2A6TA

Crystal structure of s.pombe mrna decapping enzyme dcp2p
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
245
structure length
230
Chain Sequence
b'MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFEISKIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIANNTTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPAC19A8.12
publication title Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein,hydrolase
total genus 63
structure length 230
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a6tA01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2a6tA02
4JZSA 5FSKA 2VNQA 3FJYA 2GT4A 3A6UA 3EEUA 4C9WA 5BONA 2FVVA 2G74A 3N77A 5HZXA 1OW2A 3OGAA 3J7Ye 2GB5A 4JZUA 1JRKA 2GT2A 4KTBA 1NQZA 2JVBA 2YVNA 5ANUA 4S2WA 3COUA 5ANVA 3QSJA 4HVYA 2O5FA 4ZG0A 3MDIA 3ACAA 1XSCA 2W4EA 1SJYA 3ID9A 1VRLA 5ANWA 1PUQA 3GG6A 3I7UA 2A8PA 1TUMA 1V8UA 2I8TA 1SU2A 3E57A 1K26A 3EXQA 3P5TA 3ZR0A 4N1TA 2QKMB 4YPRA 1V8YA 3Q2SA 3X0IA 5FSOA 1V8RA 2B0VA 4YOQA 5GHQA 4YPHA 3I9XA 3A6SA 1XSAA 3MGMA 4KG3A 5ANTA 2R5WA 4C9XA 3L85A 2DHOA 3BM4A 1V8TA 2A8SA 3BAPA 5GHOA 2B2KA 2O5WA 3MDGA 3GWYA 1KTGA 5GHMA 5IW4A 4S2YA 3DUPA 2G73A 1I9AA 4KG4A 4JZVA 3FFUA 3X0NA 1X51A 1PVFA 5DPKA 3F13A 1K2EA 1PUSA 4JZTA 3A6TA 2KDVA 1V8MA 3EESA 1Q33A 2ICKA 2VNPA 5DD4A 5FSNA 1Q54A 5C7TA 3Q4IA 3FCMA 3GZ5A 3EF5A 1MP2A 4NFXA 3SHDA 1VC8A 2ICJA 4ILQA 4DYWA 3X0MA 1XSBA 2O1CA 1VIQA 3U53A 2DSCA 2A8RA 1V8IA 2J8QA 1VIUA 3Q93A 1SOIA 5GHIA 3P6YA 1VHZA 1VC9A 2PNYA 5FSIA 5DDGA 3X0LA 3F6AA 1MUTA 3X0QA 3A6VA 1V8NA 1U20A 1SZ3A 2KDWA 3HYQA 4ICKA 5FSMA 1PPWA 5C8LA 1VHGA 5GHNA 3Q2TA 1RRSA 1MK1A 2DSBA 3GZ8A 5DEQA 1MR2A 2CL3A 2Q9PA 1PPXA 2QJTA 1V8WA 5GHPA 2FKBA 3I7VA 5CFJA 5ISYA 3SMDA 3Q91A 3X0SA 1VCDA 2QJOA 4NFWA 1F3YA 1V8VA 2XSQA 3KVHA 3SONA 3O61A 3X0KA 2A6TA 3GRNA 3HHJA 2AZWA 3O52A 3X0OA 2YVPA 2PQVA 2QKLB 3RH7A 5IW5A 1NFSA 1NQYA 1PUNA 1MQWA 1VK6A 2A8QA 1X84A 3H95A 4V14A 2I8UA 3O8SA 4HFQA 3X0RA 5LPGA 3R03A 1GA7A 5C7QA 3ZR1A 4MPOA 4S2VA 2I6KA 1JKNA 1R67A 1RRQA 2DUKA 2B06A 1MQEA 3BHOA 1V8SA 4N1UA 1X83A 1KT9A 3AC9A 2YVMA 5GHJA 1IRYA 2DSDA 3DKUA 3FSPA 3O69A 3N9UA 4S2XA 5ANSA 1G9QA 1RYAA 5FSLA 2YVOA 1QVJA 2RRKA 4IJXA 3X0PA 5BS6A 4KYXA 3WHWA 1V8LA 1Q27A 3Q1PA 2YYHA 3MCFA 2A8TA 4K6EA 1HZTA 1HX3A 5I8UA 1NFZA 2FMLA 3O6ZA 3CNGA 3X0JA 5CFIA 1KHZA 3G0QA 3GZ6A 1G0SA 1PPVA 3FK9A
chains in the Genus database with same CATH superfamily
1OCOH 3RDIA 3OMYA 4X1EA 3OYDA 2V26A 2RVCA 3JRCA 4CYDA 3EEUA 1YW8A 4KFCA 2GT2A 1TT0A 2EWNA 3OR1C 2QWWA 4BE1A 3I58A 2VOOA 4LK0F 4XBFA 3CQZJ 3ABMH 4TV7A 4W1UA 2CH0A 3QU3A 1OQYA 1FZPB 2BY2A 4BXXJ 1FOKA 4RB0A 2DFFA 3JRGA 1NHAA 3CDLA 1JGSA 2BOLA 3DPUA 3G6EI 2LMDA 3J7ZI 1QNTA 3H5NA 2CSOA 3L2VA 4BUPA 4W97A 3RCOA 1O3TA 3H3VK 3CCJI 3BM4A 3P9CA 1HCRA 1V4RA 5GHOA 3QYEA 3WU2C 3MDGA 3T0YA 2MH9A 3BTCA 2CQQA 4EM1A 4MEXF 2DJNA 3W2AA 5KCMA 3PQKA 5C4XJ 2M2EA 1XSXA 2LSOA 3DWLE 2E5ZA 1Q54A 2I8DA 1VQKI 4M3DA 4IQ4A 3SHDA 3CMYA 4BY7J 2BW3B 2E5NA 1BR4A 5HVQC 5K5RA 4BYYA 1QVTA 2UV1A 3NARA 4PFOA 4DBRA 1ORKA 2WY7Q 3FXOA 2FOKA 4X6AJ 2QBYB 1LUJB 3TMOA 2FOWA 2KRHA 4R79A 1DUXC 1W1WE 2PNYA 1M1EB 1XB4A 5K5QA 2A5YB 4ENJA 3BCAA 1APLC 2VONA 3FISA 2R5YA 4LFUA 1TWCJ 1W4MA 4P5OA 2DU9A 1W0TA 1WJAA 2KIMA 2X6YA 3W3CA 3LAPA 1ZG3A 1T0FC 3RZOJ 3X0SA 1VCDA 4LLNA 1F3YA 2QVOA 4HNUA 2JA7J 2YVPA 4LMYA 3QOPA 3H95A 1FBUA 1MQWA 2FSWA 1VK6A 5D5WB 1OYWA 3O8SA 4FT8A 2HOAA 1T39A 3R03A 1FTTA 