3GWYA

Crystal structure of putative ctp pyrophosphohydrolase from bacteroides fragilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
130
structure length
121
Chain Sequence
SLKSIEVVAAVIRLGEKYLCVQRFRYEFPGGKVEEGESLQEALQREIMEEMDYVIEVGEKLLTVHHTYPDFEITMHAFLCHPVGQRYVLKEHIAAQWLSTREMAILDWAEADKPIVRKISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative CTP pyrophosphohydrolase
publication title Crystal Structure of Ctp Pyrophosphohydrolase from Bacteroides fragilis
rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
total genus 31
structure length 121
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gwyA00
1RYAA 3N9UA 2A8PA 1HZTA 2W4EA 2DSDA 3EEUA 2DSCA 3X0JA 3O61A 5ANVA 3SONA 4DYWA 5IW4A 4C9WA 3I9XA 1VC8A 3AC9A 3U53A 3DKUA 4HVYA 3ACAA 3GZ6A 4JZUA 2A8RA 1JRKA 1X84A 1PPVA 1GA7A 3HYQA 3Q2SA 3Q91A 5ANUA 3X0NA 1G0SA 3X0QA 1MQEA 5FSMA 1X51A 5C7TA 3DUPA 3N77A 5GHPA 4JZVA 1MR2A 2RRKA 3MGMA 2QKMB 4S2YA 3GZ5A 1V8SA 1XSAA 2YVMA 1MP2A 3ZR0A 5GHNA 3MCFA 3FK9A 4JZTA 4NFWA 1PPXA 3J7Ye 2DSBA 4MPOA 5GHJA 3FSPA 3X0KA 1PUSA 4S2WA 3CNGA 2A6TA 2G74A 1XSBA 3P5TA 1RRQA 3SMDA 1TUMA 5IW5A 3BHOA 5ANTA 1K26A 2O5FA 3H95A 3SHDA 5HZXA 2ICJA 2JVBA 4JZSA 3MDGA 3EESA 1V8WA 1KT9A 1V8YA 3X0SA 2GT4A 3FFUA 1Q54A 1MQWA 4N1TA 3GRNA 3I7VA 1KHZA 1MK1A 2CL3A 2ICKA 3X0LA 2B06A 4KG4A 4YPRA 1V8LA 4ILQA 4KG3A 4KTBA 3O8SA 1V8UA 2KDWA 1Q27A 5DEQA 2QJTA 3MDIA 5GHMA 1PVFA 3L85A 2VNQA 2KDVA 3QSJA 2R5WA 2YVPA 2A8SA 1VHZA 3BAPA 5C8LA 1VIUA 2FKBA 2O1CA 1K2EA 2I8TA 3EXQA 4YOQA 1PUQA 1R67A 1PPWA 1V8RA 2GB5A 5FSIA 2PQVA 5BONA 3Q1PA 5DD4A 2PNYA 1MUTA 1VK6A 3F13A 3P6YA 1I9AA 3A6SA 1V8IA 2O5WA 3Q93A 2A8QA 2I8UA 2XSQA 4IJXA 1U20A 5ANWA 4ZG0A 3A6VA 2B2KA 2YYHA 5C7QA 4HFQA 1SJYA 5FSNA 1RRSA 2YVOA 2B0VA 1NFZA 3F6AA 4C9XA 5CFJA 3Q2TA 3X0OA 1V8TA 5I8UA 2FMLA 5ISYA 3A6UA 3FCMA 1VIQA 3R03A 5DDGA 3Q4IA 5DPKA 1IRYA 1SU2A 1VCDA 4NFXA 1JKNA 1VRLA 2DHOA 1VC9A 2I6KA 4ICKA 2G73A 1NFSA 2DUKA 2VNPA 4KYXA 1NQYA 3O6ZA 2Q9PA 4V14A 3BM4A 1V8MA 1KTGA 