2FVVA

Human diphosphoinositol polyphosphate phosphohydrolase 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
QTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 1
publication title Crystal structure of human diphosphoinositol phosphatase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.6.1.52: Diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2fvvA00
3OGAA 5C8LA 1K2EA 2JVBA 3X0LA 3ZR0A 4NFXA 1RRQA 3J7Ye 1MP2A 3QSJA 3X0RA 2Q9PA 2ICJA 1KT9A 2AZWA 2DSDA 3X0KA 1Q27A 1V8LA 1V8IA 1OW2A 4ILQA 5FSKA 3GZ5A 2KDVA 3RH7A 1NQYA 1VIQA 3GZ8A 3SHDA 3X0PA 2DHOA 1V8WA 1HZTA 1X51A 2B2KA 3SMDA 2RRKA 3H95A 4KG4A 5GHMA 2I8UA 3EESA 3GG6A 1PUSA 1GA7A 1V8TA 5DEQA 1NFSA 1Q54A 1TUMA 3FK9A 1V8VA 1V8SA 4YPRA 2DSCA 4HFQA 4ICKA 2GB5A 3EXQA 5DD4A 3GZ6A 1IRYA 2YVMA 4NFWA 2GT2A 2A6TA 3DUPA 1V8RA 2A8PA 2QJTA 5I8UA 4S2VA 3KVHA 5HZXA 5FSIA 2VNPA 1SJYA 1MR2A 1NFZA 2PQVA 3A6VA 3HHJA 1SZ3A 3L85A 3FCMA 3BHOA 5FSOA 5GHQA 3MDGA 2GT4A 2FKBA 3Q4IA 1SOIA 1PVFA 4IJXA 5FSLA 4MPOA 1PPWA 2FVVA 1JRKA 4JZSA 3F13A 3X0JA 4JZTA 2YVNA 1VHGA 4S2XA 5IW4A 1RRSA 3GRNA 3A6UA 1MK1A 1XSBA 1MUTA 3ZR1A 1X84A 5ANUA 4DYWA 1G0SA 4V14A 3U53A 3ID9A 4HVYA 2ICKA 4C9WA 1I9AA 5FSNA 5DDGA 4N1TA 5ANWA 3DKUA 1QVJA 3O69A 1X83A 3MCFA 2O5WA 3O52A 2G74A 5LPGA 4JZUA 5C7QA 4S2WA 4S2YA 5DPKA 3P6YA 1PUNA 5C7TA 2CL3A 2G73A 2PNYA 3I9XA 2A8SA 3EEUA 1MQEA 2J8QA 2I8TA 2W4EA 4YPHA 3AC9A 3O6ZA 1V8NA 2DSBA 2R5WA 1RYAA 3HYQA 3X0SA 4N1UA 3Q2TA 2FMLA 1KTGA 1JKNA 1U20A 2XSQA 1V8UA 5ANVA 5CFJA 5GHOA 3MDIA 1XSAA 2YVOA 5GHIA 4JZVA 5IW5A 1VRLA 4K6EA 3X0NA 4ZG0A 2B06A 1F3YA 3GWYA 4KYXA 3E57A 1KHZA 2QJOA 3Q1PA 1R67A 3I7UA 1PPXA 3X0MA 5BS6A 3FSPA 2VNQA 2YVPA 1K26A 3COUA 1G9QA 3A6SA 1Q33A 3ACAA 3Q93A 1VC9A 4KTBA 2A8RA 4C9XA 3P5TA 1VIUA 5GHNA 3FFUA 1SU2A 5GHPA 3F6AA 3FJYA 3O8SA 1V8MA 3WHWA 5ANTA 1NQZA 3EF5A 3Q2SA 1PUQA 3Q91A 2I6KA 3R03A 4KG3A 3BAPA 1VC8A 2A8TA 1XSCA 3N9UA 1PPVA 3SONA 1MQWA 3A6TA 2DUKA 2O1CA 3MGMA 4YOQA 3CNGA 1VK6A 3I7VA 2YYHA 5FSMA 3X0OA 3G0QA 3O61A 2KDWA 5ISYA 5ANSA 3X0IA 3N77A 2O5FA 5BONA 1VCDA 3X0QA 1VHZA 3BM4A 5GHJA 2A8QA 2B0VA 5CFIA 2QKMB 1V8YA 1HX3A