1MNEA 5K5OA 2I6KA 4FCYA 2H09A 1WJBA 3IH4A 3JRBA 3RKQA 1IN4A 4F52A 5JHFA 5C44J 1Z6TA 4PJJA 3KLOA 4U0WA 5FKMA 2DTZA 4HV5A 5TISC 4S2XA 1T0FA 1GVJA 2EZHA 2K40A 2XPVA 3SEQA 3D5SC 5M5WJ 4MFDA 3WHWA 1HKTA 1Q27A 5F1RA 2XKPA 2CO5A 3VPRA 2KP6A 2FRHA 1YW9A 4L9VA 1TC3C 2JN6A 2HVRA 1RKTA 2DT7B 4E70A 3HC7A 4A3LJ 4F91B 5ANVA 2XAGA 4PJ0C 4C3HJ 3W6KB 3Q5FA 2HKXA 1G3SA 4V2FA 2IS6A 2W4EA 1VRLA 1ETKA 1MGTA 3O8GA 3CJTB 1PUQA 2A68F 3TKYA 5D6FA 1ERDA 2JUGA 3ZR0A 2DN0A 4LB5A 3HDDA 2OCEA 5F0CA 1K79A 2CUEA 4YRVA 4YOQA 2LG4A 4OINF 4XIDA 2R92J 4XOPA 1JGGA 1A6QA 4Z6YA 5KAFC 2EIKH 4WXCA 2DCEA 2OUMA 3ERED 2UZKA 1D1BA 2JVHA 3JSOA 4BNCA 2D1HA 3LL7A 2HPMA 2AXLA 2M4GA 3ZPLA 4ITVA 4YFXF 2B9SA 2E7WA 2NVYJ 2CV2A 1ETXA 1ZRCA 2JA5J 2VB6A 1D3YA 1V8MA 1SFKA 4M72A 3KE2A 5IY5H 3H36A 1WFXA 3H5AA 3HJEA 3NWSA 3AG1H 4N9HA 3CUQB 4AIHA 4H4KC 1MZBA 4FX0A 2XKOA 3IH2A 3U1KA 2Z2SB 4I6ZA 2ZCWA 3F6AA 4BJ6C 4RM2A 4BQNA 1U20A 4ZDPA 5AIQA 4A3MJ 2ZBKA 2Y0SN 3ELKA 1QHHD 3K4JA 3BR1A 4M73A 1YLFA 5GPAA 3I9V2 1SVOA 2V9VA 2ZNYA 2VOPA 5GHPA 4RAYA 4RLQA 3FK7A 2HI3A 5ISYA 2EFWA 4ZYGA 5E17F 2B7EA 1PJRA 3E6CC 2RGVA 2ISZA 3OIPA 1JUMA 1Q1HA 1R7JA 1T98A 5DD8A 2Q8KA 2KIFA 4UVCA 2MG4A 4LJZF 2H27A 2XSDC 2JRMA 1DPRA 4NQWB 3OIQA 5DV5A 4F3QA 1EV7A 1MDMA 4S0HB 1F36A 3M07A 3FX3A 3RI4A 2A3SA 2VC1A 3DV8A 3SEZA 4PJLA 5ANSA 5KNLA 1K61A 3HTUA 3T5XA 5LFAA 2CFXA 1FYKA 5H2FC 4C2TA 1DQUA 1ONVA 3IRRA 1BBYA 4KIFA 3CC2I 1HX3A 3R61A 5M5XJ 2WB1N 3C2HA 3OYGA 3SHFA 5C3EJ 3ZN0A 1XS9A 1HDPA 3CCQI 2TRTA 3CESA 2LKSA 1O4XA 4EVIA 1WJDA 2FVVA 4PK4A 2G74A 4JZUA 4R1HA 3MD2A 5M3MJ 2JPBA 1Z67A 4RS8A 4I02A 1ZELA 3QYBA 4BHCA 1FBSA 3E3VA 5K1YA 5J4YA 1ZREA 4Q47A 4XOTA 3ESWB 3WTZA 2K85A 2EIJH 3E57A 4C3IJ 4YPRA 3QPTA 2M4KA 3JRIA 5FRMA 4M3BA 2XC7A 1WHUA 1IXSB 2R5ZB 4GDFA 2EZIA 3JRHA 1CGPA 1V54H 4FTHA 1Y0UA 2XDVA 2VN2A 1QBJA 2IS2A 3WTTC 2W57A 1H9TA 3OOPA 3GFJA 1O3QA 5IW4A 3CCRI 3N97A 1IZ1A 2MLKA 4XLAA 4IEJA 4B4CA 2ZKZA 4XICA 4IKFA 3DPTA 3G71I 2IA2A 1TQIA 2DOAA 5J6XA 3GTQJ 3A6TA 1I39A 2EFPA 2YPRA 5DD4A 2V6EA 2PJRB 2LY1A 1JI8A 2M8EA 4ZZLA 1T38A 3C2GA 3F72A 5BMZA 1HOMA 3KFWX 1R36A 3HRMA 3MMYB 4YELA 1XSBA 2P81A 2F4IA 1FTZA 3H9GA 1PVEA 5CVIA 4E7HA 1R1TA 3I59A 1R1VA 1FPQA 3TO7A 3HYIA 1AKHB 1RC9A 5E1XA 4NDLA 1YYVA 2GQQA 2QUFA 2VE9A 2HXIA 4WK8F 2ZO4A 1D0YA 1ZTRA 5J8FA 2HNHA 2R7DA 1BJZA 2FJ1A 2P8TA 1X19A 4RMNA 4BE0A 3KP3A 2OTJI 4G6TB 2IA0A 3MQ0A 1SD4A 2O61A 3E6BA 4YPHA 2L7MP 1UCRA 3RZDJ 3U2RA 2A8QA 2I8UA 2ZC2A 5CJ9A 2BVLA 2IGOA 3V42A 3KX2A 1FYMA 1RKWA 1H8AC 1T08B 4B1RA 1IW7F 1X3ZB 3OR2C 1ZRDA 5GTIC 1KT9A 3TDZC 2DFEA 4M3FA 5ED4A 2NVQJ 5GTHC 1IXCA 1Z77A 2XGXA 3HG9A 2P4WA 5DUIA 2CJJA 2CWEA 2AXTC 2M8GX 5BS6A 4HF1A 2VXZA 4IJXA 3VYRB 4EGYA 1I6XA 2VC0A 2F5VA 1XD7A 4NNJA 5FROA 3QPHA 5EDNA 3H0GJ 5TJJA 2GT4A 2OPTA 1FMVA 2YU3A 3BR6A 2IS4A 1PUFB 1W5SA 3TBIA 3OGAA 1TQMA 1XSVA 4ABZA 5D6EA 2H6CA 2DQRA 3E6DA 1BL0A 3OYMA 5LLQA 1KYZA 2FBIA 4P9UA 1IDYA 3S14J 2XF7A 2W00A 3N05A 2I8TA 5LBQA 2P5VA 1OJLA 4F7ZA 4OOIA 2VUMJ 3ZMZA 5M3FJ 1VFCA 1NG6A 5HDGA 4ESJA 2O8KA 5ANTA 5EEHA 1ODDA 1R6RA 4V19K 4J7HA 3ZCOA 4CZZA 1V5GA 2Y69H 3REOA 3JW4A 1OCPA 2OBPA 2L9RA 3BAPA 4DYRA 3L2RA 2M34A 3EUAA 1BC7C 1MMDA 3MEXA 3TW6A 1PVFA 2A61A 4FHTA 4IQJA 3WTUC 5DCFA 3WU1B 2KDVA 1X1BA 2ICWG 3RYRA 4C3JJ 3HUGA 3LFKA 1U3EM 4ZYHA 2VNPA 3FCMA 3GZ5A 1VI0A 1K83J 3G4SI 4XMYA 5A2QZ 3RSNA 1RR8C 2V4JC 2DT5A 4NHJA 2E19A 4I01A 4UUSA 1Y1VJ 3IRQA 2C6YA 3EETA 3AFHA 3GFLA 