1V8NA 2GT2A 3X0RA 4N1UA 3E57A 5GHOA 3FJYA 3I7UA 3O69A 1G9QA 1V8VA 5FSOA 2YVNA 3ID9A 5CFIA 3X0MA 1PUNA 3GWYA 1F3YA 3OGAA 1VHGA 1X83A 3COUA 3A6TA 5LPGA 4K6EA 1QVJA 3GG6A 2AZWA 5FSLA 3X0PA 3G0QA 3RH7A 2QJOA 1HX3A 5FSKA 3HHJA 1OW2A 1NQZA 1Q33A 2FVVA 5GHQA 3GZ8A 5GHIA 3O52A 3EF5A 1SOIA 5BS6A 4S2VA 2J8QA 3ZR1A 3X0IA 4S2XA 1SZ3A 2A8TA 4YPHA 1XSCA 3WHWA 5ANSA 3KVHA
chains in the Genus database with same CATH superfamily
1RYAA 3N9UA 2A8PA 1HZTA 2W4EA 2DSDA 3EEUA 2DSCA 3X0JA 3O61A 5ANVA 3SONA 4DYWA 5IW4A 4C9WA 3I9XA 1VC8A 3AC9A 3U53A 3DKUA 4HVYA 3ACAA 3GZ6A 4JZUA 2A8RA 1JRKA 1X84A 1PPVA 1GA7A 3HYQA 3Q2SA 3Q91A 5ANUA 3X0NA 1G0SA 3X0QA 1MQEA 5FSMA 1X51A 5C7TA 3DUPA 3N77A 5GHPA 4JZVA 1MR2A 2RRKA 3MGMA 2QKMB 4S2YA 3GZ5A 1V8SA 1XSAA 2YVMA 1MP2A 3ZR0A 5GHNA 3MCFA 3FK9A 4JZTA 4NFWA 1PPXA 3J7Ye 2DSBA 4MPOA 5GHJA 3FSPA 3X0KA 1PUSA 4S2WA 3CNGA 2A6TA 2G74A 1XSBA 3P5TA 4J7GA 1RRQA 3SMDA 1TUMA 2CZRA 5IW5A 3BHOA 5ANTA 1K26A 2O5FA 3H95A 3SHDA 5HZXA 2ICJA 2JVBA 4JZSA 3MDGA 3EESA 1V8WA 1KT9A 1V8YA 3X0SA 2GT4A 3FFUA 1Q54A 1MQWA 4N1TA 3GRNA 3I7VA 1KHZA 1MK1A 2CL3A 2ICKA 3X0LA 2B06A 4KG4A 4YPRA 1V8LA 4ILQA 4J7HA 4KG3A 4KTBA 3O8SA 1V8UA 2KDWA 1Q27A 5DEQA 2QJTA 3MDIA 5GHMA 1PVFA 3L85A 2VNQA 2KDVA 3QSJA 2R5WA 2YVPA 2A8SA 1VHZA 3BAPA 5C8LA 1VIUA 2FKBA 2O1CA 1K2EA 2I8TA 3EXQA 4YOQA 1PUQA 1R67A 1PPWA 1V8RA 2GB5A 5FSIA 2PQVA 5BONA 3Q1PA 5DD4A 2PNYA 1MUTA 1VK6A 3F13A 3P6YA 1I9AA 3A6SA 1V8IA 2O5WA 3Q93A 2A8QA 2I8UA 2XSQA 4IJXA 1U20A 5ANWA 4ZG0A 3A6VA 2B2KA 2YYHA 5C7QA 4HFQA 1SJYA 5FSNA 1RRSA 2YVOA 2B0VA 1NFZA 3F6AA 4C9XA 5CFJA 3Q2TA 3X0OA 1V8TA 5I8UA 2FMLA 5ISYA 3A6UA 3FCMA 1VIQA 3R03A 5DDGA 3Q4IA 5DPKA 1IRYA 1SU2A 1VCDA 4NFXA 1JKNA 1VRLA 2DHOA 1VC9A 2I6KA 4ICKA 2G73A 1NFSA 2DUKA 2VNPA 4KYXA 1NQYA 3O6ZA 2Q9PA 4V14A 3BM4A 1V8MA 1KTGA 1V8NA 2GT2A 3X0RA 4N1UA 3E57A 5GHOA 3FJYA 3I7UA 3O69A 1G9QA 1V8VA 5FSOA 2YVNA 3ID9A 5CFIA 3X0MA 1PUNA 3GWYA 1F3YA 3OGAA 1VHGA 1X83A 3COUA 3A6TA 5LPGA 4K6EA 1QVJA 3GG6A 2AZWA 5FSLA 3X0PA 3G0QA 3RH7A 2QJOA 1HX3A 5FSKA 3HHJA 1OW2A 1NQZA 1Q33A 2FVVA 5GHQA 3GZ8A 5GHIA 3O52A 3EF5A 1SOIA 5BS6A 4S2VA 2J8QA 3ZR1A 3X0IA 4S2XA 1SZ3A 2A8TA 4YPHA 1XSCA 3WHWA 5ANSA 3KVHA
