2A6TA

Crystal structure of s.pombe mrna decapping enzyme dcp2p
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
245
structure length
230
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFEISKIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIANNTTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPAC19A8.12
publication title Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein,hydrolase
total genus 63
structure length 230
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a6tA01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2a6tA02
5C7TA 2XSQA 2PQVA 3EF5A 4NFXA 2DHOA 1VHZA 4YPHA 5GHPA 4S2WA 3I9XA 5FSNA 2G74A 4DYWA 5BS6A 2A8PA 3GWYA 3FJYA 3R03A 5ANVA 3X0OA 2YVNA 3A6UA 2KDVA 3X0KA 5FSIA 3X0NA 1V8LA 3F6AA 3X0LA 3COUA 1RRQA 2FMLA 4C9WA 4K6EA 3O8SA 2B2KA 4S2VA 1HX3A 2I8TA 3HHJA 1V8VA 3I7UA 1F3YA 4KTBA 1V8WA 5I8UA 1K2EA 2JVBA 3MGMA 3SHDA 1PPWA 2ICKA 3O61A 1V8NA 1SZ3A 2YYHA 1VC8A 5ANTA 1PUSA 3SMDA 4HVYA 3GG6A 1JRKA 1KHZA 5DDGA 4KYXA 3U53A 4C9XA 4JZSA 5IW4A 1VIQA 5BONA 3Q1PA 5DEQA 5GHIA 4S2YA 1VCDA 3Q93A 1JKNA 2FVVA 2A8SA 1U20A 1V8YA 2GT4A 1QVJA 1NFZA 2ICJA 2O5WA 2PNYA 3KVHA 3P5TA 3EXQA 2I8UA 2DUKA 3X0SA 2A6TA 3O6ZA 5C8LA 4JZUA 2R5WA 3DKUA 5GHJA 1PPXA 3FSPA 1TUMA 1Q54A 1OW2A 2VNPA 3A6SA 3SONA 2AZWA 1V8SA 2FKBA 1XSCA 3CNGA 1G9QA 3N9UA 2DSDA 5DPKA 1VHGA 3FCMA 2VNQA 1MUTA 3E57A 5GHQA 3G0QA 2B06A 1MR2A 1VC9A 4YPRA 1V8MA 2A8TA 3Q2TA 1G0SA 1RRSA 1NFSA 5LPGA 1PPVA 2RRKA 3GZ5A 3H95A 5FSMA 3AC9A 2CL3A 4YOQA 1PVFA 4KG4A 3A6VA 4MPOA 3P6YA 3X0RA 2QKMB 2GT2A 3N77A 5CFJA 5GHNA 3EEUA 3MDIA 2YVPA 4N1UA 1MQEA 1X51A 2O1CA 1SU2A 1I9AA 3FFUA 4NFWA 3L85A 5HZXA 3O52A 1X84A 2A8QA 1XSAA 5ANUA 5FSOA 4IJXA 3Q4IA 2DSCA 1K26A 3MDGA 2QJTA 1PUNA 3BAPA 5ANWA 1MP2A 3X0PA 3MCFA 3ZR1A 5ISYA 3HYQA 2QJOA 1MK1A 5ANSA 4JZVA 1X83A 1HZTA 3GZ8A 5FSLA 4JZTA 5GHMA 2J8QA 1NQYA 4ZG0A 1GA7A 2KDWA 2Q9PA 2YVOA 4V14A 1V8UA 5FSKA 4KG3A 1MQWA 1RYAA 2GB5A 3QSJA 3O69A 4S2XA 3GRNA 2W4EA 2DSBA 2B0VA 1VIUA 3OGAA 4ICKA 3Q2SA 1SOIA 3BM4A 4ILQA 5DD4A 5IW5A 3GZ6A 3DUPA 1VRLA 3X0MA 1V8IA 2O5FA 3A6TA 4HFQA 3WHWA 3X0JA 5CFIA 1IRYA 1PUQA 1NQZA 1R67A 1SJYA 2YVMA 3I7VA 3X0QA 5C7QA 3X0IA 4N1TA 3ACAA 3ID9A 1KTGA 2QKLB 1V8TA 3F13A 3Q91A 3RH7A 3J7Ye 3ZR0A 1KT9A 1XSBA 1Q27A 1V8RA 1VK6A 2A8RA 3FK9A 5GHOA 3BHOA 3EESA 2I6KA 1Q33A 2G73A
chains in the Genus database with same CATH superfamily
5DS9A 5M5XJ 1EV7A 1QA6A 1WH7A 1H9GA 4U7BA 3RDIA 4A69C 1O3QA 1NHAA 1T39A 4DYQA 4AC0A 4HW0A 2VT3A 2A8PA 3CC2I 2JA7J 2HZTA 1FTTA 1PUEE 4BACA 4BQAA 3I54A 2Z3YA 5KHDA 4G6DA 3TDZC 1EA3A 3BP8A 1MBEA 4BXUA 2VB6A 3ESWB 1FYLA 2R4GA 4KTBA 5EGOA 1P7IA 2VKVA 3TOAA 2ESNA 4LFUA 2W25A 3ZQQA 1R4MB 5K1YA 1VC8A 2HYJA 3M07A 4NC6A 3PUBA 5L3DA 4F52A 4C9XA 2F5FA 5J6XA 3Q9VA 4BY7J 2QQBA 1I1GA 5IOYA 3CQZJ 2CQXA 2M8GX 1Z3YA 2FF4A 2BBYA 1QPMA 3ZMUA 1ERDA 4JYKA 2BGCA 4ZYGA 3HDDA 5L3CA 3ERED 1T38A 4S0HB 3TKYA 3H3ZA 2M0MA 4AVZA 2A6EF 2FSWA 1H89C 3RKWA 2IAIA 3LSPA 3HOSA 1WSUA 2PMZA 4BQNA 1MUTA 4FE4A 2IXSA 3FBIB 1MR2A 3VOEA 3HG9A 3QPSA 4A6EA 2QA4I 2GWRA 4WXHA 3K10A 1AWCA 1Z7UA 4MPOA 1NK2P 3LSHA 5LBQA 3RKQA 2K7LA 5CFJA 2HTSA 2LF8A 3I71A 4F92B 4N1UA 2DA7A 3OIQA 3A01B 3N05A 4XRSG 1B72A 2Z9OA 2XROA 1X84A 1B6AA 4Q48A 3ZMDA 5D4SA 2ZCWA 5TRDA 5HLIA 5ANWA 2VQLA 2HYGD 2NAZA 2QUFA 4NBQA 1B8IA 1I27A 2VJ5A 4XIDA 3GZ8A 3LSRA 3HOZJ 1EJ9A 3GFIA 5TGTA 3QODA 1FOXA 1WRJA 2KIQA 2KDWA 4CXFA 4V14A 2ISYA 2CV0A 3E6MA 1RR7A 2WV0A 2XSJC 1USTA 3F8MA 2OCCH 2W4EA 1X1PA 1ZGWA 4LOCA 4V2FA 4ZYHA 3RPQA 3ZMVA 2ZMEB 1XSXA 2EFOA 1AU7A 3BLYA 3N4MA 2P5VA 3X0JA 1KYWA 3M4OJ 3W6KB 1YIOA 4UVAA 5CQEA 5AIQA 2MD0A 4I01A 1W0TA 2K9QA 4IEJA 2E2HJ 3UNGC 2CFOA 1OR7A 3C2BA 5EEGA 1IC8A 5LFAA 2LNBA 3MZYA 4LK0F 2XAFA 4WF2A 5F08A 4HRIA 5LPGA 2G73A 5C4XJ 1XGSA 2FXAA 2M2EA 4G6QA 4Y4RA 3SXYA 3QP6A 1ZELA 5B1AH 1OCRH 2VQCA 1K78B 2B63J 3L2UA 4H0EA 3ECOA 5EF6A 4PUSA 4IHYA 2Z33A 3ULQB 3FMSA 3AG3H 2E5ZA 2HOAA 3D5SC 5I8UA 1ON2A 2ZMEC 5IYCJ 1NK3P 1OCZH 3CUOA 2VE9A 4RGRA 4ZYAA 1TNTA 1Y8RB 1VQPI 3PIOF 1TQPA 2KDOA 3KE2A 2IGNA 3RCOA 3BZKA 4D5FA 2XB0X 5GAHJ 1FIAA 2VL8A 3B73A 3E3VA 5ILUA 2Y48A 2KISA 3H5RA 2LKXA 2PN6A 4RS8A 1VQOI 3QYBA 3E5UA 2AXLA 2M45A 5EGOB 2AZWA 1TWFJ 3EUAA 2EIKH 1D0ZA 1W5CC 4YG2F 2FA5A 4BL0B 3F23A 5LHIA 3BTJA 5DM6F 3DCFA 1KU2A 2CV2A 1VQNI 2Q8KA 2VPLA 3IV5A 2IS4A 1X1AA 3AC9A 2E34A 4XSXF 3X0RA 4KMUX 3GO5A 4AWXB 5DM7F 1JKQC 2CQ7A 2OU2A 1X58A 3PNYA 5E17F 2JA5J 1XD7A 1U6GA 2HOEA 2ZJRF 3SFIA 1FZPB 2GBYA 2B0LA 2XGCA 5H6RA 2UV1A 2CV1A 4V19K 2VOOA 1Z21A 3X0PA 2WAFA 4HV6A 5JI6A 3LL7A 3MKLA 3DFGA 1ZRDA 2OAZA 1SFXA 4BAYA 1N25A 1P4WA 3WTUC 4A3IJ 1Z05A 1MNDA 1SVOA 2FJ1A 2HU9A 4JP0A 2GB5A 3QSJA 2VQGA 2BYVE 2RGVA 2NVTJ 2MYSA 4YFKF 4ICKA 4DZPA 1ZG3A 2VJIA 2JZYA 2K86A 4EV0A 5E8GA 1VRLA 4M6XA 3FMQA 4IHWA 4XONA 1XSVA 3DTIA 2HQAA 2X1CA 3ZR8X 2V1NA 2BVLA 3TOBA 3F13A 1PJRA 1XSDA 1OJLA 2KJCA 2V6EA 4M3FA 1Z1DA 3MCZA 3S1QJ 1QU3A 2KFDA 1G3TA 3CJNA 3QU6A 1VQ4I 2V1UA 1F43A 3G71I 3X2QH 4AIJA 1LNWA 2RVCA 3HPGA 3VSLA 2UZKA 3W2WA 3CUQA 3I59A 4E7SA 2CSOA 2ZJPF 2GA2A 2I5UA 5IT3A 4IOAF 1P2FA 3X0NA 4L9VA 1OKRA 1FT9A 1F5TA 3JSOA 4K6EA 4HYEA 4BNCA 4KDPA 1KONA 4M9XA 1PP8F 1HDDC 3BPVA 3K4NA 1TWGJ 3ZXSA 3MGMA 2UXXA 4GXOA 2XGXA 4BHBA 3F8NA 2V4JC 4NDLA 3I53A 1TW2A 2DA4A 5GPAA 1WQ2A 4HBLA 4A2UA 3FHZA 4CSWA 3QRFF 4PSWA 1ETWA 3QPLA 4J7GA 3TEDA 2KIFA 3EXQA 3V8KA 4DJAA 3HPHA 2MFZA 1MDMA 2EZIA 1G6NA 1WVRA 1TUMA 3A6SA 1YQAA 1S6LA 1MIJA 4EVIA 1BBYA 4EMSA 2LD5A 1OCOH 3SYTA 1V8MA 2RNJA 1A36A 3CO7C 3NRVA 3H95A 3BR0A 1RPWA 1YTYA 4YOQA 4M9SA 3M9AA 5FJ8J 4BJTA 2RREA 3C7JA 4KUMA 4UXNA 5B3SH 2P5LC 1OYYA 1GXQA 2XB5A 4UVCA 3MZHA 3DQVC 1W5TA 5LGUA 1SU2A 4RAGA 2BVMA 2MH9A 2Y9YA 2DMPA 4FASD 2JSCA 2WWYA 3CCMI 2PEXA 1IXRC 4BE0A 2H09A 1VQ6I 1P9QC 2IA0A 1JT6A 1WJAA 3ZR1A 5L3FA 1TT5B 1ZGJA 5FKKA 4CO8A 1IRZA 3JAMZ 2K9LA 4IL6C 3HGGA 4F55A 2LC2A 3FXMA 2QGUA 4RA2A 3ZMZA 4KG3A 3KZIC 1MQWA 4IF4A 4Y15A 1ZR2A 4XN3A 1ZREA 3GRNA 2COMA 2DJIA 4R1HA 4M74A 2ISZA 2VT2A 2L7KA 3GX4X 1H8AC 2VLAA 1BC8C 4GFBA 1Y1VJ 3KLNA 3X0MA 2B9SA 2H1LA 3DPUA 3RYRA 2YX7A 4UHTA 3B6CA 3I58A 3PSFA 1ETYA 2R7SA 2I10A 3G6EI 4B48A 4RB2C 2ECCA 4B8XA 2XDVA 1R58A 2A8RA 4XKBA 2XKOA 1QZYA 2WY8Q 4ENMA 3P9CA 2JJ7A 5C7TA 3GYHX 3FK6A 5J8CA 4RB0A 4KFCA 2IGMA 5FKOA 4JK1X 4L9TA 1MBFA 1O7LA 1QBJA 2HKXA 2KJBA 1YITI 4R79A 1A5JA 2EFNA 2XPVA 2Y2ZA 3HZJA 3DBLB 5CLSA 4E7HA 3O8SA 2V6CA 2LFBA 3S2DJ 2GAUA 3A2KA 2P4WA 3BTCA 5FKMA 2LLKA 3U2RA 1BM9A 2EH3A 1PPWA 2ICKA 3NWSA 3WODF 4PCQA 4C3HJ 2XHKA 3CUQB 3I59B 1FMWA 4JZSA 1QVUA 4LK1F 4XLPF 2XUBA 3PO2J 3GUDA 4AM3A 4BXXJ 1VIQA 1YE9A 1S5LC 2A3SA 1YI2I 2A8SA 5LEKA 4XBFA 1QVJA 3K1MA 4FX0A 3WHBA 2ZSHB 2K02A 5IP9J 4XRSA 3K4LA 1V3FA 1XG1A 1Q54A 2FKBA 4OMZA 4II3A 3OWTA 4U0WA 3ELKA 4XLHA 5J4YA 5M5YJ 3FCMA 1WI9A 3K4MA 1JXSA 1O4XA 4XKVA 2AO9A 4M73A 1ODDA 1U8BA 3HGYA 3GZ5A 1BR2A 2IT0A 1J9IA 3ASOH 4FE7A 4FHTA 5FKNA 1VF9A 3QPTA 2NS7A 1L3LA 3I4MJ 4MTDA 1QO0D 2QEXI 1BR1A 3HRSA 1S3JA 2DA2A 5DUIA 5E3NA 1MDMB 3CUQC 3Q0UA 1K7AA 2A8QA 2L4AA 1X2MA 3M1EA 1MNEA 4Y7NJ 3HSFA 3G73A 3E5XA 2LSOA 2LG4A 2A61A 4UUTA 1MK1A 2Q1ZB 2CW8A 4PZJA 3M8EA 3OV8A 2V9KA 3AFHA 2JPCA 2AQEA 1D3YA 2P5KA 5J1UA 3BJAA 3MWMA 2GXAA 4DBQA 4MQVA 1SD4A 1Z91A 1PVEA 4XOPA 2HQ5A 2KPMA 1WJEA 1WGXA 5DD4A 3A4CA 3CCQI 3T8RA 5HDKA 4BGDA 2O0YA 1TWCJ 3FXOA 3X0IA 2DT5A 1V4RA 3KP6A 4YFNF 1AKHA 3BPXA 2P8TA 1EH7A 5K7HA 1K6OA 2IS2A 2ZXIA 4EM2A 1I5ZA 5E8IA 1BOAA 1U78A 3KYLA 1WFXA 4CYCA 3OYLA 5EZHA 4BHCA 3OR1C 1BI0A 1PUFB 2KDVA 1JUSA 5IYDJ 1MSFC 3BG6A 5ICGA 4R8HA 3LNQA 4L5JA 1YJWI 2RN7A 3LSKA 1D1AA 1YX5A 3HOWJ 1HLVA 2JVBA 2CFXA 3WE2A 2HXIA 4XLEA 2EK5A 3MKZA 3S16J 4HVYA 5K7ZA 2P7CB 5EG0A 1H9TA 2XAGA 4M71A 1BI1A 5D8KB 2VBYA 3DXJF 4EJWA 2RC4A 1MJAA 1YS6A 3F9KA 1GV2A 3EUHA 3G3ZA 5LEJA 2LMDA 3CCLI 3TO6A 5CVJA 5FLMJ 4KNYA 3CC7I 1P4AA 4PJJA 1A6QA 3VYSB 2V9VA 3K2ZA 3OYBA 3DV8A 1QRYA 3C3WA 1PPXA 5CYVA 3OYHA 4MFDA 5E20A 5A2QK 1VHGA 1POGA 3SEQA 2QM3A 4RDUA 4AIKA 2HFHA 4XLCA 1MMNA 2A8TA 1RI7A 2KIUA 2GIVA 4J01A 1UMQA 2R7WA 2NYXA 4D7MA 2R93J 4HAMA 3LFKA 3DPLC 1S7OA 4C2UA 2HVQA 3OOUA 2Y0SN 1ZLKA 1DGWY 1IV8A 1I9AA 2M34A 1HQCA 1SANA 2DOEA 2EIMH 2ME6A 5JFRA 2PMZN 5FLXK 2DSCA 2EFPA 1I6XA 4E7KA 2HWVA 3I9V2 1E3HA 3BAPA 3PSIA 4ZDOA 3TMOA 4HDUA 3GMEA 3HYQA 4JZVA 4ZJZA 3J80Z 4IX7A 4X6AJ 4PFPA 3ASNH 1GA7A 4WXDA 1TNSA 2KIMA 1VQ8I 4EJVA 1V8UA 1U9OA 3MFKA 5FSKA 1X4PA 2OPTA 3H3VK 4ZDLA 2IGKA 3GTKJ 1VIUA 1B1BA 3HRTA 5LGTA 4CCKA 3BM4A 2EV0A 1Y0NA 4C9YA 3Q9SA 1G59A 3EYIA 2NNNA 2IPQX 3SQNA 2E1CA 1GDTA 4X1EA 1RUOA 3ERMA 4D1QA 3D1NI 2LOOA 2D45A 2BZTA 4P96A 3JRFA 4DIQA 1V8RA 1XSBA 3JREA 2NS0A 1LDKB 4CGZA 3GWZA 3S32A 3K4CA 4NFXA 5EJCA 2DHOA 2IA2A 2E19A 4FTHA 1E3PA 3I55I 4XKWA 1UFMA 4HQMA 2E5NA 1IN4A 4WXCA 5BPDA 3DWLE 2GOMA 4BQQA 5F27A 3DEUA 5ANVA 4E70A 1IJWC 2Z5UA 1JHFA 1GVJA 3K4JA 2VBXA 2IP2A 5M3MJ 3R60A 1FBSA 1T2KA 4RAZA 1TWAJ 1SFEA 1V8WA 1IN5A 2N8GA 1AKHB 3AL0B 1ZN2A 4G7HF 4MIMA 2X48A 2A69F 1YO5C 1R5GA 4EJOA 2DFIA 3SMDA 1KHZA 5BPIA 2RNGA 4MEXF 2F5DA 3CCRI 4CYDA 1WZ2A 4CYCB 5HLHA 1VCDA 4ENNA 3KVHA 4HNTA 1TLHB 3GLLA 5C8LA 3H35A 4BQOA 3K70C 1QPIA 