chains in the Genus database with same CATH superfamily
3OGAA 4J7HA 5C8LA 1K2EA 2JVBA 3X0LA 3ZR0A 4NFXA 1RRQA 3J7Ye 1MP2A 3QSJA 3X0RA 2Q9PA 2ICJA 1KT9A 2AZWA 2DSDA 3X0KA 1Q27A 1V8LA 1V8IA 4J7GA 1OW2A 4ILQA 5FSKA 3GZ5A 2KDVA 3RH7A 1NQYA 1VIQA 3GZ8A 3SHDA 3X0PA 2DHOA 1V8WA 1HZTA 1X51A 2B2KA 3SMDA 2RRKA 3H95A 4KG4A 5GHMA 2I8UA 3EESA 3GG6A 1PUSA 1GA7A 1V8TA 5DEQA 1NFSA 1Q54A 1TUMA 3FK9A 1V8VA 1V8SA 4YPRA 2DSCA 4HFQA 4ICKA 2GB5A 3EXQA 5DD4A 3GZ6A 1IRYA 2YVMA 4NFWA 2GT2A 2A6TA 3DUPA 1V8RA 2A8PA 2QJTA 5I8UA 4S2VA 3KVHA 5HZXA 5FSIA 2VNPA 1SJYA 1MR2A 1NFZA 2PQVA 3A6VA 3HHJA 1SZ3A 3L85A 3FCMA 3BHOA 5FSOA 5GHQA 3MDGA 2GT4A 2FKBA 3Q4IA 1SOIA 1PVFA 4IJXA 5FSLA 4MPOA 1PPWA 2FVVA 1JRKA 4JZSA 3F13A 3X0JA 4JZTA 2YVNA 1VHGA 4S2XA 5IW4A 1RRSA 3GRNA 3A6UA 1MK1A 1XSBA 1MUTA 3ZR1A 1X84A 5ANUA 4DYWA 1G0SA 4V14A 3U53A 3ID9A 4HVYA 2ICKA 4C9WA 1I9AA 5FSNA 5DDGA 4N1TA 5ANWA 3DKUA 1QVJA 3O69A 1X83A 3MCFA 2O5WA 3O52A 2G74A 5LPGA 4JZUA 5C7QA 4S2WA 4S2YA 5DPKA 3P6YA 1PUNA 5C7TA 2CL3A 2G73A 2PNYA 3I9XA 2A8SA 3EEUA 1MQEA 2J8QA 2I8TA 2W4EA 4YPHA 3AC9A 3O6ZA 1V8NA 2DSBA 2R5WA 1RYAA 3HYQA 3X0SA 4N1UA 3Q2TA 2FMLA 1KTGA 1JKNA 1U20A 2XSQA 1V8UA 5ANVA 5CFJA 5GHOA 3MDIA 1XSAA 2YVOA 5GHIA 4JZVA 5IW5A 1VRLA 4K6EA 3X0NA 4ZG0A 2B06A 1F3YA 3GWYA 4KYXA 3E57A 1KHZA 2QJOA 3Q1PA 1R67A 3I7UA 1PPXA 3X0MA 5BS6A 3FSPA 2VNQA 2YVPA 1K26A 3COUA 1G9QA 3A6SA 1Q33A 3ACAA 3Q93A 1VC9A 4KTBA 2A8RA 4C9XA 3P5TA 1VIUA 5GHNA 3FFUA 1SU2A 5GHPA 3F6AA 3FJYA 3O8SA 1V8MA 3WHWA 5ANTA 1NQZA 3EF5A 3Q2SA 1PUQA 3Q91A 2I6KA 3R03A 4KG3A 3BAPA 1VC8A 2A8TA 1XSCA 3N9UA 1PPVA 3SONA 1MQWA 3A6TA 2DUKA 2O1CA 3MGMA 4YOQA 3CNGA 1VK6A 3I7VA 2CZRA 2YYHA 5FSMA 3X0OA 3G0QA 3O61A 2KDWA 5ISYA 5ANSA 3X0IA 3N77A 2O5FA 5BONA 1VCDA 3X0QA 1VHZA 3BM4A 5GHJA 2A8QA 2B0VA 5CFIA 2QKMB 1V8YA 1HX3A