chains in the Genus database with same CATH topology
1RYAA 3N9UA 2A8PA 1HZTA 2W4EA 2DSDA 3EEUA 2DSCA 3X0JA 3O61A 5ANVA 3SONA 4DYWA 5IW4A 4C9WA 3I9XA 1VC8A 3AC9A 3U53A 3DKUA 4HVYA 3ACAA 3GZ6A 4JZUA 2A8RA 1JRKA 1X84A 1PPVA 1GA7A 3HYQA 3Q2SA 3Q91A 5ANUA 3X0NA 1G0SA 3X0QA 1MQEA 5FSMA 1X51A 5C7TA 3DUPA 3N77A 5GHPA 4JZVA 1MR2A 2RRKA 3MGMA 2QKMB 4S2YA 3GZ5A 1V8SA 1XSAA 2YVMA 1MP2A 3ZR0A 5GHNA 3MCFA 3FK9A 4JZTA 4NFWA 1PPXA 3J7Ye 2DSBA 4MPOA 5GHJA 3FSPA 3X0KA 1PUSA 4S2WA 3CNGA 2A6TA 2G74A 1XSBA 3P5TA 4J7GA 1RRQA 3SMDA 1TUMA 2CZRA 5IW5A 3BHOA 5ANTA 1K26A 2O5FA 3H95A 3SHDA 5HZXA 2ICJA 2JVBA 4JZSA 3MDGA 3EESA 1V8WA 1KT9A 1V8YA 3X0SA 2GT4A 3FFUA 1Q54A 1MQWA 4N1TA 3GRNA 3I7VA 1KHZA 1MK1A 2CL3A 2ICKA 3X0LA 2B06A 4KG4A 4YPRA 1V8LA 4ILQA 4J7HA 4KG3A 4KTBA 3O8SA 1V8UA 2KDWA 1Q27A 5DEQA 2QJTA 3MDIA 5GHMA 1PVFA 3L85A 2VNQA 2KDVA 3QSJA 2R5WA 2YVPA 2A8SA 1VHZA 3BAPA 5C8LA 1VIUA 2FKBA 2O1CA 1K2EA 2I8TA 3EXQA 4YOQA 1PUQA 1R67A 1PPWA 1V8RA 2GB5A 5FSIA 2PQVA 5BONA 3Q1PA 5DD4A 2PNYA 1MUTA 1VK6A 3F13A 3P6YA 1I9AA 3A6SA 1V8IA 2O5WA 3Q93A 2A8QA 2I8UA 2XSQA 4IJXA 1U20A 5ANWA 4ZG0A 3A6VA 2B2KA 2YYHA 5C7QA 4HFQA 1SJYA 5FSNA 1RRSA 2YVOA 2B0VA 1NFZA 3F6AA 4C9XA 5CFJA 3Q2TA 3X0OA 1V8TA 5I8UA 2FMLA 5ISYA 3A6UA 3FCMA 1VIQA 3R03A 5DDGA 3Q4IA 5DPKA 1IRYA 1SU2A 1VCDA 4NFXA 1JKNA 1VRLA 2DHOA 1VC9A 2I6KA 4ICKA 2G73A 1NFSA 2DUKA 2VNPA 4KYXA 1NQYA 3O6ZA 2Q9PA 4V14A 3BM4A 1V8MA 1KTGA 1V8NA 2GT2A 3X0RA 4N1UA 3E57A 5GHOA 3FJYA 3I7UA 3O69A 1G9QA 1V8VA 5FSOA 2YVNA 3ID9A 5CFIA 3X0MA 1PUNA 3GWYA 1F3YA 3OGAA 1VHGA 1X83A 3COUA 3A6TA 5LPGA 4K6EA 1QVJA 3GG6A 2AZWA 5FSLA 3X0PA 3G0QA 3RH7A 2QJOA 1HX3A 5FSKA 3HHJA 1OW2A 1NQZA 1Q33A 2FVVA 5GHQA 3GZ8A 5GHIA 3O52A 3EF5A 1SOIA 5BS6A 4S2VA 2J8QA 3ZR1A 3X0IA 4S2XA 1SZ3A 2A8TA 4YPHA 1XSCA 3WHWA 5ANSA 3KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYA