;  3FK9 A;  1PPV A;  3J7Y e;  2YYH A;  3BM4 A;  5HZX A;  1V8T A;  3O61 A;  2AZW A;  3RH7 A;  2FVV A;  1KTG A;  3X0O A;  1VC8 A;  3GWY A;  4ILQ A;  4K6E A;  1OW2 A;  3R03 A;  3GZ5 A;  3X0N A;  3ZR1 A;  5IW4 A;  1SJY A;  1V8I A;  2ICJ A;  3O6Z A;  3X0M A;  1PUS A;  2O5W A;  2QJO A;  2RRK A;  5DD4 A;  1VRL A;  3P6Y A;  4C9W A;  4DYW A;  1NFS A;  3EXQ A;  3Q2S A;  4S2W A;  1K26 A;  1RYA A;  2A8Q A;  3L85 A;  1Q54 A;  2A8R A;  5GHP A;  1MQW A;  4V14 A;  1V8R A;  3I7V A;  5GHJ A;  5BON A;  3P5T A;  1TUM A;  3X0R A;  3G0Q A;  4JZU A;  1X83 A;  2O1C A;  4IJX A;  1PVF A;  4N1U A;  5GHI A;  2O5F A;  1G9Q A;  1HZT A;  5CFI A;  3X0J A;  2A8P A;  3Q4I A;  4S2X A;  5DDG A;  2A8S A;  2QKM B;  3FFU A;  5ANW A;  1MK1 A;  3Q91 A;  3F13 A;  2DSD A;  2I8T A;  3FSP A;  1XSA A;  2PQV A;  1Q33 A;  3X0S A;  1RRS A;  1V8V A;  4KYX A;  3WHW A;  5C7Q A;  4J7H A;  1GA7 A;  2B06 A;  5C7T A;  1F3Y A;  1VIQ A;  5FSL A;  5I8U A;  4J7G A;  1X84 A;  2J8Q A;  1SOI A;  1NQY A;  1XSB A;  3EES A;  2B0V A;  4ICK A;  3A6V A;  3A6S A;  4JZV A;  1Q27 A;  1V8S A;  3EF5 A;  5ISY A;  5GHN A;  1MQE A;  3BAP A;  4ZG0 A;  4YPR A;  3X0I A;  1PUQ A;  2ICK A;  2YVO A;  4JZS A;  1NFZ A;  1U20 A;  3DUP A;  3H95 A;  3I7U A;  4KG4 A;  5ANT A;  3O8S A;  5ANV A;  2PNY A;  4NFW A;  1PUN A;  3ACA A;  5CFJ A;  1PPX A;  3BHO A;  1R67 A;  5FSO A;  5LPG A;  1VCD A;  1VK6 A;  1HX3 A;  4S2Y A;  5DPK A;  1G0S A;  1VIU A;  3X0L A;  2I6K A;  1VHZ A;  1QVJ A;  2JVB A;  2GB5 A;  4MPO A;  3MGM A;  4S2V A;  3X0P A;  3O69 A;  5C8L A;  3O52 A;  2DHO A;  1JKN A;  5GHQ A;  3ID9 A;  5DEQ A;  3X0K A;  1PPW A;  3N77 A;  4N1T A;  2XSQ A;  3FCM A;  3E57 A;  3FJY A;  3A6U A;  2W4E A;  2GT4 A;  5FSK A;  3SHD A;  1XSC A;  2KDW A;  3CNG A;  1IRY A;  5GHM A;  2A6T A;  3AC9 A;  1V8M A;  1K2E A;  4NFX A;  1KHZ A;  3Q2T A;  2KDV A;  3KVH A;  1KT9 A;  1V8N A;  2CL3 A;  3QSJ A;  4C9X A;  3X0Q A;  2DSB A;  1JRK A;  2B2K A;  3GZ8 A;  3MCF A;  3Q1P A;  2I8U A;  5ANS A;  2CZR A;  3MDI A;  2DSC A;  2FKB A;  2Q9P A;  4HVY A;  5FSI A;  3MDG A;  2YVM A;  3OGA A;  4YPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...