chains in the Genus database with same CATH topology
3OGAA 4J7HA 5C8LA 1K2EA 2JVBA 3X0LA 3ZR0A 4NFXA 1RRQA 3J7Ye 1MP2A 3QSJA 3X0RA 2Q9PA 2ICJA 1KT9A 2AZWA 2DSDA 3X0KA 1Q27A 1V8LA 1V8IA 4J7GA 1OW2A 4ILQA 5FSKA 3GZ5A 2KDVA 3RH7A 1NQYA 1VIQA 3GZ8A 3SHDA 3X0PA 2DHOA 1V8WA 1HZTA 1X51A 2B2KA 3SMDA 2RRKA 3H95A 4KG4A 5GHMA 2I8UA 3EESA 3GG6A 1PUSA 1GA7A 1V8TA 5DEQA 1NFSA 1Q54A 1TUMA 3FK9A 1V8VA 1V8SA 4YPRA 2DSCA 4HFQA 4ICKA 2GB5A 3EXQA 5DD4A 3GZ6A 1IRYA 2YVMA 4NFWA 2GT2A 2A6TA 3DUPA 1V8RA 2A8PA 2QJTA 5I8UA 4S2VA 3KVHA 5HZXA 5FSIA 2VNPA 1SJYA 1MR2A 1NFZA 2PQVA 3A6VA 3HHJA 1SZ3A 3L85A 3FCMA 3BHOA 5FSOA 5GHQA 3MDGA 2GT4A 2FKBA 3Q4IA 1SOIA 1PVFA 4IJXA 5FSLA 4MPOA 1PPWA 2FVVA 1JRKA 4JZSA 3F13A 3X0JA 4JZTA 2YVNA 1VHGA 4S2XA 5IW4A 1RRSA 3GRNA 3A6UA 1MK1A 1XSBA 1MUTA 3ZR1A 1X84A 5ANUA 4DYWA 1G0SA 4V14A 3U53A 3ID9A 4HVYA 2ICKA 4C9WA 1I9AA 5FSNA 5DDGA 4N1TA 5ANWA 3DKUA 1QVJA 3O69A 1X83A 3MCFA 2O5WA 3O52A 2G74A 5LPGA 4JZUA 5C7QA 4S2WA 4S2YA 5DPKA 3P6YA 1PUNA 5C7TA 2CL3A 2G73A 2PNYA 3I9XA 2A8SA 3EEUA 1MQEA 2J8QA 2I8TA 2W4EA 4YPHA 3AC9A 3O6ZA 1V8NA 2DSBA 2R5WA 1RYAA 3HYQA 3X0SA 4N1UA 3Q2TA 2FMLA 1KTGA 1JKNA 1U20A 2XSQA 1V8UA 5ANVA 5CFJA 5GHOA 3MDIA 1XSAA 2YVOA 5GHIA 4JZVA 5IW5A 1VRLA 4K6EA 3X0NA 4ZG0A 2B06A 1F3YA 3GWYA 4KYXA 3E57A 1KHZA 2QJOA 3Q1PA 1R67A 3I7UA 1PPXA 3X0MA 5BS6A 3FSPA 2VNQA 2YVPA 1K26A 3COUA 1G9QA 3A6SA 1Q33A 3ACAA 3Q93A 1VC9A 4KTBA 2A8RA 4C9XA 3P5TA 1VIUA 5GHNA 3FFUA 1SU2A 5GHPA 3F6AA 3FJYA 3O8SA 1V8MA 3WHWA 5ANTA 1NQZA 3EF5A 3Q2SA 1PUQA 3Q91A 2I6KA 3R03A 4KG3A 3BAPA 1VC8A 2A8TA 1XSCA 3N9UA 1PPVA 3SONA 1MQWA 3A6TA 2DUKA 2O1CA 3MGMA 4YOQA 3CNGA 1VK6A 3I7VA 2CZRA 2YYHA 5FSMA 3X0OA 3G0QA 3O61A 2KDWA 5ISYA 5ANSA 3X0IA 3N77A 2O5FA 5BONA 1VCDA 3X0QA 1VHZA 3BM4A 5GHJA 2A8QA 2B0VA 5CFIA 2QKMB 1V8YA 1HX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGA A;  5C8L A;  1K2E A;  2JVB A;  3X0L A;  3ZR0 A;  4NFX A;  1RRQ A;  3J7Y e;  1MP2 A;  3QSJ A;  3X0R A;  2Q9P A;  2ICJ A;  1KT9 A;  2AZW A;  2DSD A;  3X0K A;  1Q27 A;  1V8L A;  1V8I A;  1OW2 A;  4ILQ A;  5FSK A;  3GZ5 A;  2KDV A;  3RH7 A;  1NQY A;  1VIQ A;  3GZ8 A;  3SHD A;  3X0P A;  2DHO A;  1V8W A;  1HZT A;  1X51 A;  2B2K A;  3SMD A;  2RRK A;  3H95 A;  4KG4 A;  5GHM A;  2I8U A;  3EES A;  3GG6 A;  1PUS A;  1GA7 A;  1V8T A;  5DEQ A;  1NFS A;  1Q54 A;  1TUM A;  3FK9 A;  1V8V A;  1V8S A;  4YPR A;  2DSC A;  4HFQ A;  4ICK A;  2GB5 A;  3EXQ A;  5DD4 A;  3GZ6 A;  1IRY A;  2YVM A;  4NFW A;  2GT2 A;  2A6T A;  3DUP A;  1V8R A;  2A8P A;  2QJT A;  5I8U A;  4S2V A;  3KVH A;  5HZX A;  5FSI A;  2VNP A;  1SJY A;  1MR2 A;  1NFZ A;  2PQV A;  3A6V A;  3HHJ A;  1SZ3 A;  3L85 A;  3FCM A;  3BHO A;  5FSO A;  5GHQ A;  3MDG A;  2GT4 A;  2FKB A;  3Q4I A;  1SOI A;  1PVF A;  4IJX A;  5FSL A;  4MPO A;  1PPW A;  2FVV A;  1JRK A;  4JZS A;  3F13 A;  3X0J A;  4JZT A;  2YVN A;  1VHG A;  4S2X A;  5IW4 A;  1RRS A;  3GRN A;  3A6U A;  1MK1 A;  1XSB A;  1MUT A;  3ZR1 A;  1X84 A;  5ANU A;  4DYW A;  1G0S A;  4V14 A;  3U53 A;  3ID9 A;  4HVY A;  2ICK A;  4C9W A;  1I9A A;  5FSN A;  5DDG A;  4N1T A;  5ANW A;  3DKU A;  1QVJ A;  3O69 A;  1X83 A;  3MCF A;  2O5W A;  3O52 A;  2G74 A;  5LPG A;  4JZU A;  5C7Q A;  4S2W A;  4S2Y A;  5DPK A;  3P6Y A;  1PUN A;  5C7T A;  2CL3 A;  2G73 A;  2PNY A;  3I9X A;  2A8S A;  3EEU A;  1MQE A;  2J8Q A;  2I8T A;  2W4E A;  4YPH A;  3AC9 A;  3O6Z A;  1V8N A;  2DSB A;  2R5W A;  1RYA A;  3HYQ A;  3X0S A;  4N1U A;  3Q2T A;  2FML A;  1KTG A;  1JKN A;  1U20 A;  2XSQ A;  1V8U A;  5ANV A;  5CFJ A;  5GHO A;  3MDI A;  1XSA A;  2YVO A;  5GHI A;  4JZV A;  5IW5 A;  1VRL A;  4K6E A;  3X0N A;  4ZG0 A;  2B06 A;  1F3Y A;  3GWY A;  4KYX A;  3E57 A;  1KHZ A;  2QJO A;  3Q1P A;  1R67 A;  3I7U A;  1PPX A;  3X0M A;  5BS6 A;  3FSP A;  2VNQ A;  2YVP A;  1K26 A;  3COU A;  1G9Q A;  3A6S A;  1Q33 A;  3ACA A;  3Q93 A;  1VC9 A;  4KTB A;  2A8R A;  4C9X A;  3P5T A;  1VIU A;  5GHN A;  3FFU A;  1SU2 A;  5GHP A;  3F6A