A;  3N9U A;  2A8P A;  1HZT A;  2W4E A;  2DSD A;  3EEU A;  2DSC A;  3X0J A;  3O61 A;  5ANV A;  3SON A;  4DYW A;  5IW4 A;  4C9W A;  3I9X A;  1VC8 A;  3AC9 A;  3U53 A;  3DKU A;  4HVY A;  3ACA A;  3GZ6 A;  4JZU A;  2A8R A;  1JRK A;  1X84 A;  1PPV A;  1GA7 A;  3HYQ A;  3Q2S A;  3Q91 A;  5ANU A;  3X0N A;  1G0S A;  3X0Q A;  1MQE A;  5FSM A;  1X51 A;  5C7T A;  3DUP A;  3N77 A;  5GHP A;  4JZV A;  1MR2 A;  2RRK A;  3MGM A;  2QKM B;  4S2Y A;  3GZ5 A;  1V8S A;  1XSA A;  2YVM A;  1MP2 A;  3ZR0 A;  5GHN A;  3MCF A;  3FK9 A;  4JZT A;  4NFW A;  1PPX A;  3J7Y e;  2DSB A;  4MPO A;  5GHJ A;  3FSP A;  3X0K A;  1PUS A;  4S2W A;  3CNG A;  2A6T A;  2G74 A;  1XSB A;  3P5T A;  1RRQ A;  3SMD A;  1TUM A;  5IW5 A;  3BHO A;  5ANT A;  1K26 A;  2O5F A;  3H95 A;  3SHD A;  5HZX A;  2ICJ A;  2JVB A;  4JZS A;  3MDG A;  3EES A;  1V8W A;  1KT9 A;  1V8Y A;  3X0S A;  2GT4 A;  3FFU A;  1Q54 A;  1MQW A;  4N1T A;  3GRN A;  3I7V A;  1KHZ A;  1MK1 A;  2CL3 A;  2ICK A;  3X0L A;  2B06 A;  4KG4 A;  4YPR A;  1V8L A;  4ILQ A;  4KG3 A;  4KTB A;  3O8S A;  1V8U A;  2KDW A;  1Q27 A;  5DEQ A;  2QJT A;  3MDI A;  5GHM A;  1PVF A;  3L85 A;  2VNQ A;  2KDV A;  3QSJ A;  2R5W A;  2YVP A;  2A8S A;  1VHZ A;  3BAP A;  5C8L A;  1VIU A;  2FKB A;  2O1C A;  1K2E A;  2I8T A;  3EXQ A;  4YOQ A;  1PUQ A;  1R67 A;  1PPW A;  1V8R A;  2GB5 A;  5FSI A;  2PQV A;  5BON A;  3Q1P A;  5DD4 A;  2PNY A;  1MUT A;  1VK6 A;  3F13 A;  3P6Y A;  1I9A A;  3A6S A;  1V8I A;  2O5W A;  3Q93 A;  2A8Q A;  2I8U A;  2XSQ A;  4IJX A;  1U20 A;  5ANW A;  4ZG0 A;  3A6V A;  2B2K A;  2YYH A;  5C7Q A;  4HFQ A;  1SJY A;  5FSN A;  1RRS A;  2YVO A;  2B0V A;  1NFZ A;  3F6A A;  4C9X A;  5CFJ A;  3Q2T A;  3X0O A;  1V8T A;  5I8U A;  2FML A;  5ISY A;  3A6U A;  3FCM A;  1VIQ A;  3R03 A;  5DDG A;  3Q4I A;  5DPK A;  1IRY A;  1SU2 A;  1VCD A;  4NFX A;  1JKN A;  1VRL A;  2DHO A;  1VC9 A;  2I6K A;  4ICK A;  2G73 A;  1NFS A;  2DUK A;  2VNP A;  4KYX A;  1NQY A;  3O6Z A;  2Q9P