1DGRM 1EF4A 1WJ5A 3BTLA 1MW7A 2CRGA 2XRNA 3O3KA 5ICEA 1XMAA 4AU7A 1TL8A 1R9TJ 5F6FA 2DXIA 4HF1A 1S8NA 5KAFC 1VC9A 5C44J 2NOGA 4RMNA 3JR9A 3HSRA 1LJ9A 2TCTA 4F93B 3OOPA 3FXJA 3AL0C 1OPCA 2QKMB 2GT2A 3N77A 1GV5A 5HLTA 5GHNA 4A6DA 5CVIA 1G4DA 3F8BA 3M1CA 3V7SA 3KETA 2OZUA 3O52A 4CZCA 1JUMA 3OS1A 2W48A 4I09A 4A3DJ 2E1NA 4M3GA 2CGPA 4DBRA 3MDGA 5LRSA 3OYJA 1RESA 1G3SA 2Y0SA 1FOWA 3FF5A 3QOPA 2IS6A 4G8XA 3C2HA 1KA8A 2QJOA 5ANSA 4E7JA 2L9SA 4HLXA 4E7IA 1JTYA 2XF6A 4X0GA 3J7AY 5FLVA 1NQYA 2Y31A 1WJDA 1BN5A 1MKMA 1ZAOA 3DLLF 2CG4A 1WCMJ 2E7XA 4WX9A 2EV5A 1YFHA 3OGAA 2VJJA 4ILQA 4ASNA 2WA0A 1JE8A 1USSA 2G7HA 3CLOA 2HGCA 4BXFA 1YOVB 3KYDB 3MD2A 3SEZA 3EUHC 2M1BA 3RPUA 5GAGJ 4OMYA 4M72A 1LDDA 3VYTB 1LPQA 4BBSJ 2KDZA 1FOYA 2CO5A 4NB5A 3O8GA 3DKYA 3RSNA 1RR8C 4A3BJ 3Q91A 3SZGA 2HDDA 1GXPA 1FSEA 1XGOA 2RV8A 3VB2A 4ENKA 3K2AA 2MA3A 5ILSA 5D5UB 3I7UA 3FMRA 3EF5A 2K3PA 4S2WA 3PNVA 2L7FP 3RQ4A 4P9FA 2BHYA 4IQ4A 3LAPA 2DO7A 1J59A 1IXCA 3U1DA 4DYCA 2IVMA 2IBDA 4GYIA 3R61A 1P4XA 1D0XA 3X0LA 3BZCA 2M87A 4C9WA 4E7LA 1IRFA 1AHDP 4S2VA 1F3YA 1HKQA 3ZGKA 3ZRGA 2ELKA 2BXYA 1A04A 4CHUA 3K6GA 1VQ5I 2P7VB 3FK7A 2JUGA 2R7FA 2FUG2 4RM2A 1V8NA 2OC6A 2W7NA 1JKPC 4LMYA 5JVGF 2P81A 2PX9A 5DDGA 1DUXC 4W1UA 4I02A 3RJPA 4I6ZA 2O7OA 2MLKA 1S7EA 5DD8A 1X1BA 3BT9A 3E0JB 4AVPA 2JT1A 3AAFA 3PQKA 1LB2A 4QSHA 2W4SA 2Y75A 4ESJA 2XPUA 1L0OC 4F91B 5KNLA 2EA2A 4HQEA 2R5WA 3V8JA 2E35A 2QWWA 3IKTA 5GHJA 4FETA 3BY6A 3KIOA 2MC4A 2VNPA 1EH8A 4A12A 2M4KA 4E4HA 1SFOJ 3R6SA 4RAFA 1X3WB 3G0QA 2B06A 3L2RA 1UJ8A 2DFHA 2ZJQF 2FE3A 3UR3C 1JHHA 3FKIJ 2X51A 3A0BC 4DZJA 1NFSA 2ZKZA 1TTYA 2ACJA 1MD0A 3KCCA 2W24A 2PBIA 3HTUA 1VNDA 1K6YA 4S05A 3A6VA 5J8FA 4UV8A 3U21A 3K4KA 1IN8A 4ZTJA 3O2PE 3JRIA 1D8JA 3ABKH 1KQ0A 3KYCB 2F5CA 5FROA 5ILVA 3F22A 4B43A 1LFBA 2KT0A 3KLOA 1ZLJA 2L4MA 3CCYA 3LSGA 4O5VA 1RC9A 2QSFX 3QAHA 4RBOA 3IH3A 2HDWA 4NFWA 2H1KA 2RDPA 5GTHC 3HOVJ 2YVOA 2QQAA 4UV9A 4JQFA 4XL9A 3KEQA 2X0LA 2IS1A 4HNUA 1SD5A 3BR1A 4I99C 2CYYA 3G1OA 4MO7A 2E36A 2YX4A 3GZ6A 2W57A 3RKYA 3HOUJ 3E1SA 3PO3J 3DEEA 3FISA 2E2IJ 4HFQA 4G9YA 2EFQA 4IRHA 1FEXA 3IH4A 2A6HF 3PFYA 4IQJA 2STWA 1QHHD 3CMMA 1UELB 4U87A 2MBFA 4OIOF 4L5EA 3ZR0A 1XTAA 1T0FA 3DLAA 4OU0A 3TL4X 3B6AA 3OYMA 3OIPA 1IG7A 1APLC 2W82A 4N4OB 2QZ8A 2NVXJ 1FYKA 2DT7B 2ZXJA 5D5XB 4YFXF 1U9NA 1BOBA 1B72B 5GADJ 3LA7A 4K2EA 3RIRA 4GRIA 1LE8A 3X0KA 1G8XA 2IJLA 2WY7Q 1UG0A 1QHGA 2R92J 3G2BA 3KP3A 1V8VA 4NNJA 1B8IB 1LUJB 3BWGA 1R22A 5IPAA 2JN6A 3H9JA 4A3JJ 2ZBKA 3BC8A 2XV4S 3SHDA 2OQRA 1ETXA 4XOTA 4CH7A 4IHSA 3I64A 5JR3A 2QQ9A 3GCMA 5M5WJ 2VC0A 2R0QC 4IHXA 2VPRA 1U8RA 1W7PD 1VQLI 3QU3A 1BL0A 3K4BA 5BONA 1YX3A 2DLLA 4YRVA 1R5HA 1U20A 3CCVI 2VKDA 2CU7A 3IAM2 4LLNA 3HRMA 1V54H 3DKUA 2E1MB 1Z0XA 4RLFA 3G1LA 5K5RA 1SMTA 4Y13A 1J7KA 2HPIA 3LWFA 1CF7A 2OCEA 4XM3A 4IKFA 3ZMTA 3E57A 4NC8A 1ZTRA 1KZHA 2LVSA 5BNGA 3ZQIA 3J81Z 4AD9A 1RRSA 1BJZA 1VTNC 3CP2A 3JAMK 2HYFA 3IL2A 1N78A 2CWEA 2BW3A 1T6SA 2P6TA 4KG4A 3IKVA 1W0UA 1ZR4A 5HVQC 4OIPF 4G12A 2R5ZA 4KN7X 3Q3SA 3GZNB 4LLLA 4BKXA 4EJTA 3FX3A 3ISPA 1SFUA 4HG2A 3Q4IA 3S2HJ 1G2HA 2L02A 3A1YA 1K26A 4W97A 2VOPA 4ZC3A 1MP2A 2IEKA 4AYBA 2A5YB 6PAXA 1H0MA 4J19A 1DP3A 2FD5A 3KP4A 3CDIA 5ERIA 4HX7A 4JZTA 3ZQCA 1JTXA 2E1MC 3K7AJ 4ITVA 2ME0A 4YIIA 4Q5SF 3OR2C 1Q1HA 1LEAA 1W7PA 2DFFA 1D5YA 2K5CA 2DPUA 2PJRA 1LFPA 1Y56A 3K1PA 2EINH 2X1DA 2XKPA 3KP7A 1IRGA 1MBKA 2O3FA 1R5ID 2AS5F 1SVMA 4XKCA 4B09A 2FEZA 1RNLA 1ZHFA 2BHZA 1HKSA 4IVNA 4PDKA 3ZOBA 1Z67A 4CCMA 5J1RA 3I7VA 1GLNA 3KZYA 4IXAA 2V79A 1O3SA 2HTJA 3QOEA 2CMPA 2XSDC 2JA8J 3DU6A 2MABA 2MSYA 2KP6A 3SZTA 3H0DA 1T33A 4MHGA 4BE1A 1V5FA 2J5PA 2OQGA 4N4NB 3RI4A 2V1XA 5JVTA 1VHZA 1T08B 3CJTB 3LMMA 3BG5A 4HF2A 3NARA 5FRMA 3F6OA 4EQQA 3JRDA 2OA4A 3HC7A 1DPRA 3QP5A 9ANTA 4QLCU 4O6JA 3ZCOA 2YVNA 1RRQA 2WAQA 1V8LA 4PGGA 4PJNA 2CH0A 4D7NA 3W6VA 2GZWA 1R71A 1FP2A 2ICWG 2O5RA 1MMAA 1JJ6C 1FBUA 1LVAA 1HF0A 1SZ3A 2A07F 2FBIA 2EWNA 3DP7A 4ESBA 3GTLJ 3U53A 4A0YA 2X9DA 2M0CA 4ZZDA 1FPQA 2LYCA 4KT6A 1JKRC 1VQ9I 4BEHA 2F4IA 3CF5F 2GT4A 2ICJA 1LE8B 3OSFA 3SJMA 3Q0VA 3HHHA 5HS7A 3LQRA 1RZ4A 4LB6B 5K5OA 2QBYA 2GA1A 1K61A 1XS9A 2JQ7A 5H20A 3SONA 4EM0B 1A31A 2HR3A 4IHTA 1MH3A 1R6RA 4WK8F 4KIBA 4HPQA 2DSDA 2MG4A 4A3GJ 2VASA 2VXZA 4FT8A 3WG7H 4G94A 3RKXA 2JK3A 5JLXA 3IUOA 1T0FC 1JT0A 3F21A 1X1CA 2LREA 4F3QA 3K70D 1U5TA 4HZFA 1BA5A 2LKSA 2DQLA 2EV6A 4Y33A 5J3LA 1RKWA 2JMWA 3VYUB 1I50J 4CA0A 3BZ6A 1CF7B 4MFEA 4MQ9F 2F2EA 3RYPA 3Q0WA 2HS5A 5FSLA 1E17A 4B3AA 2VI6A 1FC3A 1SEUA 4HF0A 3RQIA 2BW3B 2DYSH 1J2XA 4F7ZA 1R49A 5IT9Z 3KPHA 4RM3A 4CZZA 3VWBA 2R5ZB 2NOJB 5JLWA 2DSBA 5CVUA 1RETA 1MJBA 2B0VA 4ZDPA 2LBFA 2M3AA 3CCUI 1FY7A 3D5LA 2EBIA 5J1YA 1IRYA 3OSGA 1JI8A 1D8KA 1UHSA 4ZYDA 3HRUA 4L0ZB 1P7JA 4XNFA 4RAYA 4KIGA 3H1CA 1HA8A 4N1TA 3ID9A 3V4GA 2EZHA 3KP5A 5FD5A 1P92A 1IUFA 1MBGA 4KISA 3BCBA 2L0KA 2M8EA 2Q2EA 3EESA 3BG3A 4IOCF 1UZCA 1W7PB 4KITB 2W00A 4XLFA 2PJRB 4M3EA 1IDZA 1FLIA 3CJQB 4QPQA 2QVOA 1UCRA 2F5VA 2WTEA 2WAEA 3IH2A 3BQYA 3MQ0A 1R1UA 5J4VA 3COUA 1X3ZB 1SAUA 2QYOA 4O3MA 1FX7A 3TBIA 1UHMA 3E6CC 3SZPA 2I8TA 1YW7A 2MC3A 3V7CA 3TW7A 4ABZA 2DTRA 1TP4A 2L2OA 4KICA 4C3JJ 3CDLA 5E1ZB 1KQ9A 2K27A 4EATA 4NHJA 3F8CA 4XLAA 2STTA 4CCLA 4KN4X 3HHGA 5CQGA 2E7WA 2KZGA 3DTEA 1K83J 3EPZA 4BU2A 1F1ZA 5GHIA 5ICFA 3Q93A 1XDUA 3H92A 2FRHA 2HQNA 2L7MP 2GIZA 3MVPA 4JBAA 2JWTA 3TGNA 4J00A 3AG4H 2ELJA 2XAJA 3GTJJ 3S3MA 2C6YA 2DUKA 4JZUA 2JUCA 5DTDA 1IF1A 4GYGA 5FO5A 3J7ZI 3FSPA 4QIWN 3V8LA 4ESFA 2BOLA 2EQRA 2KQRA 3N9UA 2M7AA 4QTRA 4FISA 5EEHA 1WJBA 3L1PA 2O9LA 4LG3A 3VYRB 2OTLI 1BI3A 2LKPA 5GP9A 1KU7A 2HOSA 1TQIA 1GHCA 2AHQA 2H94A 3FWEA 5TJJA 4LGWA 3FIWA 4BEHB 3J80K 3ROUA 2ELHA 3FZVA 3DPTA 4XRFA 2BY1A 3S14J 1G3WA 1T98A 2FMYA 5F1RA 3OL4A 5L3EA 4B47A 2O1CA 1W4MA 1ZARA 3IAS2 4XRMA 1IGNA 2QBYB 3HIFA 4H4KC 2VUMJ 3L85A 5HZXA 2RKHA 2BXZA 5ANUA 1BI2A 1VQMI 4I0BA 2E2JJ 5B66C 2IA1A 2K9MA 2Z16A 3GF2A 3I4NJ 2AXTC 3P5JA 3ABMH 4UUSA 1PUNA 3GFLA 2W85A 5IY5H 2DCEA 3CCEI 1YW8A 5BMZA 4ENJA 1FNNA 1SD7A 2LF7A 4U0YA 4L9NA 2Q9PA 4OAZA 3A03A 4Y52J 3L2VA 1YYVA 1VI0A 3ZQ7A 4BHPA 3F8FA 1U5TB 1K4TA 3O69A 2NVYJ 3TO9A 3Q2SA 1SOIA 3VPRA 3AKZA 2DA3A 1XC5A 1K4SA 4QWQA 2Q0OA 4BYYA 4ETSA 1FP1D 3CMAI 1V8IA 2OZ6A 1NG7A 1PDNC 3X0QA 2J5OA 1IN7A 4XORA 3DTKA 3CO6C 4GDFA 3ACAA 3E6DA 3LSMA 3BR5A 2JVHA 3QYEA 5GHOA 3H36A 3BDDA 4IRIA 2BEOA 2LY1A 2EILH 4G6TB 2FBHA 4PJMA 5FGMA 1IRXA 1YG2A 1ZGAA 1DU0A 2DDAA 3WU1B 4LITA 3ZQLA 2FQ4A 4AIHA 3ZN0A 4L9JA 3JW4A 3COAC 2M30A 3MEXA 3OYKA 5FSNA 2L9VA 5M3FJ 3MKWB 4YIFA 2XPWA 4U88A 3R03A 2ID6A 4BS9A 1QVTA 3S15J 2RQPA 4ZTFA 3ZPLA 1YJNI 5J47A 1SFKA 2QF7A 2EFWA 3CF2A 1U5TC 1UHWA 2HQRA 2X6XA 5B1BH 1X2NA 1ZKGA 2NXNB 3BR3A 1R23A 4PFOA 3GLXA 4CICA 2V7FA 2PMHA 5D4RA 3FM3A 2QQ8A 2ID3A 3U9GA 2Q2EB 3PNTA 3I4PA 1HXDA 1MH4A 5HDNA 1ON1A 4UB8C 2PQ8A 1XGMA 2V1DA 2ZNZA 4KYXA 3GTGJ 2CQNA 5EYRA 4WWCA 1E3OC 2G0EA 1OFCX 1HKTA 2LTPA 1YJ9I 4OAYA 2DMTA 3W3CA 3CCJI 1VQKI 3GTPJ 3E6BA 1V8YA 2FVVA 2O5WA 2WBMA 2P0WA 3VDXA 1VFCA 1SC7A 3X0SA 1WH5A 2YU3A 2JRTA 2DAOA 4Y17A 5GAEJ 1OW2A 1MMSA 1D5VA 4KYWA 1AOYA 4DOZA 4BBRJ 2LR8A 3WG9A 1FIPA 4JOMA 2FOWA 1DQUA 3JRBA 3WTZA 1ACIA 3I3LA 2PJPA 3OIOA 4XMYA 5FSMA 3HJEA 4UNOA 3NEUA 1WKMA 2GXGA 3FFUA 1K78A 4UB6C 1T95A 3DF8A 2NRAC 4IJXA 2ZSIB 5DCFA 1ZG5A 2X6OA 3RPUD 1XGNA 1Y8QB 4GO1A 3L2CA 5C4JJ 5HNHA 5ISYA 5E79C 3IWZA 3UKGA 3M3YJ 1HZTA 3KFWX 2FX0A 2VODA 3G1MA 5EG0B 2PMUA 4ZG0A 2KLOA 2ZNYA 2YU9J 2VKHA 4XLNF 2RQQA 3FXQA 4RB3C 2PLYA 1WPKA 5KCMA 4BH9A 1IZ1A 2VXDA 2XGEA 5CVRA 4HX8A 2R7VA 1VQ7I 3SFZA 3WE3A 5IP7J 1SMYF 4UUSB 4A3EJ 2M5WA 1TZLA 4LIUA 1SJYA 4MGRA 1W5SA 3LQQA 2DU9A 2DQRA 1V8TA 5E1XA 1IW7F 1Z6TA 4B3XA 4PGHA 3MKYB 1Q27A 3C2GA 3M8JA 3KX2A 4CCJA 2FOKA 2R7ZJ 1U2WA 3REOA 3WU0A 2TRTA 1BW6A 3QQAA 4YIRX 2AQFA 5H2FC 5JHUA 2ETHA 3H9GA 3U1KA 3FJYA 4OWRB 2MW8A 1ORKA 3GTOJ 2K4JA 1ITYA 1V5EA 2B2KA 1QNTA 3WTXC 2XGDA 3P9KA 2DN0A 2HZDA 1SVLA 1DP7P 2ESHA 3T8TA 3AG1H 3OYFA 2ZC2A 2HVRA 2EZKA 4II2A 4FCYA 3L09A 1JJ8C 1Y6IA 3TP3A 2K40A 1P6RA 1IXSB 5D8LB 4MLOA 1BC7C 3DBHB 4G7OF 4NQWA 1G3YA 1I1SA 4S2YA 3SDBA 2FQ3A 1ETOA 1YW9A 4A5MA 2I8UA 2A6TA 2COBA 3E5QA 2XF7A 1D1BA 4EJUA 1V8SA 1G9QA 2VBWA 2BY3A 2OF7A 2D1VA 1ETKA 2R7RA 1IDYA 4M3DA 2CZRA 1ZG1A 1YIJI 3JCUC 1R36A 3S3NA 4WCGA 2R7DA 4LIVA 3SHFA 3CD6I 2CL3A 1RUNA 4NUBA 4A3KJ 4QPOA 1Z9CA 4CCNA 2YVPA 2EA4A 3ZMSA 2Y9ZA 4RB1A 2Z99A 2KRFA 5HLGA 3JRHA 3B02A 3E7LA 2EPFA 3FXLA 5D5WB 5C3EJ 1X83A 5LLQA 5GHMA 1U0JA 3KEYA 5B5EC 2NS8A 1HSTA 4V2GA 2L01A 5LD2C 2HOTA 4CUGA 3ZP5A 3D0SA 4ZZLA 1O3RA 1NH3A 1RYAA 3LSJA 5FFXA 1V55H 5LGNA 3JSPA 4A0XA 3S93A 4BJ5C 2R5YA 5IP6A 2KRHA 2DODA 4AYBN 4OINF 2DFEA 2KZVA 4LB5A 4DNCA 2I8DA 4HEA2 3WTTC 3WHWA 2OUMA 5FRNA 1NQZA 3HL2A 4HLYA 2W1OA 4L5IA 3VODA 2V26A 2P6SA 1ZRFA 3FM5A 2WADA 3J7Ye 5D6FA 1FOKA 4LG0A 1QZZA 4E7ZA 4P55A 3BHOA 3Q1PA 3DKXA 2VN2A 1Y0UA 1Z77A 1PP7U 3K9TA 2BY2A 5L3GA 3EUKL 1MMGA 2CUZA 2JPBA 3I9XA 3LSIA 4IPAA 2G74A 4PK4A 5BS6A 2X6YA 2CJJA 3BQZA 3HEFA 4B4CA 3WGIA 1XN7A 3BTIA 1DDNA 4L18B 2CUJA 3NQOA 2CW7A 4C2TA 5KVRA 2FMLA 2W84A 3HSEA 1XPXA 2LY9A 4RGXA 3WGGA 