1VHZA 3GF2A 3P6YA 4OIOF 4XONA 4EJOA 2FBHA 4CDGA 1SZ3A 4I99C 2KDWA 3A02A 2R7RA 2HVSA 2KKOA 1K6YA 2ZJ2A 4KN4X 1LKXA 1A6IA 2OAZA 3SJMA 1YTYA 3TQNA 2HTSA 5EG0A 1R5ID 2PEXA 2WA0A 5KAIC 5D5XB 3CMEI 3CCVI 3Q91A 1FIPA 4YIIA 5K7FA 4HLXA 1WJEA 5EJCA 4UNOA 2XSQA 4U0VA 3O61A 4BL0B 2Y9YA 4IOAF 2QKLB 2QQ9A 1LVKA 5LPGA 4E7LA 4KDPA 1A31A 4XLHA 1X1CA 3IAM2 1D1CA 1QPMA 5E1ZB 1K4SA 3VOEA 4O5VA 4N1UA 3S2HJ 4RGXA 4EMSA 1G4DA 2X48A 2ZB9A 1S7AA 3V8JA 3TP3A 3L2CA 3B73A 1KU3A 1R4MB 1VQ4I 3B02A 1B6AA 2ID3A 5FLXZ 3A1YA 2RRKA 4UVAA 3GLXA 3CCYA 4IOCF 2LK2A 1O57A 3CLOA 4R8HA 3GZ6A 2EIMH 3DTIA 1KHZA 1WRJA 4E7SA 3LSMA 3O8HA 3GFIA 4BKXA 1JHFA 1F1ZA 2CGPA 2MC4A 2FUG2 6PAXA 3NAUA 4BHBA 2P0WA 2BZTA 3J7Ye 4KTBA 2RNJA 3GMEA 2IVMA 4KT6A 3HPGA 4Y33A 4BEHB 2JVBA 1SEUA 1FBQA 1RZ4A 4ZG0A 1SFUA 1MJBA 2OV7A 4HAMA 2H6BA 2KT0A 4KIBA 4XL9A 1I6HJ 2X6XA 3E5QA 1VQMI 3I53A 1VQPI 4E6KG 2VXDA 3QRFF 2WAFA 3ZQQA 3JTGA 4I98B 2XB0X 4WWCA 4XK4A 1XTAA 4A0ZA 2E2IJ 2X6OA 2E1OA 3S1NJ 3OS2A 2ESHA 1BI0A 2N8GA 4HX4A 2EQRA 2DLLA 4DJAA 5F64A 1S7EA 2G0EA 1QGPA 4HEA2 1X51A 1R58A 4MO7A 2NRAC 3R60A 4JZTA 3DBHB 2COMA 2XAQA 1VQ7I 1MMNA 2EFNA 3FIWA 2XV4S 3CCSI 3CC7I 3EESA 4EJWA 2EH3A 2QQ8A 3WTYC 4EGZA 3EDPA 5CVVA 1X2NA 1LJ9A 5K7ZA 4RGRA 4RGUA 2DAOA 1SANA 3QU6A 1XX5A 2EFQA 3PUBA 2J8QA 3OYKA 2O9LA 1XSDA 3SYTA 1J5YA 2FNPA 2A5WA 2R5ZA 1YO5C 3DKYA 5FSIA 5DDGA 4MFEA 1YJ9I 2L2OA 2Q0OA 4IHTA 3I56I 2GOMA 1G8XA 1UMQA 4J19A 2LYCA 3V7RA 5LGNA 2IBDA 2IS1A 4IVNA 1MMAA 2X51A 3WGIA 4E7KA 1QQIA 1YJWI 2QJTA 2QGUA 3J80Z 1TL8A 2LH9A 2K3FA 1SFEA 1IJWC 3CCEI 2FU4A 1P7JA 5FKKA 5E79C 1FT9A 3LSRA 5CKTA 2ZMEA 3HHJA 3DKXA 3O52A 2CUFA 5EGOB 1USTA 5ICCA 3W2VA 2VBXA 2KIUA 2LVSA 1IXRC 2JA2A 3CDIA 2CZRA 4UVBA 1NH3A 4PSWA 2XGDA 3DP7A 4RBOA 2IGNA 5BPIA 3CLQA 2X1CA 3QWLA 4O3MA 1FX7A 5FKOA 4OAYA 2K86A 5DCMB 2R7XA 2B06A 4QSHA 3AC9A 5IPAA 5CLSA 1BR1A 2K9MA 3SXYA 3S3MA 3J81Z 1FSHA 4CO8A 1AKHA 1W36C 3FXQA 4LITA 1BM9A 4LGWA 5L3EA 4L5IA 2Y48A 2UWMA 5CQEA 1IUYA 1K2EA 3WTVC 4RA2A 2JVGA 2DMUA 2KDOA 1W7PA 1XDUA 4XQFA 4UV8A 4JOMA 4OWRB 2FQ3A 3FMQA 1PDNC 2BEOA 2XF5A 5BONA 4EM2A 4RB1A 2DQLA 1KZHA 4YG2F 1NQZA 3LA7A 4G12A 1ZK8A 3SDGA 2GBYA 2L3DA 4RLFA 2D1VA 1R71A 5IOYA 1GVDA 2JPCA 3OY9A 1S7OA 4GYIA 2VL8A 1X1AA 2OD5A 4C9YA 1LE8B 2L02A 3M1EA 1EA3A 1PP8F 1S5LC 1G3YA 2ME6A 3LNQA 1JKQC 2QKMB 1VF9A 5ILUA 3OS0A 4HBLA 2OQRA 3SZGA 2B0VA 2GZWA 2V1DA 1WGXA 2LR8A 3K4BA 2P6SA 4RAFA 3I4MJ 4Q5SF 3CCUI 2DTRA 3KP6A 4L9NA 1T95A 3GTPJ 2LC2A 1U8RA 2GA1A 4GCVA 2B2KA 4U0YA 1Z9CA 2RAEA 3BOQA 2A69F 2YSRA 2LDUA 3HM5A 3VEPA 1QU3A 3FXLA 1U5TB 1TTYA 2DFHA 4ESFA 1G3WA 3RJPA 1FJLA 1TWFJ 4JQFA 4XN0A 3HOVJ 1Q33A 3M9AA 5TRDA 3DEWA 1OCTC 4B43A 1ETYA 2FNAA 1REPC 1ZYRF 2BE5F 2GWRA 2GIZA 3WGGA 1FC3A 3ZQIA 4BQOA 3LA2A 1XMAA 4A6DA 2MGQA 2MW8A 2LOOA 5FLVA 4E7JA 4MHGA 2FQ4A 1IN7A 2F5EA 3KP7A 2BY3A 2HQAA 2COBA 4IHWA 4UUTA 1IV8A 3CC4I 1N77A 5JFRA 2CRGA 1ZR2A 1FEXA 4MIMA 3TGNA 1A04A 3FXKA 1OMIA 1GUUA 3K4MA 4PFPA 1TQPA 4ZZDA 1R23A 3GTKJ 1ITYA 1WJFA 3SZPA 2A6TA 2A07F 2LNBA 3NQOA 3GCMA 3RH7A 3CCMI 3O2PE 2RQQA 3IAS2 3JCUC 1BN5A 2KJBA 1AHDP 1S8NA 3HOXJ 2W1OA 1R67A 2KRCA 1WI3A 1GXQA 4FQGA 2DDBA 2R7OA 2WAQN 3IH3A 2ME0A 2K9QA 4PJNA 3OSGA 2QYOA 2NS0A 2PI0A 3OWTA 2NNNA 4PCQA 3BPVA 5IT9K 3LSTA 3T8TA 4I0AA 3UKGA 3M4OJ 3DTKA 4DYQA 4PDKA 3SZTA 4A5NA 4FX4A 1IGNA 2Z16A 5TGTA 1YRNA 3CNGA 2EBIA 3G0QA 3FK9A 1YJNI 2RV8A 1X2MA 2WAQA 2VNQA 2PJPA 2DDAA 2VQGA 4C9WA 2JUCA 