A;  4V14 A;  3BM4 A;  1V8M A;  1KTG A;  1V8N A;  2GT2 A;  3X0R A;  4N1U A;  3E57 A;  5GHO A;  3FJY A;  3I7U A;  3O69 A;  1G9Q A;  1V8V A;  5FSO A;  2YVN A;  3ID9 A;  5CFI A;  3X0M A;  1PUN A;  3GWY A;  1F3Y A;  3OGA A;  1VHG A;  1X83 A;  3COU A;  3A6T A;  5LPG A;  4K6E A;  1QVJ A;  3GG6 A;  2AZW A;  5FSL A;  3X0P A;  3G0Q A;  3RH7 A;  2QJO A;  1HX3 A;  5FSK A;  3HHJ A;  1OW2 A;  1NQZ A;  1Q33 A;  2FVV A;  5GHQ A;  3GZ8 A;  5GHI A;  3O52 A;  3EF5 A;  1SOI A;  5BS6 A;  4S2V A;  2J8Q A;  3ZR1 A;  3X0I A;  4S2X A;  1SZ3 A;  2A8T A;  4YPH A;  1XSC A;  3WHW A;  5ANS A;  3KVH A; 
#chains in the Genus database with same CATH topology
 1RYA A;  3N9U A;  2A8P A;  1HZT A;  2W4E A;  2DSD A;  3EEU A;  2DSC A;  3X0J A;  3O61 A;  5ANV A;  3SON A;  4DYW A;  5IW4 A;  4C9W A;  3I9X A;  1VC8 A;  3AC9 A;  3U53 A;  3DKU A;  4HVY A;  3ACA A;  3GZ6 A;  4JZU A;  2A8R A;  1JRK A;  1X84 A;  1PPV A;  1GA7 A;  3HYQ A;  3Q2S A;  3Q91 A;  5ANU A;  3X0N A;  1G0S A;  3X0Q A;  1MQE A;  5FSM A;  1X51 A;  5C7T A;  3DUP A;  3N77 A;  5GHP A;  4JZV A;  1MR2 A;  2RRK A;  3MGM A;  2QKM B;  4S2Y A;  3GZ5 A;  1V8S A;  1XSA A;  2YVM A;  1MP2 A;  3ZR0 A;  5GHN A;  3MCF A;  3FK9 A;  4JZT A;  4NFW A;  1PPX A;  3J7Y e;  2DSB A;  4MPO A;  5GHJ A;  3FSP A;  3X0K A;  1PUS A;  4S2W A;  3CNG A;  2A6T A;  2G74 A;  1XSB A;  3P5T A;  4J7G A;  1RRQ A;  3SMD A;  1TUM A;  2CZR A;  5IW5 A;  3BHO A;  5ANT A;  1K26 A;  2O5F A;  3H95 A;  3SHD A;  5HZX A;  2ICJ A;  2JVB A;  4JZS A;  3MDG A;  3EES A;  1V8W A;  1KT9 A;  1V8Y A;  3X0S A;  2GT4 A;  3FFU A;  1Q54 A;  1MQW A;  4N1T A;  3GRN A;  3I7V A;  1KHZ A;  1MK1 A;  2CL3 A;  2ICK A;  3X0L A;  2B06 A;  4KG4 A;  4YPR A;  1V8L A;  4ILQ A;  4J7H A;  4KG3 A;  4KTB A;  3O8S A;  1V8U A;  2KDW A;  1Q27 A;  5DEQ A;  2QJT A;  3MDI A;  5GHM A;  1PVF A;  3L85 A;  2VNQ A;  2KDV A;  3QSJ A;  2R5W A;  2YVP A;  2A8S A;  1VHZ A;  3BAP A;  5C8L A;  1VIU A;  2FKB A;  2O1C A;  1K2E A;  2I8T A;  3EXQ A;  4YOQ A;  