2DYRH 2F4MB 3JTHA 1ULYA 2PG4A 3QYFA 2QENA 1KU3A 2E1OA 1E0EA 5IOZA 2DT6A 3LA2A 4JX4A 5ANTA 1ENHA 2FNAA 2DW4A 1PUSA 1MZBA 2HI3A 3GG6A 3WHCA 1W36C 3W2AA 4XSZF 3J81K 4BDYA 3ZQGA 3T0YA 2WAQN 3CTAA 1QGPA 3JRAA 2HNHA 4HNVA 3ECHA 5LHGA 3CMYA 3GFJA 1NFZA 5L3BA 2XVCA 1TT0A 5HS8A 2PNYA 3P5TA 5E3LA 4D0PA 4YEJA 2Z1DA 2XASA 3O6ZA 2O6GE 1Z3XA 5GPCA 2LK2A 3BR6A 3K1NA 2VE8A 4CCOA 3PM1A 2FNPA 4UUVA 1OCCH 1IN6A 2DA1A 4HSTA 4RGUA 4U0VA 1XMXA 3L00A 3HOYJ 5DPKA 3WTVC 2O8KA 4BY1J 2JA6J 3LAJA 2VONA 2F48A 1IUYA 4AIDA 4I76A 4YPRA 5CVVA 4U7DA 1N75A 5AIPA 2D2WA 2YS9A 4NQWB 3P6YA 3TQNA 1X1DA 1WI3A 2VIXA 2UWMA 3EEUA 3VFZA 2O8XA 2L3DA 3CZ6A 1RIOH 3EYYA 1HSJA 3P9IA 3GW2A 1HC8A 1JGSA 2WC2A 1GVDA 2CS3A 4FX4A 2R7OA 1OCTC 1ZQ3P 1TW3A 3S17J 2PI0A 4I2OA 3Q5FA 3PL8A 4KT5C 2R7UA 3NAUA 3OYGA 2H6BA 2UXNA 4G7ZF 2H27A 1HW2A 1W1WE 4Q4ZF 1LDJA 3CP8A 1DU6A 2YPRA 3S8PA 1O57A 3O6BB 3D5RC 3V7RA 2ZXWH 1E2XA 2OTJI 2F5EA 4KIFA 3GFMA 2LDUA 4XK4A 2A05A 3KP2A 3A6TA 5CFIA 1M1EB 3OYEA 5CPRB 3OYIA 3FXKA 3PJRA 1PUQA 5C7QA 1R67A 2CQQA 4N9IA 1KU9A 4DQ2A 5FB2A 4D5CA 1HBXG 2K85A 3LOCA 1EH6A 3GXOA 2KMUA 3HKZN 4XQFA 2WB1N 2ZB9A 2RAEA 2R3SA 1I39A 2KRCA 4YPHA 3JRCA 4KA4A 2Y0MA 2R5YB 1TC3C 1XB4A 5EDNA 3GWYA 4I0AA 3K69A 3BCAA 2H8RA 5EEAA 4HSRA 3HBLA 2F6CA 5TISC 1HX3A 1T56A 3H5AA 4LG0B 2JRMA 1K2EA 1BR4A 3GTQJ 5IYBJ 3H5NA 1IV6A 3S1NJ 3O61A 5CJ9A 3EDPA 2YYHA 3L7WA 1MMDA 3C1DA 1OR7C 2L9RA 4P5OA 4XR6A 2DPDA 1B9MA 5IW4A 2V9PA 3CC4I 3ZN1A 2XRLA 2YR2A 5EZGA 2JTVA 4M9ZA 4IHVA 2VBZA 4MTEA 2E60A 3QWLA 3OYCA 3F0CA 3A0HC 2XAHA 5F0CA 4I7HA 1U3EM 3ZQHA 1MBHA 3IHUA 4C3IJ 4PJLA 2A5WA 1STZA 2BY0A 2XF5A 1O3TA 1FTZA 1OYIA 4A5NA 2JA2A 1NG6A 4IO9F 1NTCA 1XCBA 2MLGA 3GEZA 2MGQA 2NVQJ 4L0YB 1PPVA 2VKEA 2RRKA 1UB9A 2NNYA 4Z2YA 2M7BA 3BG7A 2KHMA 4HX4A 1QQIA 4LLGF 2DBBA 2ZFWA 2XC7A 2QSGX 1X19A 4ANJA 5HOOA 2GLOA 2VC1A 5IT9K 1MQEA 4DW6A 1X51A 3ZQFA 1GT0C 2CUEA 2G9WA 3BJOA 3JRGA 1HW1A 2HDCA 4M6YA 2XIGA 2BE5F 1PUFA 2WV1A 3S3OA 3PFIA 3OYAA 3BR2A 3AG2H 4PSXA 5DCMA 1ETVA 2ZO4A 1RRJA 1YHQI 4OIRF 3HUGA 3ML6A 4ON0A 3OL3A 2E71A 2M4GA 1BW5A 1OCPA 1YS7A 3W2VA 4MEYF 1A6IA 1B59A 1V5GA 3OS2A 4S2XA 1J09A 3FXUA 1SAXA 5IW5A 2NVUB 3PIPF 2TDXA 4E6KG 4C30A 3DUPA 5F04A 5F64A 3ABLH 2YVMA 3K0LA 2L5QA 4ZYEA 3WTWC 3MAJA 2D1HA 4S04A 1KT9A 4A3LJ 1VK6A 5AONA 4C2MJ 1JGGA 3IRQA 2X1EA 1Q33A 3KEOA 1ZK8A 1LVKA 2PQVA 2DMQA 2M9HA 2DOFA 5GHPA 1VZ0A 5F0FA 3RZDJ 4BE2A 3LFUA 2CQKA 2DTZA 3TO7A 3EQLF 2ZFUA 3HKZA 1JKOC 2K9SA 2WB1A 3L9FA 2UUZA 3S1MJ 1RKTA 3A6UA 3C18A 3E97A 2DK8A 4BUPA 1QZEA 4GGGA 4N0BA 1F9NA 1BJAA 2K9NA 3R0JA 2VQHA 1I3AA 1X3UA 2K3FA 2R7XA 4RLQA 4CDGA 2DMNA 2H6CA 1MJ9A 2QLZA 4OIQF 2ECBA 1S7AA 1R4NB 3FKJA 5JHFA 3S1RJ 1J75A 5GTIC 5DYMA 3J7YJ 1JRKA 1R7JA 3RTRA 3DKWA 3ABTA 3W6JB 3BOQA 3OYDA 1I3QJ 3ABUA 2F4OB 2JVGA 4A3FJ 2DA5A 1YLFA 3MMYB 1KYZA 3OMYA 3T5XA 4A3MJ 3V42A 2Y30A 1H88C 3EETA 4NC7A 4IJAA 2XAUA 3PUFA 5E3MA 1YRNA 3CCSI 4EGYA 2H8WA 5F0HA 3IRRA 1XSCA 4EEFG 2YSRA 3HM5A 4XICA 3CDHA 2X6WA 3CMEI 2GOXB 1OYWA 2VJ4A 3M8FA 3KZZA 5E1WA 3GVAA 4KJZA 1R00A 3HXLA 2GQQA 4PJ0C 5ICCA 3IWFA 5K7FA 3OYNA 1R1VA 3BJ6A 1I6HJ 2DI3A 1PVFA 3HB9A 2DA6A 3MDIA 2X4HA 1S9HA 2R7TA 3A02A 1XSAA 2JSPA 3OY9A 2CW0F 2DMUA 2A68F 5BQTA 2QJTA 3J7AO 2HKOA 3F3XA 4AUXA 3WTYC 3MCFA 2OBPA 3CESA 2G7UA 2J8QA 5KK1A 5FKLA 1MGTA 2Y69H 1T8IA 4Q47A 1OQYA 2HXOA 1JUPA 2IW5A 2HVSA 1DPUA 3N97A 4A93J 4XN0A 1FMVA 1A35A 3LA3A 1J0RA 2XAQA 3I0TA 4HOBA 1TQMA 2MH2A 2YUSA 4JX6A 1S29A 1FWZA 2DK5A 4LD5A 5DCMB 1MSEC 2OV7A 3L2QA 5D6EA 1XMKA 5D5VB 2QKLB 3HYIA 3HUGB 1FYMA 1HW5A 1LKXA 1OISA 1KTGA 2BV6A 2X85A 4A3CJ 1ONVA 2HEOA 4MNUA 3FK9A 3TP0A 2OD5A 3FXRA 3LSTA 4ZH4F 1MNMC 2I6KA 3FDYA 2XSQA 5HODA 2GM4A 5K5QA 1REPC 1MBJA 4YELA 4B1RA 1XCVA 1O7FA 1LQ1A 4A0ZA 5E18F 4DYWA 2QSHX 4IZZA 3DEWA 4N9HA 3T1BA 1S72I 3X0OA 1AA7A 4RGSA 1WJFA 4FQGA 3HTSB 1FBQA 5FSIA 3F6AA 4JX5A 2O03A 1Z6RA 4HDVA 3HHJA 3I5UA 3NWTA 2PFBA 3I56I 5DUKA 2ZJ2A 2DDBA 5HS9A 1HCRA 2LP0A 1K79A 1XDSA 1D0YA 5FFZA 4B44A 1OLTA 5CKTA 1TBXA 1TWHJ 3S2WA 4EM1A 2MD5A 3TDUC 5ED4A 4HV5A 1F36A 4HA8A 5DEQA 4UVBA 1JKNA 2CUFA 1X4OA 2KKOA 2LBFB 3HOTA 3BG9A 4EGZA 1ZH5A 2L9NA 3VSKA 3CLQA 2LRDA 3DU5A 5HNFA 3A01A 2L54A 1IO2A 3RZOJ 2EJRA 4M6VA 1UAAA 1UG2A 5H6QA 1SD6A 3MZ8A 3CNGA 3VEPA 3F6VA 1Y39A 1GUUA 2D5VA 2VNQA 1W36D 1CQTA 1WHUA 5HDGA 3FBNB 5GHQA 4GCVA 3IC7A 1ETQA 4I98B 1N77A 3Q2TA 3OS0A 1G0SA 4Z6YA 4P9UA 5J40A 2EZLA 1KGSA 2FBKA 2HPMA 3L2WA 3R4KA 4LJZF 1EKEA 5DV5A 3JTGA 1Y1WJ 4OOIA 3CJRB 3P7NA 3R0AA 2ZXHA 3WGHA 4DGWB 3QPHA 4P1WA 4UY8I 1YRNB 2Z2SB 5FSOA 2K4BA 2ZMEA 5A2QZ 2DJNA 3FHNA 1BIBA 1D1CA 1WWXA 2LH9A 4IRGA 2OJED 1FSHA 4BDZA 1J5YA 1HDPA 3H3UA 4KMFA 4BJ6C 1XX5A 4Y3OA 1F4KA 2IGOA 1R1TA 3ONQA 2LY2A 1IAWA 3M7GA 3DBRB 3F72A 4D9JA 1LFUP 5FD6A 5F1JA 3MN2A 3WU2C 5LHHA 2KL4A 4M3BA 3GTMJ 3O8HA 1ZRCA 1BIAA 3G4SI 4TV7A 1C0WA 5E3OA 1PYVA 3BROA 1Q1VA 3HOXJ 3PQJA 3GBGA 2B7EA 5FLXZ 2O61A 3TW6A 2IRFG 2FU4A 2EB7A 2L7ZA 2QCOA 3H0GJ 1B4AA 1LEBA 2O5FA 3H9QA 3IP4B 3WTSC 1WJCA 1CGPA 1FJLA 1OMIA 2DOAA 4DYRA 1Z7LA 4J7HA 5LRRA 1B9NA 2ADUA 5KAIC 1HOMA 3RH7A 1ZYRF 3SDGA 5BOXA 2GXBA 2EIJH 2R7QA 1KQ8A
chains in the Genus database with same CATH topology
1V5FA 2IS2A 2ZXIA 4N4NB 1VHZA 3EUKL 1MMGA 4U7BA 2CUZA 3I9XA 3LMMA 3LSIA 2G74A 4PK4A 3KYLA 5FRMA 2A8PA 2X6YA 5BS6A 1WFXA 3HC7A 3OYLA 2CUJA 2CW7A 3OR1C 3ZCOA 4BACA 4C2TA 2KDVA 2YVNA 1RRQA 2WAQA 1V8LA 5KHDA 2FMLA 3BG6A 1EA3A 2VB6A 4PJNA 2CH0A 2R4GA 3LSKA 1D1AA 4KTBA 1YX5A 3QYFA 2JVBA 2O5RA 1MMAA 1E0EA 4XLEA 2DT6A 3ZQQA 3MKZA 1SZ3A 1VC8A 5ANTA 1PUSA 4HVYA 3GG6A 3PUBA 1W36C 4F52A 3U53A 4C9XA 3W2AA 4BDYA 2LYCA 4KT6A 3F9KA 4BEHA 2F4IA 2HNHA 2GT4A 2ICJA 1NFZA 3P5TA 1TT0A 1Z3YA 4PJJA 3VYSB 2PNYA 3OYBA 4YEJA 2Z1DA 1ERDA 3O6ZA 1Z3XA 1PPXA 3OYHA 3SONA 4CCOA 1R6RA 4HSTA 5DPKA 4HPQA 2DSDA 1VHGA 2M0MA 4AVZA 2VASA 3SEQA 3HOSA 1MUTA 2PMZA 2VXZA 4BQNA 2IXSA 3FBIB 1MR2A 4XLCA 4YPRA 1MMNA 2A8TA 1N75A 3HG9A 4J01A 2R7WA 3K10A 3IUOA 4NQWB 1T0FC 3P6YA 1X1CA 4MPOA 1X1DA 2LREA 3DPLC 3LSHA 4F3QA 4C2UA 2HVQA 2VIXA 5CFJA 3OOUA 2UWMA 3K70D 3EEUA 4F92B 4N1UA 1DGWY 1I9AA 3OIQA 3CZ6A 3N05A 4Y33A 1X84A 2DSCA 3VYUB 4CA0A 4E7KA 3I9V2 3BAPA 3PSIA 4ZDOA 2VQLA 3TMOA 5ANWA 2VJ5A 3HYQA 2CS3A 4JZVA 2R7OA 4ZJZA 3GZ8A 5FSLA 4IX7A 5TGTA 3QODA 4PFPA 1GA7A 3PL8A 2BW3B 2R7UA 2KDWA 3OYGA 4V14A 2CV0A 1V8UA 5FSKA 4RM3A 3VWBA 2XSJC 1X4PA 2NOJB 3CP8A 2DSBA 2W4EA 3S8PA 2B0VA 4ZDLA 3D5RC 2IGKA 4ZDPA 2LBFA 1VIUA 3BM4A 4CCKA 2M3AA 3D5LA 3BLYA 4C9YA 1G59A 3A6TA 5CFIA 3X0JA 1IRYA 3OYEA 1JI8A 5CPRB 3OYIA 3PJRA 1PUQA 5C7QA 1R67A 4XNFA 5CQEA 2MD0A 1HA8A 4N1TA 3ID9A 4D1QA 3UNGC 2CFOA 2LOOA 2KMUA 4DIQA 1V8RA 1XSBA 5LFAA 4KISA 4XQFA 3BCBA 4HRIA 3EESA 1LDKB 2G73A 5LPGA 3S32A 3K4CA 4NFXA 2DHOA 2KRCA 4YPHA 4KITB 4Y4RA 4XKWA 2W00A 2E5NA 4XLFA 2PJRB 3CJQB 3DWLE 4QPQA 3GWYA 1ZELA 2GOMA 4BQQA 2VQCA 5ANVA 3BCAA 2F5VA 2WAEA 3L2UA 3K4JA 3COUA 4HSRA 4PUSA 1SAUA 2F6CA 3TBIA 1HX3A 2I8TA 2E5ZA 3D5SC 1V8WA 5I8UA 3H5AA 3AL0B 1BR4A 1K2EA 3H5NA 2L2OA 4ZYAA 4EATA 3O61A 2YYHA 4XLAA 3SMDA 1MMDA 4CCLA 1KHZA 1OR7C 4P5OA 4XR6A 2RNGA 2KDOA 5IW4A 2IGNA 5CQGA 3RCOA 3DTEA 3EPZA 4BU2A 3Q1PA 5GHIA 2VL8A 1VCDA 3Q93A 3H5RA 3KVHA 4HNTA 2E60A 3OYCA 4J00A 2ELJA 3S3MA 2DUKA 3QYBA 5C8LA 3H35A 4BQOA 3K70C 4JZUA 1DGRM 1WJ5A 3FSPA 4PJLA 2AZWA 3EUAA 2A5WA 1MW7A 2BOLA 2KQRA 3N9UA 2XF5A 1D0ZA 2M7AA 1WJBA 4AU7A 4BL0B 2DXIA 4LG3A 3VYRB 2JA2A 1NG6A 1VC9A 2CV2A 2VPLA 2IS4A 1PPVA 2RRKA 4RMNA 1X1AA 3AC9A 2M7BA 3BG7A 2KHMA 4BEHB 2XC7A 4F93B 3AL0C 1X19A 4ANJA 2QKMB 3DPTA 5HOOA 2GT2A 5HLTA 3N77A 5GHNA 3X0RA 3OL4A 3M1CA 1MQEA 4B47A 1X51A 2O1CA 4NFWA 3IAS2 3L85A 4H4KC 5HZXA 3O52A 4CZCA 3PNYA 3OS1A 5ANUA 3S3OA 4DBRA 3MDGA 2K9MA 2Z16A 3OYAA 1PUNA 3OYJA 4PSXA 2Y0SA 2UV1A 2CV1A 2DCEA 2IS6A 1Z21A 3X0PA 2WAFA 3C2HA 2QJOA 5ANSA 4E7JA 2L9SA 3LL7A 4E7IA 2XF6A 4X0GA 3OL3A 3J7AY 2M4GA 1NQYA 1WJDA 4OAZA 2Q9PA 1MNDA 2HU9A 3W2VA 3L2VA 2GB5A 3QSJA 3O69A 3OS2A 2VQGA 1V5GA 4S2XA 1J09A 2MYSA 3OGAA 2VJJA 4ICKA 4ILQA 3Q2SA 1SOIA 5IW5A 3AKZA 2WA0A 4E6KG 4C30A 2VJIA 3DUPA 4BXFA 1VRLA 1V8IA 3MD2A 3SEZA 3EUHC 1NG7A 4XONA 3VYTB 2YVMA 3X0QA 2L5QA 3DTIA 2HQAA 2X1CA 3DKYA 2V1NA 2BVLA 3DTKA 4XORA 1PJRA 3RSNA 3SZGA 3LSMA 3ZR8X 3ACAA 3F13A 3Q91A 2JVHA 3QYEA 2V6EA 1KT9A 5GHOA 1VK6A 2LY1A 4G6TB 4PJMA 1QU3A 2X1EA 1IRXA 1Q33A 3I7UA 1LVKA 2PQVA 3EF5A 4LITA 2K3PA 3HPGA 3VSLA 5GHPA 4S2WA 1VZ0A 3PNVA 3RQ4A 3W2WA 4BE2A 3LFUA 5FSNA 4E7SA 3OYKA 3HKZA 2ZFUA 4IQ4A 3MKWB 3R03A 2WB1A 2UUZA 3A6UA 4BS9A 4ZTFA 1D0XA 4BUPA 3X0NA 3X0LA 4C9WA 1SFKA 4K6EA 3CF2A 2X6XA 4E7LA 4S2VA 1F3YA 1KONA 3ZGKA 4PFOA 2VQHA 3ZRGA 2R7XA 4RLQA 2V7FA 3K6GA 3K4NA 2JUGA 2Q2EB 3PNTA 3ZXSA 3MGMA 2FUG2 4RM2A 3FKJA 5JHFA 2OC6A 1V8NA 2W7NA 1JRKA 5DDGA 3RTRA 4KYXA 2V4JC 1X1BA 3E0JB 3OYDA 3BHOA 2JVGA 2W4SA 4OAYA 4CSWA 3MMYB 3OMYA 3W3CA 4PSWA 1V8YA 2FVVA 2O5WA 2WBMA 4J7GA 3V42A 2P0WA 3VDXA 4NC7A 3EXQA 4DJAA 4F91B 5KNLA 3X0SA 3HPHA 2MFZA 2XAUA 2R5WA 5GHJA 4FETA 1TUMA 1OW2A 2MC4A 2VNPA 3A6SA 1XSCA 4DOZA 2M4KA 4E4HA 2X6WA 4JOMA 2GOXB 3G0QA 2B06A 1DQUA 3L2RA 2VJ4A 3SYTA 3UR3C 3I3LA 1V8MA 2X51A 1NFSA 4XMYA 3H95A 4KJZA 5FSMA 3HXLA 4YOQA 