5AIPA 1OW2A 2ESNA 1F4KA 2Q1ZB 2GM4A 1JRKA 5JHUA 3LWFA 3CMMA 3PIPF 4U7DA 5ANUA 1WJCA 3HSRA 2DA3A 5H20A 3FHZA 1K4TA 4F92B 3WODF 1OR7A 3F8NA 1SMYF 1XCBA 2F5CA 1FSEA 2M7AA 2P7CB 5D5UB 2OTLI 2F48A 3QQAA 4LG3A 4QTRA 4X0GA 3ISPA 1E3OC 2KFDA 1J59A 1X58A 4XN3A 3ZQHA 3RTRA 1U8BA 2X1EA 3MGMA 1LVAA 2R7VA 1CF7B 3IWZA 3WG9A 3RQIA 4J00A 2DHOA 4AYBN 3HHHA 4HNVA 4A12A 3L2UA 2NOGA 3BTJA 2UXNA 3G73A 3A0HC 4ENMA 3SQNA 2HGCA 4LG0B 3BC8A 5ILSA 1ZLKA 2IPQX 2XRNA 3A01A 5JVGF 2HYGD 5C7TA 4CYCA 4I09A 4A0XA 3WGHA 4B48A 4CH7A 1KU2A 2R93J 4XRFA 5H6QA 2MSYA 4U88A 1R4NB 2VKHA 5BOXA 3EYYA 4AYBA 1D5YA 3GBGA 1MMSA 1RETA 1MBHA 3LSKA 3L2WA 2CG4A 1R9TJ 4BGDA 4IHSA 3ZMSA 4BBSJ 1LDJA 3BG7A 3H1CA 1T56A 2IGKA 1V55H 4L0ZB 2ZFWA 3HYQA 2ZJRF 5LD2C 4IPAA 1SD5A 4A3EJ 4ZH4F 1VHGA 2FF4A 2LP0A 2YS9A 4RM3A 2LBFB 1K78A 5JLWA 1YIJI 3BZKA 2CL3A 2Q2EA 4G94A 2LKXA 3PFYA 4AIDA 2L7FP 2D5VA 2R7SA 1IRGA 3SMDA 2E1MB 1P4AA 1Z3YA 4IF4A 5FFXA 1Z7UA 4F55A 1Y56A 5IW5A 4G7OF 1ZARA 2KJCA 3P5JA 1ON1A 4XNFA 4A5MA 3HGGA 4HFQA 3HL2A 2CQXA 1OKRA 2OJED 2P6TA 4UXNA 3V8LA 3TW7A 4AIJA 1ZHFA 5IP9J 2E7XA 1P4WA 1W7PD 3BHOA 1JXSA 4NC7A 2RREA 2OZ6A 2RKHA 4M6XA 2GXGA 3ZP5A 3Q0WA 5F0HA 4UHTA 4YFKF 2I10A 2DSDA 4NC8A 5DTDA 1L3LA 2F5FA 3HXLA 2MABA 2JSPA 1FWZA 2V9KA 1W36D 4XLCA 3S2WA 3LSGA 3TL4X 1VQOI 3B6AA 4RAGA 1Y8RB 4HA8A 4N4OB 1J09A 4EATA 4NUBA 4CGZA 1NTCA 1YX3A 5E1WA 1B72B 1XG1A 2HYFA 2XPWA 4I2OA 3V4GA 1MIJA 1BA5A 1T6SA 1U9NA 3FXMA 3K4CA 3HOYJ 4XLNF 2AS5F 2P5LC 2Y0SA 2STTA 1O7FA 3COUA 1R49A 4HVYA 4A6EA 3IKVA 4BQQA 1SJYA 1T2KA 1DU6A 3I54A 3GTGJ 1SU2A 2W48A 3T8RA 3X2QH 3QPLA 3Q0VA 4I76A 3ZMDA 3P5TA 3TO9A 3Q2SA 2EZLA 4N1TA 2X6WA 1KGSA 2DA5A 2XGEA 3I9XA 1QA6A 4OIQF 2WADA 2CU7A 2K3PA 4DIQA 1IUFA 2IA1A 1IV6A 2YU9J 3BROA 2F2EA 3VYUB 4L18B 1KU9A 1X1DA 3OV8A 2HFHA 2DBBA 3I64A 2DK8A 3P7NA 1I27A 3U1DA 4V2GA 2Y9ZA 1I9AA 3GW2A 3ZMTA 4LIUA 2HQRA 3KZZA 1SVMA 1XGOA 2IAIA 3L00A 1E3PA 1FOYA 3G3ZA 5GADJ 2EA2A 4KITB 3DLLF 3JTHA 4Y17A 2Y75A 5BQTA 4AIKA 2QENA 2WB1A 1N75A 2HXOA 4ZYEA 3MKWB 2DA7A 1WJ5A 3K1NA 3U53A 3HIFA 4CA0A 3ROUA 5F27A 1W0UA 5BNGA 3B6CA 1VC9A 3SFIA 3X0QA 2WC2A 4A3JJ 5FSMA 4IHYA 5C8LA 2KDZA 1U9OA 2DSBA 3GZ8A 4N4NB 1EH8A 3QP6A 3BG3A 3KYLA 3LSIA 1V3FA 3OOUA 1XMXA 4M9XA 4IX7A 4A3BJ 2CUZA 1MBEA 4Q4ZF 3VDXA 2WV0A 2YR2A 5IYCJ 3WTWC 3N4MA 1I3AA 5ICEA 1LFPA 1X84A 1H88C 2BXYA 3RIRA 5A2QK 4OAZA 3PO3J 5D4SA 1GA7A 3BTIA 1XCVA 2BY1A 2WAEA 4OIRF 1FLIA 5HS8A 1HDDC 1MQEA 3P9IA 2MYSA 3BCBA 1MW7A 2J5OA 2AQFA 2E60A 3MN2A 1WWXA 2CW0F 2QZ8A 4BJTA 4P9FA 2JMWA 2ISYA 2IJLA 1RUNA 1EH6A 4JK1X 4IO9F 1YX5A 1V8LA 2HVQA 3A03A 4XM3A 3S1RJ 1XPXA 4A3FJ 1YS6A 1UELB 2FXAA 2GXAA 4YEJA 3F23A 2HR3A 4RB3C 2ADUA 2ZFUA 2OU2A 1G0SA 1PPVA 1ENHA 3S1QJ 1R1UA 2W84A 5ICFA 2P5KA 3JSPA 1A35A 3HPHA 3I0TA 2BW3A 1QPIA 3C2BA 1OCRH 2QA4I 2XPUA 1MBJA 1LDDA 4S2WA 3ZQCA 2DA1A 2ID6A 4ZDLA 5DM7F 2QBYA 3J7AY 1VNDA 1IC8A 2QSFX 3KYCB 3GG6A 1QRYA 2BVMA 2K9SA 2R7TA 3AL0B 4QPOA 3BWGA 2HQNA 2VKVA 4B3AA 2M1BA 3CO6C 3K1MA 1GHCA 4MQ9F 2FX0A 1J7KA 3RYPA 4DBQA 2O5WA 2DMTA 3K70C 1GXPA 3CDHA 1G3TA 3F9KA 2ELJA 5E20A 2Z9OA 4KG4A 1JE8A 1YITI 1B8IB 4P96A 5AONA 3F13A 2YX7A 2K9LA 1OYIA 1FIAA 3BR2A 2Y31A 4MTEA 2AQEA 1S29A 1PYVA 1TP4A 4IXAA 1HLVA 5J4VA 3F22A 1BI1A 3BG6A 2JA6J 5B1BH 1FMWA 2VBWA 3C18A 3RKWA 3CZ6A 4S04A 1MJAA 5LGUA 3KEYA 1S6LA 1ZGWA 1B9NA 3GZNB 1JKOC 2UUZA 3K69A 4AD9A 4HYEA 3OYFA 1VQ8I 3ULQB 4UV9A 1OLTA 2PN6A 1Q1VA 1J75A 2NNYA 1OFCX 