1PUQ A;  1R67 A;  1PPW A;  1V8R A;  2GB5 A;  5FSI A;  2PQV A;  5BON A;  3Q1P A;  5DD4 A;  2PNY A;  1MUT A;  1VK6 A;  3F13 A;  3P6Y A;  1I9A A;  3A6S A;  1V8I A;  2O5W A;  3Q93 A;  2A8Q A;  2I8U A;  2XSQ A;  4IJX A;  1U20 A;  5ANW A;  4ZG0 A;  3A6V A;  2B2K A;  2YYH A;  5C7Q A;  4HFQ A;  1SJY A;  5FSN A;  1RRS A;  2YVO A;  2B0V A;  1NFZ A;  3F6A A;  4C9X A;  5CFJ A;  3Q2T A;  3X0O A;  1V8T A;  5I8U A;  2FML A;  5ISY A;  3A6U A;  3FCM A;  1VIQ A;  3R03 A;  5DDG A;  3Q4I A;  5DPK A;  1IRY A;  1SU2 A;  1VCD A;  4NFX A;  1JKN A;  1VRL A;  2DHO A;  1VC9 A;  2I6K A;  4ICK A;  2G73 A;  1NFS A;  2DUK A;  2VNP A;  4KYX A;  1NQY A;  3O6Z A;  2Q9P A;  4V14 A;  3BM4 A;  1V8M A;  1KTG A;  1V8N A;  2GT2 A;  3X0R A;  4N1U A;  3E57 A;  5GHO A;  3FJY A;  3I7U A;  3O69 A;  1G9Q A;  1V8V A;  5FSO A;  2YVN A;  3ID9 A;  5CFI A;  3X0M A;  1PUN A;  3GWY A;  1F3Y A;  3OGA A;  1VHG A;  1X83 A;  3COU A;  3A6T A;  5LPG A;  4K6E A;  1QVJ A;  3GG6 A;  2AZW A;  5FSL A;  3X0P A;  3G0Q A;  3RH7 A;  2QJO A;  1HX3 A;  5FSK A;  3HHJ A;  1OW2 A;  1NQZ A;  1Q33 A;  2FVV A;  5GHQ A;  3GZ8 A;  5GHI A;  3O52 A;  3EF5 A;  1SOI A;  5BS6 A;  4S2V A;  2J8Q A;  3ZR1 A;  3X0I A;  4S2X A;  1SZ3 A;  2A8T A;  4YPH A;  1XSC A;  3WHW A;  5ANS A;  3KVH A; 
#chains in the Genus database with same CATH homology
 1RYA A;  3N9U A;  2A8P A;  1HZT A;  2W4E A;  2DSD A;  3EEU A;  2DSC A;  3X0J A;  3O61 A;  5ANV A;  3SON A;  4DYW A;  5IW4 A;  4C9W A;  3I9X A;  1VC8 A;  3AC9 A;  3U53 A;  3DKU A;  4HVY A;  3ACA A;  3GZ6 A;  4JZU A;  2A8R A;  1JRK A;  1X84 A;  1PPV A;  1GA7 A;  3HYQ A;  3Q2S A;  3Q91 A;  5ANU A;  3X0N A;  1G0S A;  3X0Q A;  1MQE A;  5FSM A;  1X51 A;  5C7T A;  3DUP A;  3N77 A;  5GHP A;  4JZV A;  1MR2 A;  2RRK A;  3MGM A;  2QKM B;  4S2Y A;  3GZ5 A;  1V8S A;  1XSA A;  2YVM A;  1MP2 A;  3ZR0 A;  5GHN A;  3MCF A;  3FK9 A;  4JZT A;  4NFW A;  1PPX A;  3J7Y e;  2DSB A;  4MPO A;  5GHJ A;  3FSP A;  3X0K A;  1PUS A;  4S2W A;  3CNG A;  2A6T