A;  3FJY A;  3O8S A;  1V8M A;  3WHW A;  5ANT A;  1NQZ A;  3EF5 A;  3Q2S A;  1PUQ A;  3Q91 A;  2I6K A;  3R03 A;  4KG3 A;  3BAP A;  1VC8 A;  2A8T A;  1XSC A;  3N9U A;  1PPV A;  3SON A;  1MQW A;  3A6T A;  2DUK A;  2O1C A;  3MGM A;  4YOQ A;  3CNG A;  1VK6 A;  3I7V A;  2YYH A;  5FSM A;  3X0O A;  3G0Q A;  3O61 A;  2KDW A;  5ISY A;  5ANS A;  3X0I A;  3N77 A;  2O5F A;  5BON A;  1VCD A;  3X0Q A;  1VHZ A;  3BM4 A;  5GHJ A;  2A8Q A;  2B0V A;  5CFI A;  2QKM B;  1V8Y A;  1HX3 A; 
#chains in the Genus database with same CATH topology
 3OGA A;  4J7H A;  5C8L A;  1K2E A;  2JVB A;  3X0L A;  3ZR0 A;  4NFX A;  1RRQ A;  3J7Y e;  1MP2 A;  3QSJ A;  3X0R A;  2Q9P A;  2ICJ A;  1KT9 A;  2AZW A;  2DSD A;  3X0K A;  1Q27 A;  1V8L A;  1V8I A;  4J7G A;  1OW2 A;  4ILQ A;  5FSK A;  3GZ5 A;  2KDV A;  3RH7 A;  1NQY A;  1VIQ A;  3GZ8 A;  3SHD A;  3X0P A;  2DHO A;  1V8W A;  1HZT A;  1X51 A;  2B2K A;  3SMD A;  2RRK A;  3H95 A;  4KG4 A;  5GHM A;  2I8U A;  3EES A;  3GG6 A;  1PUS A;  1GA7 A;  1V8T A;  5DEQ A;  1NFS A;  1Q54 A;  1TUM A;  3FK9 A;  1V8V A;  1V8S A;  4YPR A;  2DSC A;  4HFQ A;  4ICK A;  2GB5 A;  3EXQ A;  5DD4 A;  3GZ6 A;  1IRY A;  2YVM A;  4NFW A;  2GT2 A;  2A6T A;  3DUP A;  1V8R A;  2A8P A;  2QJT A;  5I8U A;  4S2V A;  3KVH A;  5HZX A;  5FSI A;  2VNP A;  1SJY A;  1MR2 A;  1NFZ A;  2PQV A;  3A6V A;  3HHJ A;  1SZ3 A;  3L85 A;  3FCM A;  3BHO A;  5FSO A;  5GHQ A;  3MDG A;  2GT4 A;  2FKB A;  3Q4I A;  1SOI A;  1PVF A;  4IJX A;  5FSL A;  4MPO A;  1PPW A;  2FVV A;  1JRK A;  4JZS A;  3F13 A;  3X0J A;  4JZT A;  2YVN A;  1VHG A;  4S2X A;  5IW4 A;  1RRS A;  3GRN A;  3A6U A;  1MK1 A;  1XSB A;  1MUT A;  3ZR1 A;  1X84 A;  5ANU A;  4DYW A;  1G0S A;  4V14 A;  3U53 A;  3ID9 A;  4HVY A;  2ICK A;  4C9W A;  1I9A A;  5FSN A;  5DDG A;  4N1T A;  5ANW A;  3DKU A;  1QVJ A;  3O69 A;  1X83 A;  3MCF A;  2O5W A;  3O52 A;  2G74 A;  5LPG A;  4JZU A;  5C7Q A;  4S2W A;  4S2Y A;  5DPK A;  3P6Y A;  1PUN A;  