3Q9VA 3DU5A 2QLZA 2FKBA 1OCZH 3BT9A 5JR3A 4P1WA 4L0YB 3F3XA 2IP2A 2LKPA 2YX4A 2WTEA 1I3QJ 1MBKA 1P4XA 2X1DA 4PSXA 1IO2A 1DP7P 3PNVA 3J7AO 1NFSA 2XB5A 4CCMA 4M3GA 4IRHA 5C7QA 3I4PA 2KPMA 3FMSA 3D5RC 4CCOA 2ECBA 4IHVA 4G6QA 3BLYA 1X1PA 1JT6A 1HBXG 3CUQC 2YVMA 4BDYA 3DXJF 5FB2A 2ELHA 4KN7X 3MWMA 4UB6C 3NEUA 2BY0A 1GDTA 5E8GA 1MNMC 5LEJA 3E5UA 3X0PA 2BHYA 3OYNA 2BGCA 3RPUA 1ZQ3P 3J80K 1K6OA 5F6FA 3FBIB 4HZFA 3BG5A 2MC3A 1UG0A 2TCTA 4JZSA 5JI6A 2R5YB 3KP4A 3D5LA 4HLYA 4YIFA 1N25A 2NAZA 2PLYA 2GB5A 3CUQA 1UHMA 3H5RA 4JBAA 3H3UA 1DPUA 4A69C 1YHQI 2ETHA 3GLLA 2DODA 3ACAA 4II3A 2YUSA 3CTAA 1I1SA 4E7IA 1KQ9A 1X4PA 3WG7H 5J3LA 1K26A 3ZQLA 3K4LA 2VQHA 5E3LA 2LREA 4C9XA 2R5WA 1WPKA 3JR9A 3DKWA 1LQ1A 1DGRM 4GXOA 2WWYA 3M8EA 4OMZA 3CF5F 2OA4A 3CUOA 4PUSA 5L3DA 3FM3A 2R7ZJ 3GXOA 2XASA 3WTXC 3OS1A 3BP8A 5FLMJ 5DS9A 2ZXHA 1Z6RA 3LSJA 5FSNA 4NQWA 4JX4A 3Q4IA 1RNLA 2PBIA 4D7NA 1KU7A 5K7HA 2R7UA 2QM3A 3IC7A 2O1CA 2L5QA 1HF0A 4RB2C 2K7LA 3OYIA 4N0BA 1EKEA 2M5WA 3DLAA 3Q93A 3FZVA 3HHGA 3HRTA 1NK2P 3HKZN 4F93B 2HEOA 1D0ZA 2IW5A 3K2AA 1VQ9I 1JJ8C 4ICKA 4BXFA 4IL6C 2O03A 3ZQFA 1RESA 2DMNA 2VJ5A 1U2WA 2EJRA 3S2DJ 2VPRA 2DO7A 4LB6B 2L0KA 2MA3A 2XAUA 3JRDA 2OF7A 2CW8A 4M74A 3GTMJ 4MEYF 4NC6A 3U9GA 2PQVA 2XAHA 1O7LA 3HKZA 4DOZA 4V14A 2ZMEC 2L7ZA 3R0AA 1D1AA 3PL8A 2CMPA 4G7HF 4NB5A 3H3ZA 5L3CA 3L9FA 1LFBA 1JUPA 3K0LA 4XSZF 4E4HA 1BC8C 2Y2ZA 3NWTA 4UUVA 1GLNA 2FBKA 1IN8A 3DKUA 4M9ZA 3F6OA 4A3DJ 3BR0A 1P7IA 3LAJA 1LB2A 4BACA 3IP4B 5J40A 1LNWA 2EZKA 3FXRA 1BOBA 5L3GA 1DGWY 5CPRB 1VQLI 3X0JA 4AVPA 2ACJA 4Q48A 3ZXSA 3E1SA 2PJRA 2EILH 1BI3A 2AHQA 3WE3A 3KYDB 2DT6A 3A6UA 3FKIJ 4GRIA 4D0PA 5E18F 1KQ0A 2K02A 3E6MA 5J1RA 2EA4A 3H9JA 3I71A 3O6BB 4LOCA 3LFUA 4XLFA 3QSJA 5HS9A 2O5FA 1AU7A 2DJIA 4M3EA 4Y15A 3QAHA 3R4KA 1G6NA 3R0JA 3S32A 2ZXJA 1ZR4A 2H94A 3H35A 5B66C 2H1LA 3EXQA 3DBLB 3H92A 4AVZA 1UB9A 3KETA 1I50J 3A4CA 4I0BA 4EJVA 3ZMVA 2R4GA 4ZC3A 2IT0A 1MDMB 2HYJA 2F5DA 5HDKA 1H0MA 1V8TA 3ONQA 3ZN1A 2HWVA 3FXUA 2NS8A 2CFOA 4S2YA 1D8KA 1MBFA 1OYYA 3HSFA 3H0DA 2ZXIA 4QIWN 1KYWA 3K70D 2KMUA 3L09A 2JWTA 3FBNB 2X4HA 4RDUA 4A3KJ 4LIVA 4MGRA 3WE2A 5FD6A 1KQ8A 3AG3H 1Z21A 1VC8A 1SD6A 3ABKH 5CVRA 1RPWA 2PG4A 4S05A 2BV6A 4BY1J 2EPFA 2DSCA 1QVUA 4WXDA 3VFZA 1VIUA 4L5JA 4XLEA 4IJAA 3IKTA 3OL4A 3K4NA 2O3FA 2NYXA 1AWCA 1RIOH 3HOSA 2IRFG 1XGNA 4Y13A 3C7JA 3X0LA 4ENNA 1HSTA 1IRXA 2KL4A 2O8XA 3U21A 1SD7A 4M71A 3WTSC 3OYHA 5FRNA 4GO1A 2JJ7A 1PUFA 2M9HA 1LEBA 3T1BA 2W4SA 1XN7A 1V8WA 3BJ6A 4JP0A 2KZVA 5HLHA 1ZKGA 3HTSB 3CP8A 4RGSA 4J7GA 4PZJA 2JQ7A 3W6JB 5LHGA 1B9MA 3S3OA 1EF4A 1Y1WJ 3RPUD 4KIGA 1WKMA 1BW6A 4BU2A 4J01A 1MKMA 4PJMA 2DMPA 2W82A 2M0MA 4P55A 1X83A 1SAUA 3G1LA 5GHJA 1LFUP 1L0OC 3OYEA 5HLTA 3A0BC 3VYSB 3LA3A 5LGTA 2DYSH 3LSPA 3BZCA 2OZUA 1ZRFA 5FSLA 3I59B 3L7WA 2M7BA 5HLIA 1VQ6I 1A5JA 4EQQA 2DK5A 3MCFA 1YW7A 5CFIA 4GFBA 3SDBA 2F4MB 2KLOA 2QQBA 3BQYA 2L4MA 2CV0A 1P6RA 1BIAA 3PNYA 2W7NA 2GLOA 1CQTA 5E3OA 4ZJZA 5FSKA 4OMYA 3FJYA 3N77A 1E0EA 2EK5A 3HRSA 2YVNA 3DEUA 3VSKA 2K4BA 3KZIC 1VZ0A 5FKNA 1C0WA 1ZLJA 2OQGA 1POGA 3DQVC 1YI2I 2XAFA 1JJ6C 3MDIA 3V7CA 3CCLI 1J0RA 3V7SA 4BQAA 1OR7C 4XKBA 3EYIA 2R7FA 2A8PA 1BJAA 4KICA 2DOFA 3K7AJ 3AAFA 5L3BA 3I4NJ 1V8YA 2XUBA 2RN7A 4MLOA 5LHIA 1ACIA 3G1OA 3MVPA 3TOAA 1EJ9A 3A6SA 1JKPC 1STZA 4M9SA 3L85A 3CD6I 3GVAA 2DYRH 3MZHA 3M8JA 3Q9SA 2JK3A 1U78A 4CHUA 2JRTA 1KTGA 5CVUA 5LRRA 5JLXA 5LRSA 1E2XA 3J7YJ 