1K6YA 1PVFA 3OYNA 3A6VA 4BJTA 2RREA 3MDIA 3DQVC 3U21A 1SU2A 3FFUA 1S9HA 3K4KA 2R7TA 4ZTJA 2BVMA 1T95A 1XSAA 2JSPA 3OY9A 4IJXA 2ZSIB 5FROA 4FASD 4B43A 3RPUD 2QJTA 4BE0A 3MCFA 5HNHA 3ZR1A 1P9QC 5ISYA 1WJAA 3CESA 3LSGA 1HZTA 2HDWA 2K9LA 2J8QA 4F55A 4ZG0A 2LC2A 2HVSA 2YVOA 2KLOA 4JQFA 2VKHA 4XL9A 2IS1A 4KG3A 1MQWA 2RQQA 4XN0A 4HNUA 4XN3A 1FMVA 3GRNA 2DJIA 5KCMA 2L7KA 2VLAA 2VXDA 3GZ6A 3E1SA 3DEEA 2R7VA 3X0MA 4HFQA 3DPUA 1TZLA 4LIUA 3PSFA 1SJYA 2OV7A 3L2QA 3PFYA 4IQJA 2R7SA 2QKLB 1QHHD 3HUGB 1KTGA 1LKXA 4B48A 3CMMA 1UELB 4U87A 1V8TA 2X85A 3ZR0A 2XDVA 3DLAA 4B3XA 3MKYB 1Q27A 3TL4X 3C2GA 3M8JA 4XKBA 3OYMA 2A8RA 3FK9A 2WY8Q 3KX2A 4CCJA 2I6KA 3FDYA 5C7TA 3OIPA 2XSQA 2W82A 4N4OB 2AQFA 4YELA 2IGMA 2DT7B 4DYWA 3H9GA 4IZZA 3FJYA 4OWRB 1BOBA 3X0OA 1AA7A 4GRIA 1WJFA 4R79A 3X0KA 5FSIA 3F6AA 1G8XA 2WY7Q 1UG0A 1QHGA 4E7HA 2B2KA 1V5EA 3G2BA 3O8SA 3HHJA 1V8VA 3NWTA 4NNJA 3A2KA 2HZDA 3H9JA 3BC8A 3SHDA 3OYFA 1D0YA 1PPWA 2HVRA 3NWSA 4XOTA 4II2A 4B44A 4CH7A 3H0DA 2ICKA 1OLTA 1Y6IA 5CKTA 1FMWA 4JZSA 4MLOA 1VIQA 3K4BA 1YE9A 5BONA 5DEQA 1YX3A 4S2YA 1JKNA 1X4OA 2LBFB 4YRVA 3SDBA 3HOTA 1U20A 2A8SA 1QVJA 2L9NA 2VKDA 3VSKA 2I8UA 2ZSHB 2LRDA 2A6TA 3DU5A 3IAM2 5HNFA 2XF7A 1UAAA 3DKUA 3K4LA 1Q54A 1D1BA 2E1MB 2FKBA 1V8SA 4RLFA 3CNGA 4II3A 3OWTA 1G9QA 2HPIA 4XLHA 4XM3A 3FCMA 2VNQA 1W36D 4IKFA 3E57A 3FBNB 3K4MA 4NC8A 1N77A 5GHQA 4XKVA 2R7RA 2CZRA 3Q2TA 3OS0A 1G0SA 1RRSA 3CP2A 3GZ5A 1BR2A 3S3NA 1N78A 4LIVA 2HPMA 2BW3A 2CL3A 4KG4A 4NUBA 3L2WA 5HVQC 4QPOA 4CCNA 2YVPA 3CJRB 1BR1A 2ZXHA 4DGWB 4P1WA 2Z2SB 2A8QA 5FSOA 3FHNA 4HG2A 1D1CA 2LH9A 1K26A 3Q4IA 3A1YA 4BDZA 1MNEA 4ZC3A 4Y3OA 4AYBA 4BJ6C 1MP2A 2LG4A 1DP3A 1MK1A 2IGOA 2Q1ZB 3ONQA 1X83A 2CW8A 2LY2A 4JZTA 5GHMA 2V9KA 1U0JA 3AFHA 3KEYA 4D9JA 2AQEA 2E1MC 4ITVA 5LD2C 4CUGA 2KL4A 3OR2C 1RYAA 4DBQA 3S93A 4BJ5C 1PYVA 4XOPA 2K5CA 2PJRA 3GBGA 2KPMA 1WJEA 1LFPA 1Y56A 2X1DA 2KRHA 3A4CA 5DD4A 2KZVA 2I8DA 4BGDA 4HEA2 2O5FA 3WHWA 2OUMA 3H9QA 4XKCA 5FRNA 3IP4B 3HL2A 1NQZA 3I7VA 4CCMA 1WJCA 2W1OA 3X0IA 2DOAA 1Z7LA 2V26A 4J7HA 2WADA 3RH7A 3J7Ye 1GLNA 3QOEA 2CMPA 3DU6A 2MABA 4E7ZA 2R7QA 3DKXA 2KP6A 4BE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C7T A;  2XSQ A;  2PQV A;  3EF5 A;  4NFX A;  2DHO A;  1VHZ A;  4YPH A;  5GHP A;  4S2W A;  3I9X A;  5FSN A;  2G74 A;  4DYW A;  5BS6 A;  2A8P A;  3GWY A;  3FJY A;  3R03 A;  5ANV A;  3X0O A;  2YVN A;  3A6U A;  2KDV A;  3X0K A;  5FSI A;  3X0N A;  1V8L A;  3F6A A;  3X0L A;  3COU A;  1RRQ A;  2FML A;  4C9W A;  4K6E A;  3O8S A;  2B2K A;  4S2V A;  1HX3 A;  2I8T A;  3HHJ A;  1V8V A;  3I7U A;  1F3Y A;  4KTB A;  1V8W A;  5I8U A;  1K2E A;  2JVB A;  3MGM A;  3SHD A;  1PPW A;  2ICK A;  3O61 A;  1V8N A;  1SZ3 A;  2YYH A;  1VC8 A;  5ANT A;  1PUS A;  3SMD A;  4HVY A;  3GG6 A;  1JRK A;  1KHZ A;  5DDG A;  4KYX A;  3U53 A;  4C9X A;  4JZS A;  5IW4 A;  1VIQ A;  5BON A;  3Q1P A;  5DEQ A;  5GHI A;  4S2Y A;  1VCD A;  3Q93 A;  1JKN A;  2FVV A;  2A8S A;  1U20 A;  1V8Y A;  2GT4 A;  1QVJ A;  1NFZ A;  2ICJ A;  2O5W A;  2PNY A;  3KVH A;  3P5T A;  3EXQ A;  2I8U A;  2DUK A;  3X0S A;  2A6T A;  3O6Z A;  5C8L A;  4JZU A;  2R5W A;  3DKU A;  5GHJ A;  1PPX A;  3FSP A;  1TUM A;  1Q54 A;  1OW2 A;  2VNP A;  3A6S A;  3SON A;  2AZW A;  1V8S A;  2FKB A;  1XSC A;  3CNG A;  1G9Q A;  3N9U A;  2DSD A;  5DPK A;  1VHG A;  3FCM A;  2VNQ A;  1MUT A;  3E57 A;  5GHQ A;  3G0Q A;  2B06 A;  1MR2 A;  1VC9 A;  4YPR A;  1V8M A;  2A8T A;  3Q2T A;  1G0S A;  1RRS A;  1NFS A;  5LPG A;  1PPV A;  2RRK A;  3GZ5 A;  3H95 A;  5FSM A;  3AC9 A;  2CL3 A;  4YOQ A;  1PVF A;  4KG4 A;  3A6V A;  4MPO A;  3P6Y A;  3X0R A;  2QKM B;  2GT2 A;  3N77 A;  5CFJ A;  5GHN A;  3EEU A;  3MDI A;  2YVP A;  4N1U A;  1MQE A;  1X51 A;  2O1C A;  1SU2 A;  1I9A A;  3FFU A;  4NFW A;  3L85 A;  5HZX A;  3O52 A;  1X84 A;  2A8Q A;  1XSA A;  5ANU A;  5FSO A;  4IJX A;  3Q4I A;  2DSC A;  1K26 A;  3MDG A;  2QJT A;  1PUN A;  3BAP A;  5ANW A;  1MP2 A;  3X0P A;  3MCF A;  3ZR1 A;  5ISY A;  3HYQ A;  2QJO A;  1MK1 A;  5ANS A;  4JZV A;  1X83 A;  1HZT A;  3GZ8 A;  5FSL A;  4JZT A;  5GHM A;  2J8Q A;  1NQY A;  4ZG0 A;  1GA7 A;  2KDW A;  2Q9P A;  2YVO A;  4V14 A;  1V8U A;  5FSK A;  4KG3 A;  1MQW A;  1RYA A;  2GB5 A;  3QSJ A;  3O69 A;  4S2X A;  3GRN A;  2W4E A;  2DSB A;  2B0V A;  1VIU A;  3OGA A;  4ICK A;  3Q2S A;  1SOI A;  3BM4 A;  4ILQ A;  5DD4 A;  5IW5 A;  3GZ6 A;  3DUP A;  1VRL A;  3X0M A;  1V8I A;  2O5F A;  3A6T A;  4HFQ A;  3WHW A;  3X0J A;  5CFI A;  1IRY A;  1PUQ A;  1NQZ A;  1R67 A;  1SJY A;  2YVM A;  3I7V A;  3X0Q A;  5C7Q A;  3X0I A;  4N1T A;  3ACA A;  3ID9 A;  1KTG A;  2QKL B;  1V8T A;  3F13 A;  3Q91 A;  3RH7 A;  3J7Y e;  3ZR0 A;  1KT9 A;  1XSB A;  1Q27 A;  1V8R A;  1VK6 A;  2A8R A;  3FK9 A;  5GHO A;  3BHO A;  3EES A;  2I6K A;  1Q33 A;  2G73 A; 
#chains in the Genus database with same CATH topology
 5DS9 A;  5M5X J;  1EV7 A;  1QA6 A;  1WH7 A;  1H9G A;  4U7B A;  3RDI A;  4A69 C;  1O3Q A;  1NHA A;  1T39 A;  4DYQ A;  4AC0 A;  4HW0 A;  2VT3 A;  2A8P A;  3CC2 I;  2JA7 J;  2HZT A;  1FTT A;  1PUE E;  4BAC A;  4BQA A;  3I54 A;  2Z3Y A;  5KHD A;  4G6D A;  3TDZ C;  1EA3 A;  3BP8 A;  1MBE A;  4BXU A;  2VB6 A;  3ESW B;  1FYL A;  2R4G A;  4KTB A;  5EGO A;  1P7I A;  2VKV A;  3TOA A;  2ESN A;  4LFU A;  2W25 A;  3ZQQ A;  1R4M B;  5K1Y A;  1VC8 A;  2HYJ A;  3M07 A;  4NC6 A;  3PUB A;  5L3D A;  4F52 A;  4C9X A;  2F5F A;  5J6X A;  3Q9V A;  4BY7 J;  2QQB A;  1I1G A;  5IOY A;  3CQZ J;  2CQX A;  2M8G X;  1Z3Y A;  2FF4 A;  2BBY A;  1QPM A;  3ZMU A;  1ERD A;  4JYK A;  2BGC A;  4ZYG A;  3HDD A;  5L3C A;  3ERE D;  1T38 A;  4S0H B;  3TKY A;  3H3Z A;  2M0M A;  4AVZ A;  2A6E F;  2FSW A;  1H89 C;  3RKW A;  2IAI A;  3LSP A;  3HOS A;  1WSU A;  2PMZ A;  4BQN A;  1MUT A;  4FE4 A;  2IXS A;  3FBI B;  1MR2 A;  3VOE A;  3HG9 A;  3QPS A;  4A6E A;  2QA4 I;  2GWR A;  4WXH A;  3K10 A;  1AWC A;  1Z7U A;  4MPO A;  1NK2 P;  3LSH A;  5LBQ A;  3RKQ A;  2K7L A;  5CFJ A;  2HTS A;  2LF8 A;  3I71 A;  4F92 B;  4N1U A;  2DA7 A;  3OIQ A;  3A01 B;  3N05 A;  4XRS G;  1B72 A;  2Z9O A;  2XRO A;  1X84 A;  1B6A A;  4Q48 A;  3ZMD A;  5D4S A;  2ZCW A;  5TRD A;  5HLI A;  5ANW A;  2VQL A;  2HYG D;  2NAZ A;  2QUF A;  4NBQ A;  1B8I A;  1I27 A;  2VJ5 A;  4XID A;  3GZ8 A;  3LSR A;  3HOZ J;  1EJ9 A;  3GFI A;  5TGT A;  3QOD A;  1FOX A;  1WRJ A;  2KIQ A;  2KDW A;  4CXF A;  4V14 A;  2ISY A;  2CV0 A;  3E6M A;  1RR7 A;  2WV0 A;  2XSJ C;  1UST A;  3F8M A;  2OCC H;  2W4E A;  1X1P A;  1ZGW A;  4LOC A;  4V2F A;  4ZYH A;  3RPQ A;  3ZMV A;  2ZME B;  1XSX A;  2EFO A;  1AU7 A;  3BLY A;  3N4M A;  2P5V A;  3X0J A;  1KYW A;  3M4O J;  3W6K B;  1YIO A;  4UVA A;  5CQE A;  5AIQ A;  2MD0 A;  4I01 A;  1W0T A;  2K9Q A;  4IEJ A;  2E2H J;  3UNG C;  2CFO A;  1OR7 A;  3C2B A;  5EEG A;  1IC8 A;  5LFA A;  2LNB A;  3MZY A;  4LK0 F;  2XAF A;  4WF2 A;  5F08 A;  4HRI A;  5LPG A;  2G73 A;  5C4X J;  1XGS A;  2FXA A;  2M2E A;  4G6Q A;  4Y4R A;  3SXY A;  3QP6 A;  1ZEL A;  5B1A H;  1OCR H;  2VQC A;  1K78 B;  2B63 J;  3L2U A;  4H0E A;  3ECO A;  5EF6 A;  4PUS A;  4IHY A;  2Z33 A;  3ULQ B;  3FMS A;  3AG3 H;  2E5Z A;  2HOA A;  3D5S C;  5I8U A;  1ON2 A;  2ZME C;  5IYC J;  1NK3 P;  1OCZ H;  3CUO A;  2VE9 A;  4RGR A;  4ZYA A;  1TNT A;  1Y8R B;  1VQP I;  3PIO F;  1TQP A;  2KDO A;  3KE2 A;  2IGN A;  3RCO A;  3BZK A;  4D5F A;  2XB0 X;  5GAH J;  1FIA A;  2VL8 A;  3B73 A;  3E3V A;  5ILU A;  2Y48 A;  2KIS A;  3H5R A;  2LKX A;  2PN6 A;  4RS8 A;  1VQO I;  3QYB A;  3E5U A;  2AXL A;  2M45 A;  5EGO B;  2AZW A;  1TWF J;  3EUA A;  2EIK H;  1D0Z A;  1W5C C;  4YG2 F;  2FA5 A;  4BL0 B;  3F23 A;  5LHI A;  3BTJ A;  5DM6 F;  3DCF A;  1KU2 A;  2CV2 A;  1VQN I;  2Q8K A;  2VPL A;  3IV5 A;  2IS4 A;  1X1A A;  3AC9 A;  2E34 A;  4XSX F;  3X0R A;  4KMU X;  3GO5 A;  4AWX B;  5DM7 F;  1JKQ C;  2CQ7 A;  2OU2 A;  1X58 A;  3PNY A;  5E17 F;  2JA5 J;  1XD7 A;  1U6G A;  2HOE A;  2ZJR F;  3SFI A;  1FZP B;  2GBY A;  2B0L A;  2XGC A;  5H6R A;  2UV1 A;  2CV1 A;  4V19 K;  2VOO A;  1Z21 A;  3X0P A;  2WAF A;  4HV6 A;  5JI6 A;  3LL7 A;  3MKL A;  3DFG A;  1ZRD A;  2OAZ A;  1SFX A;  4BAY A;  1N25 A;  1P4W A;  3WTU C;  4A3I J;  1Z05 A;  1MND A;  1SVO A;  2FJ1 A;  2HU9 A;  4JP0 A;  2GB5 A;  3QSJ A;  2VQG A;  2BYV E;  2RGV A;  2NVT J;  2MYS A;  4YFK F;  4ICK A;  4DZP A;  1ZG3 A;  2VJI A;  2JZY A;  2K86 A;  4EV0 A;  5E8G A;  1VRL A;  4M6X A;  3FMQ A;  4IHW A;  4XON A;  1XSV A;  3DTI A;  2HQA A;  2X1C A;  3ZR8 X;  2V1N A;  2BVL A;  3TOB A;  3F13 A;  1PJR A;  1XSD A;  1OJL A;  2KJC A;  2V6E A;  4M3F A;  1Z1D A;  3MCZ A;  3S1Q J;  1QU3 A;  2KFD A;  1G3T A;  3CJN A;  3QU6 A;  1VQ4 I;  2V1U A;  1F43 A;  3G71 I;  3X2Q H;  4AIJ A;  1LNW A;  2RVC A;  3HPG A;  3VSL A;  2UZK A;  3W2W A;  3CUQ A;  3I59 A;  4E7S A;  2CSO A;  2ZJP F;  2GA2 A;  2I5U A;  5IT3 A;  4IOA F;  1P2F A;  3X0N A;  4L9V A;  1OKR A;  1FT9 A;  1F5T A;  3JSO A;  4K6E A;  4HYE A;  4BNC A;  4KDP A;  1KON A;  4M9X A;  1PP8 F;  1HDD C;  3BPV A;  3K4N A;  1TWG J;  3ZXS A;  3MGM A;  2UXX A;  4GXO A;  2XGX A;  4BHB A;  3F8N A;  2V4J C;  4NDL A;  3I53 A;  1TW2 A;  2DA4 A;  5GPA A;  1WQ2 A;  4HBL A;  4A2U A;  3FHZ A;  4CSW A;  3QRF F;  4PSW A;  1ETW A;  3QPL A;  4J7G A;  3TED A;  2KIF A;  3EXQ A;  3V8K A;  4DJA A;  3HPH A;  2MFZ A;  1MDM A;  2EZI A;  1G6N A;  1WVR A;  1TUM A;  3A6S A;  1YQA A;  1S6L A;  1MIJ A;  4EVI A;  1BBY A;  4EMS A;  2LD5 A;  1OCO H;  3SYT A;  1V8M A;  2RNJ A;  1A36 A;  3CO7 C;  3NRV A;  3H95 A;  3BR0 A;  1RPW A;  1YTY A;  4YOQ A;  4M9S A;  3M9A A;  5FJ8 J;  4BJT A;  2RRE A;  3C7J A;  4KUM A;  4UXN A;  5B3S H;  2P5L C;  1OYY A;  1GXQ A;  2XB5 A;  4UVC A;  3MZH A;  3DQV C;  1W5T A;  5LGU A;  1SU2 A;  4RAG A;  2BVM A;  2MH9 A;  2Y9Y A;  2DMP A;  4FAS D;  2JSC A;  2WWY A;  3CCM I;  2PEX A;  1IXR C;  4BE0 A;  2H09 A;  1VQ6 I;  1P9Q C;  2IA0 A;  1JT6 A;  1WJA A;  3ZR1 A;  5L3F A;  1TT5 B;  1ZGJ A;  5FKK A;  4CO8 A;  1IRZ A;  3JAM Z;  2K9L A;  4IL6 C;  3HGG A;  4F55 A;  2LC2 A;  3FXM A;  2QGU A;  4RA2 A;  3ZMZ A;  4KG3 A;  3KZI C;  1MQW A;  4IF4 A;  4Y15 A;  1ZR2 A;  4XN3 A;  1ZRE A;  3GRN A;  2COM A;  2DJI A;  4R1H A;  4M74 A;  2ISZ A;  2VT2 A;  2L7K A;  3GX4 X;  1H8A C;  2VLA A;  1BC8 C;  4GFB A;  1Y1V J;  3KLN A;  3X0M A;  2B9S A;  2H1L A;  3DPU A;  3RYR A;  2YX7 A;  4UHT A;  3B6C A;  3I58 A;  3PSF A;  1ETY A;  2R7S A;  2I10 A;  3G6E I;  4B48 A;  4RB2 C;  2ECC A;  4B8X A;  2XDV A;  1R58 A;  2A8R A;  4XKB A;  2XKO A;  1QZY A;  2WY8 Q;  4ENM A;  3P9C A;  2JJ7 A;  5C7T A;  3GYH X;  3FK6 A;  5J8C A;  4RB0 A;  4KFC A;  2IGM A;  5FKO A;  4JK1 X;  4L9T A;  1MBF A;  1O7L A;  1QBJ A;  2HKX A;  2KJB A;  1YIT I;  4R79 A;  1A5J A;  2EFN A;  2XPV A;  2Y2Z A;  3HZJ A;  3DBL B;  5CLS A;  4E7H A;  3O8S A;  2V6C A;  2LFB A;  3S2D J;  2GAU A;  3A2K A;  2P4W A;  3BTC A;  5FKM A;  2LLK A;  3U2R A;  1BM9 A;  2EH3 A;  1PPW A;  2ICK A;  3NWS A;  3WOD F;  4PCQ A;  4C3H J;  2XHK A;  3CUQ B;  3I59 B;  1FMW A;  4JZS A;  1QVU A;  4LK1 F;  4XLP F;  2XUB A;  3PO2 J;  3GUD A;  4AM3 A;  4BXX J;  1VIQ A;  1YE9 A;  1S5L C;  2A3S A;  1YI2 I;  2A8S A;  5LEK A;  4XBF A;  1QVJ A;  3K1M A;  4FX0 A;  3WHB A;  2ZSH B;  2K02 A;  5IP9 J;  4XRS A;  3K4L A;  1V3F A;  1XG1 A;  1Q54 A;  2FKB A;  4OMZ A;  4II3 A;  3OWT A;  4U0W A;  3ELK A;  4XLH A;  5J4Y A;  5M5Y J;  3FCM A;  1WI9 A;  3K4M A;  1JXS A;  1O4X A;  4XKV A;  2AO9 A;  4M73 A;  1ODD A;  1U8B A;  3HGY A;  3GZ5 A;  1BR2 A;  2IT0 A;  1J9I A;  3ASO H;  4FE7 A;  4FHT A;  5FKN A;  1VF9 A;  3QPT A;  2NS7 A;  1L3L A;  3I4M J;  4MTD A;  1QO0 D;  2QEX I;  1BR1 A;  3HRS A;  1S3J A;  2DA2 A;  5DUI A;  5E3N A;  1MDM B;  3CUQ C;  3Q0U A;  1K7A A;  2A8Q A;  2L4A A;  1X2M A;  3M1E A;  1MNE A;  4Y7N J;  3HSF A;  3G73 A;  3E5X A;  2LSO A;  2LG4 A;  2A61 A;  4UUT A;  1MK1 A;  2Q1Z B;  2CW8 A;  4PZJ A;  3M8E A;  3OV8 A;  2V9K A;  3AFH A;  2JPC A;  2AQE A;  1D3Y A;  2P5K A;  5J1U A;  3BJA A;  3MWM A;  2GXA A;  4DBQ A;  4MQV A;  1SD4 A;  1Z91 A;  1PVE A;  4XOP A;  2HQ5 A;  2KPM A;  1WJE A;  1WGX A;  5DD4 A;  3A4C A;  3CCQ I;  3T8R A;  5HDK A;  4BGD A;  2O0Y A;  1TWC J;  3FXO A;  3X0I A;  2DT5 A;  1V4R A;  3KP6 A;  4YFN F;  1AKH A;  3BPX A;  2P8T A;  1EH7 A;  5K7H A;  1K6O A;  2IS2 A;  2ZXI A;  4EM2 A;  1I5Z A;  5E8I A;  1BOA A;  1U78 A;  3KYL A;  1WFX A;  4CYC A;  3OYL A;  5EZH A;  4BHC A;  3OR1 C;  1BI0 A;  1PUF B;  2KDV A;  1JUS A;  5IYD J;  1MSF C;  3BG6 A;  5ICG A;  4R8H A;  3LNQ A;  4L5J A;  1YJW I;  2RN7 A;  3LSK A;  1D1A A;  1YX5 A;  3HOW J;  1HLV A;  2JVB A;  2CFX A;  3WE2 A;  2HXI A;  4XLE A;  2EK5 A;  3MKZ A;  3S16 J;  4HVY A;  5K7Z A;  2P7C B;  5EG0 A;  1H9T A;  2XAG A;  4M71 A;  1BI1 A;  5D8K B;  2VBY A;  3DXJ F;  4EJW A;  2RC4 A;  1MJA A;  1YS6 A;  3F9K A;  1GV2 A;  3EUH A;  3G3Z A;  5LEJ A;  2LMD A;  3CCL I;  3TO6 A;  5CVJ A;  5FLM J;  4KNY A;  3CC7 I;  1P4A A;  4PJJ A;  1A6Q A;  3VYS B;  2V9V A;  3K2Z A;  3OYB A;  3DV8 A;  1QRY A;  3C3W A;  1PPX A;  5CYV A;  3OYH A;  4MFD A;  5E20 A;  5A2Q K;  1VHG A;  1POG A;  3SEQ A;  2QM3 A;  4RDU A;  4AIK A;  2HFH A;  4XLC A;  1MMN A;  2A8T A;  1RI7 A;  2KIU A;  2GIV A;  4J01 A;  1UMQ A;  2R7W A;  2NYX A;  4D7M A;  2R93 J;  4HAM A;  3LFK A;  3DPL C;  1S7O A;  4C2U A;  2HVQ A;  3OOU A;  2Y0S N;  1ZLK A;  1DGW Y;  1IV8 A;  1I9A A;  2M34 A;  1HQC A;  1SAN A;  2DOE A;  2EIM H;  2ME6 A;  5JFR A;  2PMZ N;  5FLX K;  2DSC A;  2EFP A;  1I6X A;  4E7K A;  2HWV A;  3I9V 2;  1E3H A;  3BAP A;  3PSI A;  4ZDO A;  3TMO A;  4HDU A;  3GME A;  3HYQ A;  4JZV A;  4ZJZ A;  3J80 Z;  4IX7 A;  4X6A J;  4PFP A;  3ASN H;  1GA7 A;  4WXD A;  1TNS A;  2KIM A;  1VQ8 I;  4EJV A;  1V8U A;  1U9O A;  3MFK A;  5FSK A;  1X4P A;  2OPT A;  3H3V K;  4ZDL A;  2IGK A;  3GTK J;  1VIU A;  1B1B A;  3HRT A;  5LGT A;  4CCK A;  3BM4 A;  2EV0 A;  1Y0N A;  4C9Y A;  3Q9S A;  1G59 A;  3EYI A;  2NNN A;  2IPQ X;  3SQN A;  2E1C A;  1GDT A;  4X1E A;  1RUO A;  3ERM A;  4D1Q A;  3D1N I;  2LOO A;  2D45 A;  2BZT A;  4P96 A;  3JRF A;  4DIQ A;  1V8R A;  1XSB A;  3JRE A;  2NS0 A;  1LDK B;  4CGZ A;  3GWZ A;  3S32 A;  3K4C A;  4NFX A;  5EJC A;  2DHO A;  2IA2 A;  2E19 A;  4FTH A;  1E3P A;  3I55 I;  4XKW A;  1UFM A;  4HQM A;  2E5N A;  1IN4 A;  4WXC A;  5BPD A;  3DWL E;  2GOM A;  4BQQ A;  5F27 A;  3DEU A;  5ANV A;  4E70 A;  1IJW C;  2Z5U A;  1JHF A;  1GVJ A;  3K4J A;  2VBX A;  2IP2 A;  5M3M J;  3R60 A;  1FBS A;  1T2K A;  4RAZ A;  1TWA J;  1SFE A;  1V8W A;  1IN5 A;  2N8G A;  1AKH B;  3AL0 B;  1ZN2 A;  4G7H F;  4MIM A;  2X48 A;  2A69 F;  1YO5 C;  1R5G A;  4EJO A;  2DFI A;  3SMD A;  1KHZ A;  5BPI A;  2RNG A;  4MEX F;  2F5D A;  3CCR I;  4CYD A;  1WZ2 A;  4CYC B;  5HLH A;  1VCD A;  4ENN A;  3KVH A;  4HNT A;  1TLH B;  3GLL A;  5C8L A;  3H35 A;  4BQO A;  3K70 C;  1QPI A;  1DGR M;  1EF4 A;  1WJ5 A;  3BTL A;  1MW7 A;  2CRG A;  2XRN A;  3O3K A;  5ICE A;  1XMA A;  4AU7 A;  1TL8 A;  1R9T J;  5F6F A;  2DXI A;  4HF1 A;  1S8N A;  5KAF C;  1VC9 A;  5C44 J;  2NOG A;  4RMN A;  3JR9 A;  3HSR A;  1LJ9 A;  2TCT A;  4F93 B;  3OOP A;  3FXJ A;  3AL0 C;  1OPC A;  2QKM B;  2GT2 A;  3N77 A;  1GV5 A;  5HLT A;  5GHN A;  4A6D A;  5CVI A;  1G4D A;  3F8B A;  3M1C A;  3V7S A;  3KET A;  2OZU A;  3O52 A;  4CZC A;  1JUM A;  3OS1 A;  2W48 A;  4I09 A;  4A3D J;  2E1N A;  4M3G A;  2CGP A;  4DBR A;  3MDG A;  5LRS A;  3OYJ A;  1RES A;  1G3S A;  2Y0S A;  1FOW A;  3FF5 A;  3QOP A;  2IS6 A;  4G8X A;  3C2H A;  1KA8 A;  2QJO A;  5ANS A;  4E7J A;  2L9S A;  4HLX A;  4E7I A;  1JTY A;  2XF6 A;  4X0G A;  3J7A Y;  5FLV A;  1NQY A;  2Y31 A;  1WJD A;  1BN5 A;  1MKM A;  1ZAO A;  3DLL F;  2CG4 A;  1WCM J;  2E7X A;  4WX9 A;  2EV5 A;  1YFH A;  3OGA A;  2VJJ A;  4ILQ A;  4ASN A;  2WA0 A;  1JE8 A;  1USS A;  2G7H A;  3CLO A;  2HGC A;  4BXF A;  1YOV B;  3KYD B;  3MD2 A;  3SEZ A;  3EUH C;  2M1B A;  3RPU A;  5GAG J;  4OMY A;  4M72 A;  1LDD A;  3VYT B;  1LPQ A;  4BBS J;  2KDZ A;  1FOY A;  2CO5 A;  4NB5 A;  3O8G A;  3DKY A;  3RSN A;  1RR8 C;  4A3B J;  3Q91 A;  3SZG A;  2HDD A;  1GXP A;  1FSE A;  1XGO A;  2RV8 A;  3VB2 A;  4ENK A;  3K2A A;  2MA3 A;  5ILS A;  5D5U B;  3I7U A;  3FMR A;  3EF5 A;  2K3P A;  4S2W A;  3PNV A;  2L7F P;  3RQ4 A;  4P9F A;  2BHY A;  4IQ4 A;  3LAP A;  2DO7 A;  1J59 A;  1IXC A;  3U1D A;  4DYC A;  2IVM A;  2IBD A;  4GYI A;  3R61 A;  1P4X A;  1D0X A;  3X0L A;  3BZC A;  2M87 A;  4C9W A;  4E7L A;  1IRF A;  1AHD P;  4S2V A;  1F3Y A;  1HKQ A;  3ZGK A;  3ZRG A;  2ELK A;  2BXY A;  1A04 A;  4CHU A;  3K6G A;  1VQ5 I;  2P7V B;  3FK7 A;  2JUG A;  2R7F A;  2FUG 2;  4RM2 A;  1V8N A;  2OC6 A;  2W7N A;  1JKP C;  4LMY A;  5JVG F;  2P81 A;  2PX9 A;  5DDG A;  1DUX C;  4W1U A;  4I02 A;  3RJP A;  4I6Z A;  2O7O A;  2MLK A;  1S7E A;  5DD8 A;  1X1B A;  3BT9 A;  3E0J B;  4AVP A;  2JT1 A;  3AAF A;  3PQK A;  1LB2 A;  4QSH A;  2W4S A;  2Y75 A;  4ESJ A;  2XPU A;  1L0O C;  4F91 B;  5KNL A;  2EA2 A;  4HQE A;  2R5W A;  3V8J A;  2E35 A;  2QWW A;  3IKT A;  5GHJ A;  4FET A;  3BY6 A;  3KIO A;  2MC4 A;  2VNP A;  1EH8 A;  4A12 A;  2M4K A;  4E4H A;  1SFO J;  3R6S A;  4RAF A;  1X3W B;  3G0Q A;  2B06 A;  3L2R A;  1UJ8 A;  2DFH A;  2ZJQ F;  2FE3 A;  3UR3 C;  1JHH A;  3FKI J;  2X51 A;  3A0B C;  4DZJ A;  1NFS A;  2ZKZ A;  1TTY A;  2ACJ A;  1MD0 A;  3KCC A;  2W24 A;  2PBI A;  3HTU A;  1VND A;  1K6Y A;  4S05 A;  3A6V A;  5J8F A;  4UV8 A;  3U21 A;  3K4K A;  1IN8 A;  4ZTJ A;  3O2P E;  3JRI A;  1D8J A;  3ABK H;  1KQ0 A;  3KYC B;  2F5C A;  5FRO A;  5ILV A;  3F22 A;  4B43 A;  1LFB A;  2KT0 A;  3KLO A;  1ZLJ A;  2L4M A;  3CCY A;  3LSG A;  4O5V A;  1RC9 A;  2QSF X;  3QAH A;  4RBO A;  3IH3 A;  2HDW A;  4NFW A;  2H1K A;  2RDP A;  5GTH C;  3HOV J;  2YVO A;  2QQA A;  4UV9 A;  4JQF A;  4XL9 A;  3KEQ A;  2X0L A;  2IS1 A;  4HNU A;  1SD5 A;  3BR1 A;  4I99 C;  2CYY A;  3G1O A;  4MO7 A;  2E36 A;  2YX4 A;  3GZ6 A;  2W57 A;  3RKY A;  3HOU J;  3E1S A;  3PO3 J;  3DEE A;  3FIS A;  2E2I J;  4HFQ A;  4G9Y A;  2EFQ A;  4IRH A;  1FEX A;  3IH4 A;  2A6H F;  3PFY A;  4IQJ A;  2STW A;  1QHH D;  3CMM A;  