A;  2G74 A;  1XSB A;  3P5T A;  4J7G A;  1RRQ A;  3SMD A;  1TUM A;  2CZR A;  5IW5 A;  3BHO A;  5ANT A;  1K26 A;  2O5F A;  3H95 A;  3SHD A;  5HZX A;  2ICJ A;  2JVB A;  4JZS A;  3MDG A;  3EES A;  1V8W A;  1KT9 A;  1V8Y A;  3X0S A;  2GT4 A;  3FFU A;  1Q54 A;  1MQW A;  4N1T A;  3GRN A;  3I7V A;  1KHZ A;  1MK1 A;  2CL3 A;  2ICK A;  3X0L A;  2B06 A;  4KG4 A;  4YPR A;  1V8L A;  4ILQ A;  4J7H A;  4KG3 A;  4KTB A;  3O8S A;  1V8U A;  2KDW A;  1Q27 A;  5DEQ A;  2QJT A;  3MDI A;  5GHM A;  1PVF A;  3L85 A;  2VNQ A;  2KDV A;  3QSJ A;  2R5W A;  2YVP A;  2A8S A;  1VHZ A;  3BAP A;  5C8L A;  1VIU A;  2FKB A;  2O1C A;  1K2E A;  2I8T A;  3EXQ A;  4YOQ A;  1PUQ A;  1R67 A;  1PPW A;  1V8R A;  2GB5 A;  5FSI A;  2PQV A;  5BON A;  3Q1P A;  5DD4 A;  2PNY A;  1MUT A;  1VK6 A;  3F13 A;  3P6Y A;  1I9A A;  3A6S A;  1V8I A;  2O5W A;  3Q93 A;  2A8Q A;  2I8U A;  2XSQ A;  4IJX A;  1U20 A;  5ANW A;  4ZG0 A;  3A6V A;  2B2K A;  2YYH A;  5C7Q A;  4HFQ A;  1SJY A;  5FSN A;  1RRS A;  2YVO A;  2B0V A;  1NFZ A;  3F6A A;  4C9X A;  5CFJ A;  3Q2T A;  3X0O A;  1V8T A;  5I8U A;  2FML A;  5ISY A;  3A6U A;  3FCM A;  1VIQ A;  3R03 A;  5DDG A;  3Q4I A;  5DPK A;  1IRY A;  1SU2 A;  1VCD A;  4NFX A;  1JKN A;  1VRL A;  2DHO A;  1VC9 A;  2I6K A;  4ICK A;  2G73 A;  1NFS A;  2DUK A;  2VNP A;  4KYX A;  1NQY A;  3O6Z A;  2Q9P A;  4V14 A;  3BM4 A;  1V8M A;  1KTG A;  1V8N A;  2GT2 A;  3X0R A;  4N1U A;  3E57 A;  5GHO A;  3FJY A;  3I7U A;  3O69 A;  1G9Q A;  1V8V A;  5FSO A;  2YVN A;  3ID9 A;  5CFI A;  3X0M A;  1PUN A;  3GWY A;  1F3Y A;  3OGA A;  1VHG A;  1X83 A;  3COU A;  3A6T A;  5LPG A;  4K6E A;  1QVJ A;  3GG6 A;  2AZW A;  5FSL A;  3X0P A;  3G0Q A;  3RH7 A;  2QJO A;  1HX3 A;  5FSK A;  3HHJ A;  1OW2 A;  1NQZ A;  1Q33 A;  2FVV A;  5GHQ A;  3GZ8 A;  5GHI A;  3O52 A;  3EF5 A;  1SOI A;  5BS6 A;  4S2V A;  2J8Q A;  3ZR1 A;  3X0I A;  4S2X A;  1SZ3 A;  2A8T A;  4YPH A;  1XSC A;  3WHW A;  5ANS A;  3KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...