4C2UA 2G73A 3NRVA 4DZJA 1TZLA 1B1BA 5IYBJ 5ICGA 2HZTA 3IL2A 3GTLJ 2VPLA 4A3GJ 1Z1DA 3K2ZA 1ETOA 4ESBA 3C3WA 3BDDA 2CW7A 2VI6A 2VASA 2X9DA 1BOAA 2ICJA 4ILQA 2HDWA 3AKZA 1D5VA 1GT0C 3P9KA 3FM5A 2IXSA 4AWXB 2PX9A 3F8FA 2NXNB 4HF0A 3ZQGA 2K4JA 2E71A 4A3IJ 4BH9A 1V8NA 2P7VB 3PSIA 4IRIA 1FOXA 2KIQA 2HTJA 3JAMZ 1NK3P 2JTVA 2NVTJ 4XKWA 1Y6IA 3MCZA 3CF2A 1ZGJA 4DQ2A 1MR2A 1PPXA 2HQ5A 4BEHA 1N78A 3QOEA 2R3SA 2ZSHB 4U87A 2PMHA 3W2WA 1IRFA 4FASD 1UG2A 5LEKA 1YQAA 2JZYA 3GRNA 2AZWA 3HOUJ 3VYTB 4MNUA 3E0JB 3SFZA 2NOJB 5J1YA 1YFHA 1RRQA 2VBZA 3HUGB 4BXUA 4A0YA 4D7MA 2RNGA 2Z99A 3S17J 4KYWA 4FETA 2Y0MA 1ZH5A 1ZGAA 3GWZA 4FISA 3HBLA 2OC6A 1MBGA 3O69A 1JHHA 1R22A 2L7KA 3ABUA 1RYAA 4UUSB 5L3FA 1TLHB 1YS7A 3K4KA 3RKXA 2GAUA 4K6EA 2RC4A 3G2BA 2FMLA 3ERMA 3OYAA 2H8RA 3ECOA 1JKNA 4ANJA 3GX4X 2LD5A 3K10A 1SAXA 1S3JA 2A6EF 2KISA 4ETSA 5HZXA 3CJNA 1DP3A 3ZR8X 5EG0B 2MD5A 1HW1A 3E97A 4WXHA 2XGCA 2OCCH 1D8JA 5M5YJ 4HQEA 4DNCA 1HW2A 1WSUA 2DOEA 2HS5A 1IF1A 2VBYA 4RAZA 1IN6A 4CCNA 1J9IA 1UJ8A 1MNDA 4D5CA 1V8RA 5GHQA 2IEKA 1XSAA 2E1CA 2K5CA 1P92A 5BPDA 2LY9A 1WI9A 4DYCA 5IP7J 5EGOA 4U7BA 5IT9Z 3S93A 4CSWA 4Y7NJ 3X0NA 3RKYA 1X4OA 1D0XA 1IAWA 1HKQA 3CMAI 2LF8A 4B44A 2ICKA 1XDSA 5DCMA 1OPCA 2QSGX 4HQMA 2M45A 5FFZA 5HDNA 3EF5A 4NFXA 4KT5C 2EV6A 2G7UA 2XHKA 1X3UA 4YIRX 4IRGA 1MH4A 4L5EA 2DA6A 2A8RA 1PP7U 1U0JA 5LHHA 5D5VB 3QODA 4D9JA 3CO7C 4CICA 2FEZA 2DI3A 3ZRGA 1Z91A 1P9QC 4HV6A 2AO9A 1MUTA 4II2A 1IN5A 2M87A 2X85A 3KCCA 2VJ4A 3PM1A 1WVRA 2LTPA 3Q2TA 2V1XA 2NS7A 3DU6A 1RRSA 3BJOA 5HODA 2F4OB 1MK1A 1WZ2A 3DF8A 1UZCA 4MTDA 3F8BA 3GEZA 1BIBA 2CQ7A 2M0CA 3PFIA 5E3MA 3HZJA 2L9SA 2DW4A 5KVRA 2CYYA 1KONA 1U5TC 1B4AA 1LE8A 1NQYA 1PUNA 3LMMA 2HZDA 3MAJA 3FK6A 3DEEA 2VE8A 3OSFA 3ZR1A 4MPOA 5GAEJ 3VWBA 3F0CA 2WV1A 2CUJA 2ZNZA 5IP6A 4G7ZF 2EV0A 3M8FA 3QP5A 5IOZA 1HA8A 3ZGKA 2CS3A 1TNTA 3ABTA 2XF6A 1Y0NA 1G2HA 4G8XA 4EEFG 1ZAOA 1V5FA 3D1NI 1QVJA 3OYBA 4FE4A 3BG9A 4PGGA 1SFOJ 2JA8J 3Q1PA 1U5TA 2CV1A 3BQZA 3A2KA 2A8TA 3FWEA 5I8UA 1TW2A 5B5EC 4JX6A 1NFZA 4ZDOA 2L01A 3KP5A 4JZVA 4QWQA 4UB8C 2O7OA 4LLLA 5ERIA 3FMRA 1BR2A 2F6CA 1VQNI 4AM3A 2H1KA 1F9NA 2VT2A 3TO6A 2FA5A 3DPLC 2DFIA 1S9HA 1MSEC 3VODA 1QZYA 3G1MA 3CP2A 3FXJA 2ZJPF 2TDXA 5HNHA 2JSCA 1R5HA 3WHCA 5KHDA 4XRMA 3ID9A 5ANWA 2ZMEB 1WH7A 4OU0A 3LQRA 2Z3YA 3FDYA 3I7UA 2KQRA 1V8UA 1MJ9A 3LSHA 4Y52J 4BS9A 1TT5B 3EPZA 4ZTJA 4OIPF 1Z05A 2XSJC 4KG3A 5JVTA 3M7GA 1ETQA 3BR3A 3K6GA 4ZYAA 2MH2A 4XSXF 5E3NA 5B3SH 2VLAA 3FF5A 2RDPA 4DW6A 1K7AA 3BR5A 2EFOA 4B8XA 3ABLH 1AA7A 3HRUA 1TWAJ 1QZZA 2E34A 1T33A 2VT3A 4I7HA 2W25A 1ZG1A 3GYHX 1JKRC 4HSRA 1DDNA 5HS7A 4KJZA 3TOBA 3BJAA 1W7PB 1IDZA 4XKCA 3BZ6A 2KHMA 5DYMA 2D2WA 4DYWA 1NG7A 1YE9A 4HG2A 1RRJA 1VIQA 5FLXK 2D45A 1SVLA 4EJTA 4KMFA 3K1PA 2VQLA 3JRFA 2HKOA 4HDUA 2HDDA 1FOWA 3MKYB 3UR3C 1QO0D 2HOSA 5FJ8J 3RPQA 3BY6A 2VIXA 1X3WB 2Z1DA 4IZZA 1TWHJ 4HOBA 1JT0A 4NBQA 4GGGA 4K2EA 1MSFC 3MKZA 1XGSA 4B3XA 1FYLA 3I7VA 4D1QA 4AU7A 3OYLA 3ASOH 5D4RA 3SONA 2V7FA 3X0KA 3X0OA 3Q3SA 3IUOA 4EJUA 1T8IA 3JREA 3KLNA 4IHXA 3LOCA 1E17A 1IG7A 2V6CA 4ON0A 1JUSA 2KZGA 4KISA 2DUKA 2CQNA 2VKDA 2QEXI 1V8SA 3KZYA 1CF7A 4M6YA 3PO2J 3MKLA 2O5RA 1RI7A 1IRYA 4BE2A 1WH5A 3DFGA 1XC5A 3HGYA 4WX9A 1UFMA 2JT1A 3KPHA 4LD5A 4N9IA 3ECHA 2DA2A 2B0LA 1AOYA 3QYFA 1G9QA 4A3CJ 1XGMA 2BYVE 5CQGA 4LG0A 1UHSA 2W24A 5EEAA 4KYXA 1J2XA 2YYHA 1ON2A 3HOWJ 5FD5A 4PGHA 1EH7A 3H9QA 2R7QA 2VJIA 2ELKA 