1UEL B;  4U87 A;  2MBF A;  4OIO F;  4L5E A;  3ZR0 A;  1XTA A;  1T0F A;  3DLA A;  4OU0 A;  3TL4 X;  3B6A A;  3OYM A;  3OIP A;  1IG7 A;  1APL C;  2W82 A;  4N4O B;  2QZ8 A;  2NVX J;  1FYK A;  2DT7 B;  2ZXJ A;  5D5X B;  4YFX F;  1U9N A;  1BOB A;  1B72 B;  5GAD J;  3LA7 A;  4K2E A;  3RIR A;  4GRI A;  1LE8 A;  3X0K A;  1G8X A;  2IJL A;  2WY7 Q;  1UG0 A;  1QHG A;  2R92 J;  3G2B A;  3KP3 A;  1V8V A;  4NNJ A;  1B8I B;  1LUJ B;  3BWG A;  1R22 A;  5IPA A;  2JN6 A;  3H9J A;  4A3J J;  2ZBK A;  3BC8 A;  2XV4 S;  3SHD A;  2OQR A;  1ETX A;  4XOT A;  4CH7 A;  4IHS A;  3I64 A;  5JR3 A;  2QQ9 A;  3GCM A;  5M5W J;  2VC0 A;  2R0Q C;  4IHX A;  2VPR A;  1U8R A;  1W7P D;  1VQL I;  3QU3 A;  1BL0 A;  3K4B A;  5BON A;  1YX3 A;  2DLL A;  4YRV A;  1R5H A;  1U20 A;  3CCV I;  2VKD A;  2CU7 A;  3IAM 2;  4LLN A;  3HRM A;  1V54 H;  3DKU A;  2E1M B;  1Z0X A;  4RLF A;  3G1L A;  5K5R A;  1SMT A;  4Y13 A;  1J7K A;  2HPI A;  3LWF A;  1CF7 A;  2OCE A;  4XM3 A;  4IKF A;  3ZMT A;  3E57 A;  4NC8 A;  1ZTR A;  1KZH A;  2LVS A;  5BNG A;  3ZQI A;  3J81 Z;  4AD9 A;  1RRS A;  1BJZ A;  1VTN C;  3CP2 A;  3JAM K;  2HYF A;  3IL2 A;  1N78 A;  2CWE A;  2BW3 A;  1T6S A;  2P6T A;  4KG4 A;  3IKV A;  1W0U A;  1ZR4 A;  5HVQ C;  4OIP F;  4G12 A;  2R5Z A;  4KN7 X;  3Q3S A;  3GZN B;  4LLL A;  4BKX A;  4EJT A;  3FX3 A;  3ISP A;  1SFU A;  4HG2 A;  3Q4I A;  3S2H J;  1G2H A;  2L02 A;  3A1Y A;  1K26 A;  4W97 A;  2VOP A;  4ZC3 A;  1MP2 A;  2IEK A;  4AYB A;  2A5Y B;  6PAX A;  1H0M A;  4J19 A;  1DP3 A;  2FD5 A;  3KP4 A;  3CDI A;  5ERI A;  4HX7 A;  4JZT A;  3ZQC A;  1JTX A;  2E1M C;  3K7A J;  4ITV A;  2ME0 A;  4YII A;  4Q5S F;  3OR2 C;  1Q1H A;  1LEA A;  1W7P A;  2DFF A;  1D5Y A;  2K5C A;  2DPU A;  2PJR A;  1LFP A;  1Y56 A;  3K1P A;  2EIN H;  2X1D A;  2XKP A;  3KP7 A;  1IRG A;  1MBK A;  2O3F A;  1R5I D;  2AS5 F;  1SVM A;  4XKC A;  4B09 A;  2FEZ A;  1RNL A;  1ZHF A;  2BHZ A;  1HKS A;  4IVN A;  4PDK A;  3ZOB A;  1Z67 A;  4CCM A;  5J1R A;  3I7V A;  1GLN A;  3KZY A;  4IXA A;  2V79 A;  1O3S A;  2HTJ A;  3QOE A;  2CMP A;  2XSD C;  2JA8 J;  3DU6 A;  2MAB A;  2MSY A;  2KP6 A;  3SZT A;  3H0D A;  1T33 A;  4MHG A;  4BE1 A;  1V5F A;  2J5P A;  2OQG A;  4N4N B;  3RI4 A;  2V1X A;  5JVT A;  1VHZ A;  1T08 B;  3CJT B;  3LMM A;  3BG5 A;  4HF2 A;  3NAR A;  5FRM A;  3F6O A;  4EQQ A;  3JRD A;  2OA4 A;  3HC7 A;  1DPR A;  3QP5 A;  9ANT A;  4QLC U;  4O6J A;  3ZCO A;  2YVN A;  1RRQ A;  2WAQ A;  1V8L A;  4PGG A;  4PJN A;  2CH0 A;  4D7N A;  3W6V A;  2GZW A;  1R71 A;  1FP2 A;  2ICW G;  2O5R A;  1MMA A;  1JJ6 C;  1FBU A;  1LVA A;  1HF0 A;  1SZ3 A;  2A07 F;  2FBI A;  2EWN A;  3DP7 A;  4ESB A;  3GTL J;  3U53 A;  4A0Y A;  2X9D A;  2M0C A;  4ZZD A;  1FPQ A;  2LYC A;  4KT6 A;  1JKR C;  1VQ9 I;  4BEH A;  2F4I A;  3CF5 F;  2GT4 A;  2ICJ A;  1LE8 B;  3OSF A;  3SJM A;  3Q0V A;  3HHH A;  5HS7 A;  3LQR A;  1RZ4 A;  4LB6 B;  5K5O A;  2QBY A;  2GA1 A;  1K61 A;  1XS9 A;  2JQ7 A;  5H20 A;  3SON A;  4EM0 B;  1A31 A;  2HR3 A;  4IHT A;  1MH3 A;  1R6R A;  4WK8 F;  4KIB A;  4HPQ A;  2DSD A;  2MG4 A;  4A3G J;  2VAS A;  2VXZ A;  4FT8 A;  3WG7 H;  4G94 A;  3RKX A;  2JK3 A;  5JLX A;  3IUO A;  1T0F C;  1JT0 A;  3F21 A;  1X1C A;  2LRE A;  4F3Q A;  3K70 D;  1U5T A;  4HZF A;  1BA5 A;  2LKS A;  2DQL A;  2EV6 A;  4Y33 A;  5J3L A;  1RKW A;  2JMW A;  3VYU B;  1I50 J;  4CA0 A;  3BZ6 A;  1CF7 B;  4MFE A;  4MQ9 F;  2F2E A;  3RYP A;  3Q0W A;  2HS5 A;  5FSL A;  1E17 A;  4B3A A;  2VI6 A;  1FC3 A;  1SEU A;  4HF0 A;  3RQI A;  2BW3 B;  2DYS H;  1J2X A;  4F7Z A;  1R49 A;  5IT9 Z;  3KPH A;  4RM3 A;  4CZZ A;  3VWB A;  2R5Z B;  2NOJ B;  5JLW A;  2DSB A;  5CVU A;  1RET A;  1MJB A;  2B0V A;  4ZDP A;  2LBF A;  2M3A A;  3CCU I;  1FY7 A;  3D5L A;  2EBI A;  5J1Y A;  1IRY A;  3OSG A;  1JI8 A;  1D8K A;  1UHS A;  4ZYD A;  3HRU A;  4L0Z B;  1P7J A;  4XNF A;  4RAY A;  4KIG A;  3H1C A;  1HA8 A;  4N1T A;  3ID9 A;  3V4G A;  2EZH A;  3KP5 A;  5FD5 A;  1P92 A;  1IUF A;  1MBG A;  4KIS A;  3BCB A;  2L0K A;  2M8E A;  2Q2E A;  3EES A;  3BG3 A;  4IOC F;  1UZC A;  1W7P B;  4KIT B;  2W00 A;  4XLF A;  2PJR B;  4M3E A;  1IDZ A;  1FLI A;  3CJQ B;  4QPQ A;  2QVO A;  1UCR A;  2F5V A;  2WTE A;  2WAE A;  3IH2 A;  3BQY A;  3MQ0 A;  1R1U A;  5J4V A;  3COU A;  1X3Z B;  1SAU A;  2QYO A;  4O3M A;  1FX7 A;  3TBI A;  1UHM A;  3E6C C;  3SZP A;  2I8T A;  1YW7 A;  2MC3 A;  3V7C A;  3TW7 A;  4ABZ A;  2DTR A;  1TP4 A;  2L2O A;  4KIC A;  4C3J J;  3CDL A;  5E1Z B;  1KQ9 A;  2K27 A;  4EAT A;  4NHJ A;  3F8C A;  4XLA A;  2STT A;  4CCL A;  4KN4 X;  3HHG A;  5CQG A;  2E7W A;  2KZG A;  3DTE A;  1K83 J;  3EPZ A;  4BU2 A;  1F1Z A;  5GHI A;  5ICF A;  3Q93 A;  1XDU A;  3H92 A;  2FRH A;  2HQN A;  2L7M P;  2GIZ A;  3MVP A;  4JBA A;  2JWT A;  3TGN A;  4J00 A;  3AG4 H;  2ELJ A;  2XAJ A;  3GTJ J;  3S3M A;  2C6Y A;  2DUK A;  4JZU A;  2JUC A;  5DTD A;  1IF1 A;  4GYG A;  5FO5 A;  3J7Z I;  3FSP A;  4QIW N;  3V8L A;  4ESF A;  2BOL A;  2EQR A;  2KQR A;  3N9U A;  2M7A A;  4QTR A;  4FIS A;  5EEH A;  1WJB A;  3L1P A;  2O9L A;  4LG3 A;  3VYR B;  2OTL I;  1BI3 A;  2LKP A;  5GP9 A;  1KU7 A;  2HOS A;  1TQI A;  1GHC A;  2AHQ A;  2H94 A;  3FWE A;  5TJJ A;  4LGW A;  3FIW A;  4BEH B;  3J80 K;  3ROU A;  2ELH A;  3FZV A;  3DPT A;  4XRF A;  2BY1 A;  3S14 J;  1G3W A;  1T98 A;  2FMY A;  5F1R A;  3OL4 A;  5L3E A;  4B47 A;  2O1C A;  1W4M A;  1ZAR A;  3IAS 2;  4XRM A;  1IGN A;  2QBY B;  3HIF A;  4H4K C;  2VUM J;  3L85 A;  5HZX A;  2RKH A;  2BXZ A;  5ANU A;  1BI2 A;  1VQM I;  4I0B A;  2E2J J;  5B66 C;  2IA1 A;  2K9M A;  2Z16 A;  3GF2 A;  3I4N J;  2AXT C;  3P5J A;  3ABM H;  4UUS A;  1PUN A;  3GFL A;  2W85 A;  5IY5 H;  2DCE A;  3CCE I;  1YW8 A;  5BMZ A;  4ENJ A;  1FNN A;  1SD7 A;  2LF7 A;  4U0Y A;  4L9N A;  2Q9P A;  4OAZ A;  3A03 A;  4Y52 J;  3L2V A;  1YYV A;  1VI0 A;  3ZQ7 A;  4BHP A;  3F8F A;  1U5T B;  1K4T A;  3O69 A;  2NVY J;  3TO9 A;  3Q2S A;  1SOI A;  3VPR A;  3AKZ A;  2DA3 A;  1XC5 A;  1K4S A;  4QWQ A;  2Q0O A;  4BYY A;  4ETS A;  1FP1 D;  3CMA I;  1V8I A;  2OZ6 A;  1NG7 A;  1PDN C;  3X0Q A;  2J5O A;  1IN7 A;  4XOR A;  3DTK A;  3CO6 C;  4GDF A;  3ACA A;  3E6D A;  3LSM A;  3BR5 A;  2JVH A;  3QYE A;  5GHO A;  3H36 A;  3BDD A;  4IRI A;  2BEO A;  2LY1 A;  2EIL H;  4G6T B;  2FBH A;  4PJM A;  5FGM A;  1IRX A;  1YG2 A;  1ZGA A;  1DU0 A;  2DDA A;  3WU1 B;  4LIT A;  3ZQL A;  2FQ4 A;  4AIH A;  3ZN0 A;  4L9J A;  3JW4 A;  3COA C;  2M30 A;  3MEX A;  3OYK A;  5FSN A;  2L9V A;  5M3F J;  3MKW B;  4YIF A;  2XPW A;  4U88 A;  3R03 A;  2ID6 A;  4BS9 A;  1QVT A;  3S15 J;  2RQP A;  4ZTF A;  3ZPL A;  1YJN I;  5J47 A;  1SFK A;  2QF7 A;  2EFW A;  3CF2 A;  1U5T C;  1UHW A;  2HQR A;  2X6X A;  5B1B H;  1X2N A;  1ZKG A;  2NXN B;  3BR3 A;  1R23 A;  4PFO A;  3GLX A;  4CIC A;  2V7F A;  2PMH A;  5D4R A;  3FM3 A;  2QQ8 A;  2ID3 A;  3U9G A;  2Q2E B;  3PNT A;  3I4P A;  1HXD A;  1MH4 A;  5HDN A;  1ON1 A;  4UB8 C;  2PQ8 A;  1XGM A;  2V1D A;  2ZNZ A;  4KYX A;  3GTG J;  2CQN A;  5EYR A;  4WWC A;  1E3O C;  2G0E A;  1OFC X;  1HKT A;  2LTP A;  1YJ9 I;  4OAY A;  2DMT A;  3W3C A;  3CCJ I;  1VQK I;  3GTP J;  3E6B A;  1V8Y A;  2FVV A;  2O5W A;  2WBM A;  2P0W A;  3VDX A;  1VFC A;  1SC7 A;  3X0S A;  1WH5 A;  2YU3 A;  2JRT A;  2DAO A;  4Y17 A;  5GAE J;  1OW2 A;  1MMS A;  1D5V A;  4KYW A;  1AOY A;  4DOZ A;  4BBR J;  2LR8 A;  3WG9 A;  1FIP A;  4JOM A;  2FOW A;  1DQU A;  3JRB A;  3WTZ A;  1ACI A;  3I3L A;  2PJP A;  3OIO A;  4XMY A;  5FSM A;  3HJE A;  4UNO A;  3NEU A;  1WKM A;  2GXG A;  3FFU A;  1K78 A;  4UB6 C;  1T95 A;  3DF8 A;  2NRA C;  4IJX A;  2ZSI B;  5DCF A;  1ZG5 A;  2X6O A;  3RPU D;  1XGN A;  1Y8Q B;  4GO1 A;  3L2C A;  5C4J J;  5HNH A;  5ISY A;  5E79 C;  3IWZ A;  3UKG A;  3M3Y J;  1HZT A;  3KFW X;  2FX0 A;  2VOD A;  3G1M A;  5EG0 B;  2PMU A;  4ZG0 A;  2KLO A;  2ZNY A;  2YU9 J;  2VKH A;  4XLN F;  2RQQ A;  3FXQ A;  4RB3 C;  2PLY A;  1WPK A;  5KCM A;  4BH9 A;  1IZ1 A;  2VXD A;  2XGE A;  5CVR A;  4HX8 A;  2R7V A;  1VQ7 I;  3SFZ A;  3WE3 A;  5IP7 J;  1SMY F;  4UUS B;  4A3E J;  2M5W A;  1TZL A;  4LIU A;  1SJY A;  4MGR A;  1W5S A;  3LQQ A;  2DU9 A;  2DQR A;  1V8T A;  5E1X A;  1IW7 F;  1Z6T A;  4B3X A;  4PGH A;  3MKY B;  1Q27 A;  3C2G A;  3M8J A;  3KX2 A;  4CCJ A;  2FOK A;  2R7Z J;  1U2W A;  3REO A;  3WU0 A;  2TRT A;  1BW6 A;  3QQA A;  4YIR X;  2AQF A;  5H2F C;  5JHU A;  2ETH A;  3H9G A;  3U1K A;  3FJY A;  4OWR B;  2MW8 A;  1ORK A;  3GTO J;  2K4J A;  1ITY A;  1V5E A;  2B2K A;  1QNT A;  3WTX C;  2XGD A;  3P9K A;  2DN0 A;  2HZD A;  1SVL A;  1DP7 P;  2ESH A;  3T8T A;  3AG1 H;  3OYF A;  2ZC2 A;  2HVR A;  2EZK A;  4II2 A;  4FCY A;  3L09 A;  1JJ8 C;  1Y6I A;  3TP3 A;  2K40 A;  1P6R A;  1IXS B;  5D8L B;  4MLO A;  1BC7 C;  3DBH B;  4G7O F;  4NQW A;  1G3Y A;  1I1S A;  4S2Y A;  3SDB A;  2FQ3 A;  1ETO A;  1YW9 A;  4A5M A;  2I8U A;  2A6T A;  2COB A;  3E5Q A;  2XF7 A;  1D1B A;  4EJU A;  1V8S A;  1G9Q A;  2VBW A;  2BY3 A;  2OF7 A;  2D1V A;  1ETK A;  2R7R A;  1IDY A;  4M3D A;  2CZR A;  1ZG1 A;  