5C7T A;  2CL3 A;  2G73 A;  2PNY A;  3I9X A;  2A8S A;  3EEU A;  1MQE A;  2J8Q A;  2I8T A;  2W4E A;  4YPH A;  3AC9 A;  3O6Z A;  1V8N A;  2DSB A;  2R5W A;  1RYA A;  3HYQ A;  3X0S A;  4N1U A;  3Q2T A;  2FML A;  1KTG A;  1JKN A;  1U20 A;  2XSQ A;  1V8U A;  5ANV A;  5CFJ A;  5GHO A;  3MDI A;  1XSA A;  2YVO A;  5GHI A;  4JZV A;  5IW5 A;  1VRL A;  4K6E A;  3X0N A;  4ZG0 A;  2B06 A;  1F3Y A;  3GWY A;  4KYX A;  3E57 A;  1KHZ A;  2QJO A;  3Q1P A;  1R67 A;  3I7U A;  1PPX A;  3X0M A;  5BS6 A;  3FSP A;  2VNQ A;  2YVP A;  1K26 A;  3COU A;  1G9Q A;  3A6S A;  1Q33 A;  3ACA A;  3Q93 A;  1VC9 A;  4KTB A;  2A8R A;  4C9X A;  3P5T A;  1VIU A;  5GHN A;  3FFU A;  1SU2 A;  5GHP A;  3F6A A;  3FJY A;  3O8S A;  1V8M A;  3WHW A;  5ANT A;  1NQZ A;  3EF5 A;  3Q2S A;  1PUQ A;  3Q91 A;  2I6K A;  3R03 A;  4KG3 A;  3BAP A;  1VC8 A;  2A8T A;  1XSC A;  3N9U A;  1PPV A;  3SON A;  1MQW A;  3A6T A;  2DUK A;  2O1C A;  3MGM A;  4YOQ A;  3CNG A;  1VK6 A;  3I7V A;  2CZR A;  2YYH A;  5FSM A;  3X0O A;  3G0Q A;  3O61 A;  2KDW A;  5ISY A;  5ANS A;  3X0I A;  3N77 A;  2O5F A;  5BON A;  1VCD A;  3X0Q A;  1VHZ A;  3BM4 A;  5GHJ A;  2A8Q A;  2B0V A;  5CFI A;  2QKM B;  1V8Y A;  1HX3 A; 
#chains in the Genus database with same CATH homology
 3OGA A;  4J7H A;  5C8L A;  1K2E A;  2JVB A;  3X0L A;  3ZR0 A;  4NFX A;  1RRQ A;  3J7Y e;  1MP2 A;  3QSJ A;  3X0R A;  2Q9P A;  2ICJ A;  1KT9 A;  2AZW A;  2DSD A;  3X0K A;  1Q27 A;  1V8L A;  1V8I A;  4J7G A;  1OW2 A;  4ILQ A;  5FSK A;  3GZ5 A;  2KDV A;  3RH7 A;  1NQY A;  1VIQ A;  3GZ8 A;  3SHD A;  3X0P A;  2DHO A;  1V8W A;  1HZT A;  1X51 A;  2B2K A;  3SMD A;  2RRK A;  3H95 A;  4KG4 A;  5GHM A;  2I8U A;  3EES A;  3GG6 A;  1PUS A;  1GA7 A;  1V8T A;  5DEQ A;  1NFS A;  1Q54 A;  1TUM A;  3FK9 A;  1V8V A;  1V8S A;  4YPR A;  2DSC A;  4HFQ A;  4ICK A;  2GB5 A;  3EXQ A;  5DD4 A;  3GZ6 A;  1IRY A;  2YVM A;  4NFW A;  2GT2 A;  2A6T A;  3DUP A;  1V8R A;  2A8P A;  2QJT A;  5I8U