2V1NA 2E1MC 2HOEA 3BPXA 2L9VA 4YFNF 1WCMJ 1Z7LA 2ZXWH 1XSCA 2M3AA 4QLCU 2QF7A 2BBYA 1TUMA 3O3KA 2A05A 1WQ2A 3I55I 2XVCA 1W5TA 4Z2YA 5FSOA 2VJJA 2LBFA 1TNSA 5F0FA 2H8WA 3PUFA 4HRIA 1USSA 1YOVB 4G6DA 3D0SA 3LQQA 2A8SA 1TW3A 4XLPF 3HOTA 3L2QA 5HNFA 4LLGF 4B47A 3KP2A 3Q0UA 5GHMA 2V9PA 2MLGA 4C30A 4H0EA 5FKLA 4CZCA 3FFUA 1PUSA 4XR6A 2QQAA 2GOXB 2ZSIB 5DM6F 1YRNB 1RR7A 5F08A 5J1UA 5D8LB 5E8IA 4DZPA 2MFZA 3M3YJ 3FHNA 4C2MJ 3J81K 4BDZA 2XRLA 1MP2A 2A6HF 4DGWB 2X0LA 2VQCA 2IGMA 1F43A 2LY2A 5H6RA 2PMUA 1ETWA 1V8IA 1SOIA 4E7ZA 5GHIA 2LRDA 1GV2A 4LK1F 3OYCA 3AG4H 4AUXA 1F5TA 1G59A 1B72A 4M6VA 5CVJA 4BBRJ 3HB9A 1O3RA 5GHNA 3I3LA 3MFKA 1DU0A 1B59A 2MBFA 5DEQA 5B1AH 2QCOA 4ZYDA 2WY8Q 4GYGA 4XKVA 5CFJA 2GIVA 4BAYA 4JX5A 3QPSA 4KA4A 1IRZA 2LFBA 2QJOA 4HF2A 1V8VA 2DA4A 1S72I 1HSJA 1P2FA 4KUMA 2L54A 1GV5A 1OISA 3AG2H 3IHUA 3X0IA 4CCLA 3EQLF 3X0RA 3PSFA 3E5XA 2Z33A 2HU9A 1QHGA 3A01B 2ZJQF 2G7HA 3ASNH 3F8CA 3MZYA 3C1DA 2BHZA 2EINH 3CJQB 4CYCB 3GTOJ 1ZN2A 2K9NA 4HX7A 1HKSA 5J8CA 4UY8I 5EF6A 3ZQ7A 3DTEA 5IYDJ 1Y39A 1FNNA 2EV5A 2Y30A 1R5GA 3UNGC 3MZ8A 5IT3A 5GAHJ 4HDVA 1E3HA 3M1CA 3RQ4A 2W85A 5F1JA 3O6ZA 2E1NA 2FE3A 4BJ5C 5EZGA 1R00A 2HDCA 1MH3A 1JTXA 5EEGA 4CCJA 3HSEA 2GXBA 3CJRB 4G9YA 3FKJA 3L1PA 3TEDA 3F6VA 1ZG5A 5ILVA 3WU0A 1K78B 3EUHC 3K9TA 4WF2A 4Y4RA 2J5PA 1PUEE 2Q2EB 2E2JJ 3S3NA 1HC8A 1VTNC 5HLGA 2HOTA 2FMYA 2PQ8A 1XMKA 2L9NA 4XRSG 3BTLA 4A2UA 1TBXA 1V5EA 2GA2A 2DXIA 4HX8A 2CQKA 2V1UA 2B63J 1Z3XA 3KEOA 4ASNA 3DCFA 4QPQA 4HW0A 3GO5A 1KA8A 3S16J 2K27A 4JYKA 2M30A 2WBMA 2XROA 2PMZN 1SFXA 3GFMA 4L9JA 3WHBA 2EB7A 2HPIA 4BHPA 2STWA 1BI2A 1MMGA 2LLKA 2VKEA 4FE7A 3S15J 3KEQA 2KRFA 2LF7A 3E7LA 3EUHA 1YG2A 3GUDA 5D8KB 3IV5A 4KMUX 2XIGA 4Y3OA 2E2HJ 3GTJJ 2L4AA 3GWYA 1TWGJ 5GPCA 3DUPA 5CYVA 3PIOF 1W5CC 3TP0A 5GP9A 2VODA 5DPKA 1Y8QB 2DMQA 4CUGA 5GAGJ 2RQPA 3KIOA 4KNYA 1YIOA 4EV0A 3IWFA 2PMZA 5DUKA 1FP2A 4HPQA 1SMTA 1QZEA 9ANTA 2XAJA 1I1GA 4XRSA 3X0MA 1HW5A 3ML6A 3HEFA 2BXZA 1A36A 4B09A 4WCGA 4ENKA 2V79A 1JTYA 1RUOA 5HOOA 3AL0C 5F04A 3VSLA 2Z5UA 2O0YA 5C4JJ 3A6VA 2G9WA 2FD5A 1PPWA 4L9TA 1FP1D 4MQVA 5FGMA 5J47A 3JRAA 3R6SA 3OL3A 2Q9PA 2E36A 3TDUC 4O6JA 1O3SA 3W6VA 1UHWA 1LDKB 5FO5A 1Z0XA 3OIOA 1LPQA 2DPUA 3F21A 4NFWA 1H89C 1HXDA 1U6GA 3F8MA 3PNTA 3VB2A 1UAAA 3KVHA 2DPDA 1BW5A 3S1MJ 4AC0A 1ULYA 1ETVA 1I5ZA 3V8KA 3EUKL 1SC7A 3PQJA 2I5UA 2UXXA 3HOZJ 4ZTFA 3ZMUA 1VQ5I 4S2VA 4XORA 2NVUB 5KK1A 1LEAA 4HNTA 3COAC 3ZOBA 4EM0B 4A93J 4CXFA 2PFBA 2NVXJ 3DBRB 1HQCA 2R7WA 3FSPA 1FY7A 2O6GE 3N9UA 5EYRA 3JAMK 3PJRA 2ECCA 1OCCH 1MD0A 5EZHA 2YVOA 1H9GA 2E35A 1B8IA 4HSTA 3S8PA 3I5UA 1HZTA 2QSHX 4CCKA 2R0QC 4D5FA 2MD0A 3OYJA
chains in the Genus database with same CATH topology
3OMYA 3OYDA 2V26A 2MC4A 2FUG2 3K10A 3HPHA 1KHZA 2BW3A 3EEUA 2P0WA 5HZXA 3J7Ye 1DP3A 3ZR8X 2GT2A 4KTBA 4Y33A 2JVBA 1TT0A 3OR1C 3HPGA 4KT6A 4BEHB 4BE1A 4S2WA 4ZDLA 4ZG0A 3J7AY 2OV7A 2CH0A 4XL9A 3GG6A 2X6XA 2BVMA 2R7TA 4E6KG 2VXDA 3AL0B 4QPOA 1PPVA 2WAFA 4CCNA 3ZQQA 1MNDA 1V8RA 2BOLA 3DPUA 5GHQA 1XSAA 2K5CA 3H5NA 3L2VA 4BUPA 3RCOA 3BM4A 4DBQA 3OS2A 5GHOA 3QYEA 3MDGA 2O5WA 3K70C 4DJAA 4U7BA 3F9KA 3S93A 2ELJA 4KG4A 3W2AA 5KCMA 4CSWA 4HEA2 3X0NA 1X51A 3F13A 1X4OA 4JZTA 1D0XA 2K9LA 3EESA 1MMNA 4B44A 2ICKA 3DWLE 2E5ZA 1Q54A 2AQEA 1PYVA 2I8DA 4IQ4A 3EF5A 4NFXA 3SHDA 2BW3B 2E5NA 1BR4A 3BG6A 5HVQC 2UV1A 4PFOA 4DBRA 3PUBA 2A8RA 1FMWA 2WY7Q 2J8QA 1U0JA 3OYKA 3QODA 3SYTA 3TMOA 