1YIJ I;  3JCU C;  1R36 A;  3S3N A;  4WCG A;  2R7D A;  4LIV A;  3SHF A;  3CD6 I;  2CL3 A;  1RUN A;  4NUB A;  4A3K J;  4QPO A;  1Z9C A;  4CCN A;  2YVP A;  2EA4 A;  3ZMS A;  2Y9Z A;  4RB1 A;  2Z99 A;  2KRF A;  5HLG A;  3JRH A;  3B02 A;  3E7L A;  2EPF A;  3FXL A;  5D5W B;  5C3E J;  1X83 A;  5LLQ A;  5GHM A;  1U0J A;  3KEY A;  5B5E C;  2NS8 A;  1HST A;  4V2G A;  2L01 A;  5LD2 C;  2HOT A;  4CUG A;  3ZP5 A;  3D0S A;  4ZZL A;  1O3R A;  1NH3 A;  1RYA A;  3LSJ A;  5FFX A;  1V55 H;  5LGN A;  3JSP A;  4A0X A;  3S93 A;  4BJ5 C;  2R5Y A;  5IP6 A;  2KRH A;  2DOD A;  4AYB N;  4OIN F;  2DFE A;  2KZV A;  4LB5 A;  4DNC A;  2I8D A;  4HEA 2;  3WTT C;  3WHW A;  2OUM A;  5FRN A;  1NQZ A;  3HL2 A;  4HLY A;  2W1O A;  4L5I A;  3VOD A;  2V26 A;  2P6S A;  1ZRF A;  3FM5 A;  2WAD A;  3J7Y e;  5D6F A;  1FOK A;  4LG0 A;  1QZZ A;  4E7Z A;  4P55 A;  3BHO A;  3Q1P A;  3DKX A;  2VN2 A;  1Y0U A;  1Z77 A;  1PP7 U;  3K9T A;  2BY2 A;  5L3G A;  3EUK L;  1MMG A;  2CUZ A;  2JPB A;  3I9X A;  3LSI A;  4IPA A;  2G74 A;  4PK4 A;  5BS6 A;  2X6Y A;  2CJJ A;  3BQZ A;  3HEF A;  4B4C A;  3WGI A;  1XN7 A;  3BTI A;  1DDN A;  4L18 B;  2CUJ A;  3NQO A;  2CW7 A;  4C2T A;  5KVR A;  2FML A;  2W84 A;  3HSE A;  1XPX A;  2LY9 A;  4RGX A;  3WGG A;  2DYR H;  2F4M B;  3JTH A;  1ULY A;  2PG4 A;  3QYF A;  2QEN A;  1KU3 A;  2E1O A;  1E0E A;  5IOZ A;  2DT6 A;  3LA2 A;  4JX4 A;  5ANT A;  1ENH A;  2FNA A;  2DW4 A;  1PUS A;  1MZB A;  2HI3 A;  3GG6 A;  3WHC A;  1W36 C;  3W2A A;  4XSZ F;  3J81 K;  4BDY A;  3ZQG A;  3T0Y A;  2WAQ N;  3CTA A;  1QGP A;  3JRA A;  2HNH A;  4HNV A;  3ECH A;  5LHG A;  3CMY A;  3GFJ A;  1NFZ A;  5L3B A;  2XVC A;  1TT0 A;  5HS8 A;  2PNY A;  3P5T A;  5E3L A;  4D0P A;  4YEJ A;  2Z1D A;  2XAS A;  3O6Z A;  2O6G E;  1Z3X A;  5GPC A;  2LK2 A;  3BR6 A;  3K1N A;  2VE8 A;  4CCO A;  3PM1 A;  2FNP A;  4UUV A;  1OCC H;  1IN6 A;  2DA1 A;  4HST A;  4RGU A;  4U0V A;  1XMX A;  3L00 A;  3HOY J;  5DPK A;  3WTV C;  2O8K A;  4BY1 J;  2JA6 J;  3LAJ A;  2VON A;  2F48 A;  1IUY A;  4AID A;  4I76 A;  4YPR A;  5CVV A;  4U7D A;  1N75 A;  5AIP A;  2D2W A;  2YS9 A;  4NQW B;  3P6Y A;  3TQN A;  1X1D A;  1WI3 A;  2VIX A;  2UWM A;  3EEU A;  3VFZ A;  2O8X A;  2L3D A;  3CZ6 A;  1RIO H;  3EYY A;  1HSJ A;  3P9I A;  3GW2 A;  1HC8 A;  1JGS A;  2WC2 A;  1GVD A;  2CS3 A;  4FX4 A;  2R7O A;  1OCT C;  1ZQ3 P;  1TW3 A;  3S17 J;  2PI0 A;  4I2O A;  3Q5F A;  3PL8 A;  4KT5 C;  2R7U A;  3NAU A;  3OYG A;  2H6B A;  2UXN A;  4G7Z F;  2H27 A;  1HW2 A;  1W1W E;  4Q4Z F;  1LDJ A;  3CP8 A;  1DU6 A;  2YPR A;  3S8P A;  1O57 A;  3O6B B;  3D5R C;  3V7R A;  2ZXW H;  1E2X A;  2OTJ I;  2F5E A;  4KIF A;  3GFM A;  2LDU A;  4XK4 A;  2A05 A;  3KP2 A;  3A6T A;  5CFI A;  1M1E B;  3OYE A;  5CPR B;  3OYI A;  3FXK A;  3PJR A;  1PUQ A;  5C7Q A;  1R67 A;  2CQQ A;  4N9I A;  1KU9 A;  4DQ2 A;  5FB2 A;  4D5C A;  1HBX G;  2K85 A;  3LOC A;  1EH6 A;  3GXO A;  2KMU A;  3HKZ N;  4XQF A;  2WB1 N;  2ZB9 A;  2RAE A;  2R3S A;  1I39 A;  2KRC A;  4YPH A;  3JRC A;  4KA4 A;  2Y0M A;  2R5Y B;  1TC3 C;  1XB4 A;  5EDN A;  3GWY A;  4I0A A;  3K69 A;  3BCA A;  2H8R A;  5EEA A;  4HSR A;  3HBL A;  2F6C A;  5TIS C;  1HX3 A;  1T56 A;  3H5A A;  4LG0 B;  2JRM A;  1K2E A;  1BR4 A;  3GTQ J;  5IYB J;  3H5N A;  1IV6 A;  3S1N J;  3O61 A;  5CJ9 A;  3EDP A;  2YYH A;  3L7W A;  1MMD A;  3C1D A;  1OR7 C;  2L9R A;  4P5O A;  4XR6 A;  2DPD A;  1B9M A;  5IW4 A;  2V9P A;  3CC4 I;  3ZN1 A;  2XRL A;  2YR2 A;  5EZG A;  2JTV A;  4M9Z A;  4IHV A;  2VBZ A;  4MTE A;  2E60 A;  3QWL A;  3OYC A;  3F0C A;  3A0H C;  2XAH A;  5F0C A;  4I7H A;  1U3E M;  3ZQH A;  1MBH A;  3IHU A;  4C3I J;  4PJL A;  2A5W A;  1STZ A;  2BY0 A;  2XF5 A;  1O3T A;  1FTZ A;  1OYI A;  4A5N A;  2JA2 A;  1NG6 A;  4IO9 F;  1NTC A;  1XCB A;  2MLG A;  3GEZ A;  2MGQ A;  2NVQ J;  4L0Y B;  1PPV A;  2VKE A;  2RRK A;  1UB9 A;  2NNY A;  4Z2Y A;  2M7B A;  3BG7 A;  2KHM A;  4HX4 A;  1QQI A;  4LLG F;  2DBB A;  2ZFW A;  2XC7 A;  2QSG X;  1X19 A;  4ANJ A;  5HOO A;  2GLO A;  2VC1 A;  5IT9 K;  1MQE A;  4DW6 A;  1X51 A;  3ZQF A;  1GT0 C;  2CUE A;  2G9W A;  3BJO A;  3JRG A;  1HW1 A;  2HDC A;  4M6Y A;  2XIG A;  2BE5 F;  1PUF A;  2WV1 A;  3S3O A;  3PFI A;  3OYA A;  3BR2 A;  3AG2 H;  4PSX A;  5DCM A;  1ETV A;  2ZO4 A;  1RRJ A;  1YHQ I;  4OIR F;  3HUG A;  3ML6 A;  4ON0 A;  3OL3 A;  2E71 A;  2M4G A;  1BW5 A;  1OCP A;  1YS7 A;  3W2V A;  4MEY F;  1A6I A;  1B59 A;  1V5G A;  3OS2 A;  4S2X A;  1J09 A;  3FXU A;  1SAX A;  5IW5 A;  2NVU B;  3PIP F;  2TDX A;  4E6K G;  4C30 A;  3DUP A;  5F04 A;  5F64 A;  3ABL H;  2YVM A;  3K0L A;  2L5Q A;  4ZYE A;  3WTW C;  3MAJ A;  2D1H A;  4S04 A;  1KT9 A;  4A3L J;  1VK6 A;  5AON A;  4C2M J;  1JGG A;  3IRQ A;  2X1E A;  1Q33 A;  3KEO A;  1ZK8 A;  1LVK A;  2PQV A;  2DMQ A;  2M9H A;  2DOF A;  5GHP A;  1VZ0 A;  5F0F A;  3RZD J;  4BE2 A;  3LFU A;  2CQK A;  2DTZ A;  3TO7 A;  3EQL F;  2ZFU A;  3HKZ A;  1JKO C;  2K9S A;  2WB1 A;  3L9F A;  2UUZ A;  3S1M J;  1RKT A;  3A6U A;  3C18 A;  3E97 A;  2DK8 A;  4BUP A;  1QZE A;  4GGG A;  4N0B A;  1F9N A;  1BJA A;  2K9N A;  3R0J A;  2VQH A;  1I3A A;  1X3U A;  2K3F A;  2R7X A;  4RLQ A;  4CDG A;  2DMN A;  2H6C A;  1MJ9 A;  2QLZ A;  4OIQ F;  2ECB A;  1S7A A;  1R4N B;  3FKJ A;  5JHF A;  3S1R J;  1J75 A;  5GTI C;  5DYM A;  3J7Y J;  1JRK A;  1R7J A;  3RTR A;  3DKW A;  3ABT A;  3W6J B;  3BOQ A;  3OYD A;  1I3Q J;  3ABU A;  2F4O B;  2JVG A;  4A3F J;  2DA5 A;  1YLF A;  3MMY B;  1KYZ A;  3OMY A;  3T5X A;  4A3M J;  3V42 A;  2Y30 A;  1H88 C;  3EET A;  4NC7 A;  4IJA A;  2XAU A;  3PUF A;  5E3M A;  1YRN A;  3CCS I;  4EGY A;  2H8W A;  5F0H A;  3IRR A;  1XSC A;  4EEF G;  2YSR A;  3HM5 A;  4XIC A;  3CDH A;  2X6W A;  3CME I;  2GOX B;  1OYW A;  2VJ4 A;  3M8F A;  3KZZ A;  5E1W A;  3GVA A;  4KJZ A;  1R00 A;  3HXL A;  2GQQ A;  4PJ0 C;  5ICC A;  3IWF A;  5K7F A;  3OYN A;  1R1V A;  3BJ6 A;  1I6H J;  2DI3 A;  1PVF A;  3HB9 A;  2DA6 A;  3MDI A;  2X4H A;  1S9H A;  2R7T A;  3A02 A;  1XSA A;  2JSP A;  3OY9 A;  2CW0 F;  2DMU A;  2A68 F;  5BQT A;  2QJT A;  3J7A O;  2HKO A;  3F3X A;  4AUX A;  3WTY C;  3MCF A;  2OBP A;  3CES A;  2G7U A;  2J8Q A;  5KK1 A;  5FKL A;  1MGT A;  2Y69 H;  1T8I A;  4Q47 A;  1OQY A;  2HXO A;  1JUP A;  2IW5 A;  2HVS A;  1DPU A;  3N97 A;  4A93 J;  4XN0 A;  1FMV A;  1A35 A;  3LA3 A;  1J0R A;  2XAQ A;  3I0T A;  4HOB A;  1TQM A;  2MH2 A;  2YUS A;  4JX6 A;  1S29 A;  1FWZ A;  2DK5 A;  4LD5 A;  5DCM B;  1MSE C;  2OV7 A;  3L2Q A;  5D6E A;  1XMK A;  5D5V B;  2QKL B;  3HYI A;  3HUG B;  1FYM A;  1HW5 A;  1LKX A;  1OIS A;  1KTG A;  2BV6 A;  2X85 A;  4A3C J;  1ONV A;  2HEO A;  4MNU A;  3FK9 A;  3TP0 A;  2OD5 A;  3FXR A;  3LST A;  4ZH4 F;  1MNM C;  2I6K A;  3FDY A;  2XSQ A;  5HOD A;  2GM4 A;  5K5Q A;  1REP C;  1MBJ A;  4YEL A;  4B1R A;  1XCV A;  1O7F A;  1LQ1 A;  4A0Z A;  5E18 F;  4DYW A;  2QSH X;  4IZZ A;  3DEW A;  4N9H A;  3T1B A;  1S72 I;  3X0O A;  1AA7 A;  4RGS A;  1WJF A;  4FQG A;  3HTS B;  1FBQ A;  5FSI A;  3F6A A;  4JX5 A;  2O03 A;  1Z6R A;  4HDV A;  3HHJ A;  3I5U A;  3NWT A;  2PFB A;  3I56 I;  5DUK A;  2ZJ2 A;  2DDB A;  5HS9 A;  1HCR A;  2LP0 A;  1K79 A;  1XDS A;  1D0Y A;  5FFZ A;  4B44 A;  1OLT A;  5CKT A;  1TBX A;  1TWH J;  3S2W A;  4EM1 A;  2MD5 A;  3TDU C;  5ED4 A;  4HV5 A;  1F36 A;  4HA8 A;  5DEQ A;  4UVB A;  1JKN A;  2CUF A;  1X4O A;  2KKO A;  2LBF B;  3HOT A;  3BG9 A;  4EGZ A;  1ZH5 A;  2L9N A;  3VSK A;  3CLQ A;  2LRD A;  3DU5 A;  5HNF A;  3A01 A;  2L54 A;  1IO2 A;  3RZO J;  2EJR A;  4M6V A;  1UAA A;  1UG2 A;  5H6Q A;  1SD6 A;  3MZ8 A;  3CNG A;  3VEP A;  3F6V A;  1Y39 A;  1GUU A;  2D5V A;  2VNQ A;  1W36 D;  1CQT A;  1WHU A;  5HDG A;  3FBN B;  5GHQ A;  4GCV A;  3IC7 A;  1ETQ A;  4I98 B;  1N77 A;  3Q2T A;  3OS0 A;  1G0S A;  4Z6Y A;  4P9U A;  5J40 A;  2EZL A;  1KGS A;  2FBK A;  2HPM A;  3L2W A;  3R4K A;  4LJZ F;  1EKE A;  5DV5 A;  3JTG A;  1Y1W J;  4OOI A;  3CJR B;  3P7N A;  3R0A A;  2ZXH A;  3WGH A;  4DGW B;  3QPH A;  4P1W A;  4UY8 I;  1YRN B;  2Z2S B;  5FSO A;  2K4B A;  2ZME A;  5A2Q Z;  2DJN A;  3FHN A;  1BIB A;  1D1C A;  1WWX A;  2LH9 A;  4IRG A;  2OJE D;  1FSH A;  4BDZ A;  1J5Y A;  1HDP A;  3H3U A;  4KMF A;  4BJ6 C;  1XX5 A;  4Y3O A;  1F4K A;  2IGO A;  1R1T A;  3ONQ A;  2LY2 A;  1IAW A;  3M7G A;  3DBR B;  3F72 A;  4D9J A;  1LFU P;  5FD6 A;  5F1J A;  3MN2 A;  3WU2 C;  5LHH A;  2KL4 A;  4M3B A;  3GTM J;  3O8H A;  1ZRC A;  1BIA A;  3G4S I;  4TV7 A;  1C0W A;  5E3O A;  1PYV A;  3BRO A;  1Q1V A;  3HOX J;  3PQJ A;  3GBG A;  2B7E A;  5FLX Z;  2O61 A;  3TW6 A;  2IRF G;  2FU4 A;  2EB7 A;  2L7Z A;  2QCO A;  3H0G J;  1B4A A;  1LEB A;  2O5F A;  3H9Q A;  3IP4 B;  3WTS C;  1WJC A;  1CGP A;  1FJL A;  1OMI A;  2DOA A;  4DYR A;  1Z7L A;  4J7H A;  5LRR A;  1B9N A;  2ADU A;  5KAI C;  1HOM A;  3RH7 A;  1ZYR F;  3SDG A;  5BOX A;  2GXB A;  2EIJ H;  2R7Q A;  1KQ8 A; 
#chains in the Genus database with same CATH homology