A;  4S2V A;  3KVH A;  5HZX A;  5FSI A;  2VNP A;  1SJY A;  1MR2 A;  1NFZ A;  2PQV A;  3A6V A;  3HHJ A;  1SZ3 A;  3L85 A;  3FCM A;  3BHO A;  5FSO A;  5GHQ A;  3MDG A;  2GT4 A;  2FKB A;  3Q4I A;  1SOI A;  1PVF A;  4IJX A;  5FSL A;  4MPO A;  1PPW A;  2FVV A;  1JRK A;  4JZS A;  3F13 A;  3X0J A;  4JZT A;  2YVN A;  1VHG A;  4S2X A;  5IW4 A;  1RRS A;  3GRN A;  3A6U A;  1MK1 A;  1XSB A;  1MUT A;  3ZR1 A;  1X84 A;  5ANU A;  4DYW A;  1G0S A;  4V14 A;  3U53 A;  3ID9 A;  4HVY A;  2ICK A;  4C9W A;  1I9A A;  5FSN A;  5DDG A;  4N1T A;  5ANW A;  3DKU A;  1QVJ A;  3O69 A;  1X83 A;  3MCF A;  2O5W A;  3O52 A;  2G74 A;  5LPG A;  4JZU A;  5C7Q A;  4S2W A;  4S2Y A;  5DPK A;  3P6Y A;  1PUN A;  5C7T A;  2CL3 A;  2G73 A;  2PNY A;  3I9X A;  2A8S A;  3EEU A;  1MQE A;  2J8Q A;  2I8T A;  2W4E A;  4YPH A;  3AC9 A;  3O6Z A;  1V8N A;  2DSB A;  2R5W A;  1RYA A;  3HYQ A;  3X0S A;  4N1U A;  3Q2T A;  2FML A;  1KTG A;  1JKN A;  1U20 A;  2XSQ A;  1V8U A;  5ANV A;  5CFJ A;  5GHO A;  3MDI A;  1XSA A;  2YVO A;  5GHI A;  4JZV A;  5IW5 A;  1VRL A;  4K6E A;  3X0N A;  4ZG0 A;  2B06 A;  1F3Y A;  3GWY A;  4KYX A;  3E57 A;  1KHZ A;  2QJO A;  3Q1P A;  1R67 A;  3I7U A;  1PPX A;  3X0M A;  5BS6 A;  3FSP A;  2VNQ A;  2YVP A;  1K26 A;  3COU A;  1G9Q A;  3A6S A;  1Q33 A;  3ACA A;  3Q93 A;  1VC9 A;  4KTB A;  2A8R A;  4C9X A;  3P5T A;  1VIU A;  5GHN A;  3FFU A;  1SU2 A;  5GHP A;  3F6A A;  3FJY A;  3O8S A;  1V8M A;  3WHW A;  5ANT A;  1NQZ A;  3EF5 A;  3Q2S A;  1PUQ A;  3Q91 A;  2I6K A;  3R03 A;  4KG3 A;  3BAP A;  1VC8 A;  2A8T A;  1XSC A;  3N9U A;  1PPV A;  3SON A;  1MQW A;  3A6T A;  2DUK A;  2O1C A;  3MGM A;  4YOQ A;  3CNG A;  1VK6 A;  3I7V A;  2CZR A;  2YYH A;  5FSM A;  3X0O A;  3G0Q A;  3O61 A;  2KDW A;  5ISY A;  5ANS A;  3X0I A;  3N77 A;  2O5F A;  5BON A;  1VCD A;  3X0Q A;  1VHZ A;  3BM4 A;  5GHJ A;  2A8Q A;  2B0V A;  5CFI A;  2QKM B;  1V8Y A;  1HX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...