 1V5F A;  2IS2 A;  2ZXI A;  4N4N B;  1VHZ A;  3EUK L;  1MMG A;  4U7B A;  2CUZ A;  3I9X A;  3LMM A;  3LSI A;  2G74 A;  4PK4 A;  3KYL A;  5FRM A;  2A8P A;  2X6Y A;  5BS6 A;  1WFX A;  3HC7 A;  3OYL A;  2CUJ A;  2CW7 A;  3OR1 C;  3ZCO A;  4BAC A;  4C2T A;  2KDV A;  2YVN A;  1RRQ A;  2WAQ A;  1V8L A;  5KHD A;  2FML A;  3BG6 A;  1EA3 A;  2VB6 A;  4PJN A;  2CH0 A;  2R4G A;  3LSK A;  1D1A A;  4KTB A;  1YX5 A;  3QYF A;  2JVB A;  2O5R A;  1MMA A;  1E0E A;  4XLE A;  2DT6 A;  3ZQQ A;  3MKZ A;  1SZ3 A;  1VC8 A;  5ANT A;  1PUS A;  4HVY A;  3GG6 A;  3PUB A;  1W36 C;  4F52 A;  3U53 A;  4C9X A;  3W2A A;  4BDY A;  2LYC A;  4KT6 A;  3F9K A;  4BEH A;  2F4I A;  2HNH A;  2GT4 A;  2ICJ A;  1NFZ A;  3P5T A;  1TT0 A;  1Z3Y A;  4PJJ A;  3VYS B;  2PNY A;  3OYB A;  4YEJ A;  2Z1D A;  1ERD A;  3O6Z A;  1Z3X A;  1PPX A;  3OYH A;  3SON A;  4CCO A;  1R6R A;  4HST A;  5DPK A;  4HPQ A;  2DSD A;  1VHG A;  2M0M A;  4AVZ A;  2VAS A;  3SEQ A;  3HOS A;  1MUT A;  2PMZ A;  2VXZ A;  4BQN A;  2IXS A;  3FBI B;  1MR2 A;  4XLC A;  4YPR A;  1MMN A;  2A8T A;  1N75 A;  3HG9 A;  4J01 A;  2R7W A;  3K10 A;  3IUO A;  4NQW B;  1T0F C;  3P6Y A;  1X1C A;  4MPO A;  1X1D A;  2LRE A;  3DPL C;  3LSH A;  4F3Q A;  4C2U A;  2HVQ A;  2VIX A;  5CFJ A;  3OOU A;  2UWM A;  3K70 D;  3EEU A;  4F92 B;  4N1U A;  1DGW Y;  1I9A A;  3OIQ A;  3CZ6 A;  3N05 A;  4Y33 A;  1X84 A;  2DSC A;  3VYU B;  4CA0 A;  4E7K A;  3I9V 2;  3BAP A;  3PSI A;  4ZDO A;  2VQL A;  3TMO A;  5ANW A;  2VJ5 A;  3HYQ A;  2CS3 A;  4JZV A;  2R7O A;  4ZJZ A;  3GZ8 A;  5FSL A;  4IX7 A;  5TGT A;  3QOD A;  4PFP A;  1GA7 A;  3PL8 A;  2BW3 B;  2R7U A;  2KDW A;  3OYG A;  4V14 A;  2CV0 A;  1V8U A;  5FSK A;  4RM3 A;  3VWB A;  2XSJ C;  1X4P A;  2NOJ B;  3CP8 A;  2DSB A;  2W4E A;  3S8P A;  2B0V A;  4ZDL A;  3D5R C;  2IGK A;  4ZDP A;  2LBF A;  1VIU A;  3BM4 A;  4CCK A;  2M3A A;  3D5L A;  3BLY A;  4C9Y A;  1G59 A;  3A6T A;  5CFI A;  3X0J A;  1IRY A;  3OYE A;  1JI8 A;  5CPR B;  3OYI A;  3PJR A;  1PUQ A;  5C7Q A;  1R67 A;  4XNF A;  5CQE A;  2MD0 A;  1HA8 A;  4N1T A;  3ID9 A;  4D1Q A;  3UNG C;  2CFO A;  2LOO A;  2KMU A;  4DIQ A;  1V8R A;  1XSB A;  5LFA A;  4KIS A;  4XQF A;  3BCB A;  4HRI A;  3EES A;  1LDK B;  2G73 A;  5LPG A;  3S32 A;  3K4C A;  4NFX A;  2DHO A;  2KRC A;  4YPH A;  4KIT B;  4Y4R A;  4XKW A;  2W00 A;  2E5N A;  4XLF A;  2PJR B;  3CJQ B;  3DWL E;  4QPQ A;  3GWY A;  1ZEL A;  2GOM A;  4BQQ A;  2VQC A;  5ANV A;  3BCA A;  2F5V A;  2WAE A;  3L2U A;  3K4J A;  3COU A;  4HSR A;  4PUS A;  1SAU A;  2F6C A;  3TBI A;  1HX3 A;  2I8T A;  2E5Z A;  3D5S C;  1V8W A;  5I8U A;  3H5A A;  3AL0 B;  1BR4 A;  1K2E A;  3H5N A;  2L2O A;  4ZYA A;  4EAT A;  3O61 A;  2YYH A;  4XLA A;  3SMD A;  1MMD A;  4CCL A;  1KHZ A;  1OR7 C;  4P5O A;  4XR6 A;  2RNG A;  2KDO A;  5IW4 A;  2IGN A;  5CQG A;  3RCO A;  3DTE A;  3EPZ A;  4BU2 A;  3Q1P A;  5GHI A;  2VL8 A;  1VCD A;  3Q93 A;  3H5R A;  3KVH A;  4HNT A;  2E60 A;  3OYC A;  4J00 A;  2ELJ A;  3S3M A;  2DUK A;  3QYB A;  5C8L A;  3H35 A;  4BQO A;  3K70 C;  4JZU A;  1DGR M;  1WJ5 A;  3FSP A;  4PJL A;  2AZW A;  3EUA A;  2A5W A;  1MW7 A;  2BOL A;  2KQR A;  3N9U A;  2XF5 A;  1D0Z A;  2M7A A;  1WJB A;  4AU7 A;  4BL0 B;  2DXI A;  4LG3 A;  3VYR B;  2JA2 A;  1NG6 A;  1VC9 A;  2CV2 A;  2VPL A;  2IS4 A;  1PPV A;  2RRK A;  4RMN A;  1X1A A;  3AC9 A;  2M7B A;  3BG7 A;  2KHM A;  4BEH B;  2XC7 A;  4F93 B;  3AL0 C;  1X19 A;  4ANJ A;  2QKM B;  3DPT A;  5HOO A;  2GT2 A;  5HLT A;  3N77 A;  5GHN A;  3X0R A;  3OL4 A;  3M1C A;  1MQE A;  4B47 A;  1X51 A;  2O1C A;  4NFW A;  3IAS 2;  3L85 A;  4H4K C;  5HZX A;  3O52 A;  4CZC A;  3PNY A;  3OS1 A;  5ANU A;  3S3O A;  4DBR A;  3MDG A;  2K9M A;  2Z16 A;  3OYA A;  1PUN A;  3OYJ A;  4PSX A;  2Y0S A;  2UV1 A;  2CV1 A;  2DCE A;  2IS6 A;  1Z21 A;  3X0P A;  2WAF A;  3C2H A;  2QJO A;  5ANS A;  4E7J A;  2L9S A;  3LL7 A;  4E7I A;  2XF6 A;  4X0G A;  3OL3 A;  3J7A Y;  2M4G A;  1NQY A;  1WJD A;  4OAZ A;  2Q9P A;  1MND A;  2HU9 A;  3W2V A;  3L2V A;  2GB5 A;  3QSJ A;  3O69 A;  3OS2 A;  2VQG A;  1V5G A;  4S2X A;  1J09 A;  2MYS A;  3OGA A;  2VJJ A;  4ICK A;  4ILQ A;  3Q2S A;  1SOI A;  5IW5 A;  3AKZ A;  2WA0 A;  4E6K G;  4C30 A;  2VJI A;  3DUP A;  4BXF A;  1VRL A;  1V8I A;  3MD2 A;  3SEZ A;  3EUH C;  1NG7 A;  4XON A;  3VYT B;  2YVM A;  3X0Q A;  2L5Q A;  3DTI A;  2HQA A;  2X1C A;  3DKY A;  2V1N A;  2BVL A;  3DTK A;  4XOR A;  1PJR A;  3RSN A;  3SZG A;  3LSM A;  3ZR8 X;  3ACA A;  3F13 A;  3Q91 A;  2JVH A;  3QYE A;  2V6E A;  1KT9 A;  5GHO A;  1VK6 A;  2LY1 A;  4G6T B;  4PJM A;  1QU3 A;  2X1E A;  1IRX A;  1Q33 A;  3I7U A;  1LVK A;  2PQV A;  3EF5 A;  4LIT A;  2K3P A;  3HPG A;  3VSL A;  5GHP A;  4S2W A;  1VZ0 A;  3PNV A;  3RQ4 A;  3W2W A;  4BE2 A;  3LFU A;  5FSN A;  4E7S A;  3OYK A;  3HKZ A;  2ZFU A;  4IQ4 A;  3MKW B;  3R03 A;  2WB1 A;  2UUZ A;  3A6U A;  4BS9 A;  4ZTF A;  1D0X A;  4BUP A;  3X0N A;  3X0L A;  4C9W A;  1SFK A;  4K6E A;  3CF2 A;  2X6X A;  4E7L A;  4S2V A;  1F3Y A;  1KON A;  3ZGK A;  4PFO A;  2VQH A;  3ZRG A;  2R7X A;  4RLQ A;  2V7F A;  3K6G A;  3K4N A;  2JUG A;  2Q2E B;  3PNT A;  3ZXS A;  3MGM A;  2FUG 2;  4RM2 A;  3FKJ A;  5JHF A;  2OC6 A;  1V8N A;  2W7N A;  1JRK A;  5DDG A;  3RTR A;  4KYX A;  2V4J C;  1X1B A;  3E0J B;  3OYD A;  3BHO A;  2JVG A;  2W4S A;  4OAY A;  4CSW A;  3MMY B;  3OMY A;  3W3C A;  4PSW A;  1V8Y A;  2FVV A;  2O5W A;  2WBM A;  4J7G A;  3V42 A;  2P0W A;  3VDX A;  4NC7 A;  3EXQ A;  4DJA A;  4F91 B;  5KNL A;  3X0S A;  3HPH A;  2MFZ A;  2XAU A;  2R5W A;  5GHJ A;  4FET A;  1TUM A;  1OW2 A;  2MC4 A;  2VNP A;  3A6S A;  1XSC A;  4DOZ A;  2M4K A;  4E4H A;  2X6W A;  4JOM A;  2GOX B;  3G0Q A;  2B06 A;  1DQU A;  3L2R A;  2VJ4 A;  3SYT A;  3UR3 C;  3I3L A;  1V8M A;  2X51 A;  1NFS A;  4XMY A;  3H95 A;  4KJZ A;  5FSM A;  3HXL A;  4YOQ A;  1K6Y A;  1PVF A;  3OYN A;  3A6V A;  4BJT A;  2RRE A;  3MDI A;  3DQV C;  3U21 A;  1SU2 A;  3FFU A;  1S9H A;  3K4K A;  2R7T A;  4ZTJ A;  2BVM A;  1T95 A;  1XSA A;  2JSP A;  3OY9 A;  4IJX A;  2ZSI B;  5FRO A;  4FAS D;  4B43 A;  3RPU D;  2QJT A;  4BE0 A;  3MCF A;  5HNH A;  3ZR1 A;  1P9Q C;  5ISY A;  1WJA A;  3CES A;  3LSG A;  1HZT A;  2HDW A;  2K9L A;  2J8Q A;  4F55 A;  4ZG0 A;  2LC2 A;  2HVS A;  2YVO A;  2KLO A;  4JQF A;  2VKH A;  4XL9 A;  2IS1 A;  4KG3 A;  1MQW A;  2RQQ A;  4XN0 A;  4HNU A;  4XN3 A;  1FMV A;  3GRN A;  2DJI A;  5KCM A;  2L7K A;  2VLA A;  2VXD A;  3GZ6 A;  3E1S A;  3DEE A;  2R7V A;  3X0M A;  4HFQ A;  3DPU A;  1TZL A;  4LIU A;  3PSF A;  1SJY A;  2OV7 A;  3L2Q A;  3PFY A;  4IQJ A;  2R7S A;  2QKL B;  1QHH D;  3HUG B;  1KTG A;  1LKX A;  4B48 A;  3CMM A;  1UEL B;  4U87 A;  1V8T A;  2X85 A;  3ZR0 A;  2XDV A;  3DLA A;  4B3X A;  3MKY B;  1Q27 A;  3TL4 X;  3C2G A;  3M8J A;  4XKB A;  3OYM A;  2A8R A;  3FK9 A;  2WY8 Q;  3KX2 A;  4CCJ A;  2I6K A;  3FDY A;  5C7T A;  3OIP A;  2XSQ A;  2W82 A;  4N4O B;  2AQF A;  4YEL A;  2IGM A;  2DT7 B;  4DYW A;  3H9G A;  4IZZ A;  3FJY A;  4OWR B;  1BOB A;  3X0O A;  1AA7 A;  4GRI A;  1WJF A;  4R79 A;  3X0K A;  5FSI A;  3F6A A;  1G8X A;  2WY7 Q;  1UG0 A;  1QHG A;  4E7H A;  2B2K A;  1V5E A;  3G2B A;  3O8S A;  3HHJ A;  1V8V A;  3NWT A;  4NNJ A;  3A2K A;  2HZD A;  3H9J A;  3BC8 A;  3SHD A;  3OYF A;  1D0Y A;  1PPW A;  2HVR A;  3NWS A;  4XOT A;  4II2 A;  4B44 A;  4CH7 A;  3H0D A;  2ICK A;  1OLT A;  1Y6I A;  5CKT A;  1FMW A;  4JZS A;  4MLO A;  1VIQ A;  3K4B A;  1YE9 A;  5BON A;  5DEQ A;  1YX3 A;  4S2Y A;  1JKN A;  1X4O A;  2LBF B;  4YRV A;  3SDB A;  3HOT A;  1U20 A;  2A8S A;  1QVJ A;  2L9N A;  2VKD A;  3VSK A;  2I8U A;  2ZSH B;  2LRD A;  2A6T A;  3DU5 A;  3IAM 2;  5HNF A;  2XF7 A;  1UAA A;  3DKU A;  3K4L A;  1Q54 A;  1D1B A;  2E1M B;  2FKB A;  1V8S A;  4RLF A;  3CNG A;  4II3 A;  3OWT A;  1G9Q A;  2HPI A;  4XLH A;  4XM3 A;  3FCM A;  2VNQ A;  1W36 D;  4IKF A;  3E57 A;  3FBN B;  3K4M A;  4NC8 A;  1N77 A;  5GHQ A;  4XKV A;  2R7R A;  2CZR A;  3Q2T A;  3OS0 A;  1G0S A;  1RRS A;  3CP2 A;  3GZ5 A;  1BR2 A;  3S3N A;  1N78 A;  4LIV A;  2HPM A;  2BW3 A;  2CL3 A;  4KG4 A;  4NUB A;  3L2W A;  5HVQ C;  4QPO A;  4CCN A;  2YVP A;  3CJR B;  1BR1 A;  2ZXH A;  4DGW B;  4P1W A;  2Z2S B;  2A8Q A;  5FSO A;  3FHN A;  4HG2 A;  1D1C A;  2LH9 A;  1K26 A;  3Q4I A;  3A1Y A;  4BDZ A;  1MNE A;  4ZC3 A;  4Y3O A;  4AYB A;  4BJ6 C;  1MP2 A;  2LG4 A;  1DP3 A;  1MK1 A;  2IGO A;  2Q1Z B;  3ONQ A;  1X83 A;  2CW8 A;  2LY2 A;  4JZT A;  5GHM A;  2V9K A;  1U0J A;  3AFH A;  3KEY A;  4D9J A;  2AQE A;  2E1M C;  4ITV A;  5LD2 C;  4CUG A;  2KL4 A;  3OR2 C;  1RYA A;  4DBQ A;  3S93 A;  4BJ5 C;  1PYV A;  4XOP A;  2K5C A;  2PJR A;  3GBG A;  2KPM A;  1WJE A;  1LFP A;  1Y56 A;  2X1D A;  2KRH A;  3A4C A;  5DD4 A;  2KZV A;  2I8D A;  4BGD A;  4HEA 2;  2O5F A;  3WHW A;  2OUM A;  3H9Q A;  4XKC A;  5FRN A;  3IP4 B;  3HL2 A;  1NQZ A;  3I7V A;  4CCM A;  1WJC A;  2W1O A;  3X0I A;  2DOA A;  1Z7L A;  2V26 A;  4J7H A;  2WAD A;  3RH7 A;  3J7Y e;  1GLN A;  3QOE A;  2CMP A;  3DU6 A;  2MAB A;  4E7Z A;  2R7Q A;  3DKX A;  2KP6 A;  4BE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...