2KRHA 3CZ6A 4D9JA 4R79A 2A5WA 2PNYA 3ZRGA 3DKYA 5FSIA 1P9QC 5DDGA 3KEYA 1MUTA 2L2OA 4II2A 2X85A 2GOMA 2VJ4A 2UUZA 1G8XA 3BCAA 3Q2TA 2LYCA 3OYFA 3DU6A 2IS1A 1RRSA 1OLTA 1MMAA 2X51A 4P5OA 4E7KA 1MK1A 1WJAA 2X6YA 3W3CA 2QJTA 3DU5A 2LH9A 1T0FC 2FKBA 3X0SA 2L9SA 1VCDA 4P1WA 1F3YA 4HNUA 2X1DA 4PSXA 5CKTA 1KONA 3DKXA 3HHJA 3O52A 2YVPA 3PNVA 1NFSA 1NQYA 1MQWA 1PUNA 3LMMA 2HZDA 3W2VA 1VK6A 3DEEA 3H95A 3O8SA 2JA2A 4CCMA 2CZRA 3R03A 5C7QA 1MNEA 4PSWA 4MPOA 2KPMA 2I6KA 3ZR1A 2IGNA 3VWBA 1WJBA 2X1CA 3D5RC 4CCOA 2B06A 4OAYA 2CUJA 2R7XA 3BLYA 3AC9A 2YVMA 1BR1A 2K9MA 4BDYA 3S3MA 4F52A 5JHFA 4PJJA 1HA8A 1W36C 3ZGKA 2CS3A 4S2XA 2XF6A 4LITA 2UWMA 1V5FA 3D5SC 5CQEA 3SEQA 3OYBA 1QVJA 3X0PA 3OYNA 3WHWA 1Q27A 2CV1A 3Q1PA 3A2KA 2A8TA 5I8UA 2JVGA 1NFZA 4ZDOA 2KDOA 4JZVA 3FBIB 4XQFA 4JOMA 1BR2A 1UG0A 2F6CA 2KP6A 4JZSA 4OWRB 2HVRA 2DT7B 3D5LA 2XF5A 5BONA 3DPLC 3HC7A 1S9HA 2GB5A 3H5RA 4F91B 3CP2A 1NQZA 5ANVA 4RLFA 5HNHA 3ACAA 4II3A 5KHDA 2IS6A 2W4EA 3OY9A 1VRLA 3ID9A 2VL8A 5ANWA 1X1AA 1PUQA 4C9YA 3FDYA 4E7IA 3I7UA 2KQRA 1EA3A 1V8UA 1X4PA 3LSHA 1ERDA 1K26A 2JUGA 3ZR0A 2QKMB 4BS9A 3OS0A 3K4LA 3SZGA 3EPZA 2B0VA 2VQHA 4YRVA 4ZTJA 4YOQA 2LREA 2XSJC 2LG4A 4KG3A 3K4BA 2R5WA 4C9XA 4XOPA 3K6GA 4ZYAA 2DCEA 1T95A 2OUMA 1D1BA 2JVHA 1DGRM 2LC2A 2VLAA 2B2KA 3LL7A 2HPMA 2M4GA 4ITVA 1QU3A 4PUSA 1AA7A 2CV2A 2VB6A 3OS1A 1V8MA 1SFKA 1Q33A 2ZXHA 4HSRA 4JQFA 4KJZA 4XN0A 5FSNA 3Q4IA 4XKCA 4B43A 2KHMA 1WFXA 3H5AA 4DYWA 2R7UA 1NG7A 3NWSA 1YE9A 4HG2A 2O1CA 2L5QA 1VIQA 4BQOA 4H4KC 3OYIA 3DLAA 3Q93A 2LOOA 2VQLA 4E7JA 2Z2SB 4F93B 1D0ZA 3MKYB 3F6AA 4BJ6C 4RM2A 2HQAA 4BQNA 4BXFA 3UR3C 1U20A 4ICKA 4ZDPA 2VIXA 1QHHD 4IZZA 2Z1DA 3K4JA 2VJ5A 3I9V2 1N77A 5GHPA 3MKZA 2XAUA 4B3XA 4PFPA 4RLQA 3K4MA 3I7VA 5ISYA 4D1QA 4AU7A 2CW8A 3OYLA 1WJFA 1PJRA 3SONA 2V7FA 3X0KA 2A6TA 3X0OA 3OIPA 3IUOA 2PQVA 3RH7A 3HKZA 4DOZA 4V14A 2RQQA 3IAS2 1D1AA 3PL8A 2CMPA 2W1OA 1R67A 2KRCA 4KISA 2DUKA 2VKDA 2R7OA 4E4HA 1V8SA 4NQWB 3OIQA 4PJNA 4F3QA 3NWTA 2O5RA 1IRYA 4ANJA 1GLNA 4BE2A 3DKUA 3OWTA 3SEZA 4PJLA 5ANSA 3QYFA 1G9QA 5KNLA 4BACA 3IP4B 3DTKA 5LFAA 5CQGA 1BOBA 4KYXA 1DGWY 5CPRB 4C2TA 1DQUA 2YYHA 3X0JA 1HX3A 2Z16A 5TGTA 3CNGA 3G0QA 3C2HA 3ZXSA 3OYGA 3E1SA 2PJRA 3FK9A 3H9QA 2R7QA 2WAQA 3CESA 2VNQA 2VJIA 2DT6A 3A6UA 2VQGA 4GRIA 4C9WA 1WJDA 2FVVA 2V1NA 4PK4A 2E1MC 1OW2A 2G74A 4JZUA 2Q1ZB 3H9JA 1JRKA 3MD2A 3CMMA 4XLFA 3LFUA 5ANUA 1WJCA 1Z7LA 3QSJA 2O5FA 4F92B 1ZELA 3QYBA 2DJIA 1XSCA 2M3AA 4XOTA 3S32A 2M7AA 1TUMA 3H35A 4LG3A 3E57A 3EXQA 4X0GA 4YPRA 4AVZA 2M4KA 5FSOA 2VJJA 2LBFA 5FRMA 2XC7A 4XN3A 3RTRA 3A4CA 2X1EA 3MGMA 2R7VA 2R4GA 4ZC3A 4HRIA 4J00A 2DHOA 2XDVA 1V8TA 2A8SA 3ONQA 3HOTA 3L2QA 2IS2A 5HNFA 4B47A 3L2UA 5GHMA 5IW4A 2CFOA 4S2YA 4C30A 3H0DA 2ZXIA 4CZCA 3FFUA 3K70D 3BC8A 4XLAA 2KMUA 1K2EA 4XR6A 1PUSA 4IKFA 3DPTA 3A6TA 2DOAA 3FBNB 2GOXB 2ZSIB 5DD4A 4LIVA 2V6EA 5C7TA 2MFZA 2PJRB 2LY1A 1JI8A 3FHNA 4CH7A 4B48A 4BDZA 3C2GA 1MP2A 1Z21A 4DGWB 1VC8A 3MMYB 4YELA 2VKHA 1XSBA 2VQCA 4AYBA 3GBGA 2IGMA 2F4IA 2DSCA 3LSKA 2LY2A 3H9GA 3L2WA 4E7HA 1V8IA 4BGDA 1VIUA 4XLEA 3OL4A 3K4NA 4E7ZA 2LRDA 1SOIA 5GHIA 3BG7A 3OYCA 3HOSA 2IGKA 3X0LA 1G59A 3HYQA 4E7SA 5LD2C 1IRXA 2KL4A 1VHGA 3I3LA 5GHNA 3U21A 4RM3A 2LBFB 3OYHA 5FRNA 5DEQA 1D0YA 2CL3A 2W4SA 1V8WA 2HNHA 2WY8Q 4XKVA 2KZVA 5CFJA 4BE0A 1X19A 3PFYA 3CP8A 4RMNA 2R7SA 3SMDA 2QJOA 2E1MB 1Z3YA 4G6TB 1V8VA 4J7GA 4YPHA 4F55A 1Y56A 5IW5A 3X0IA 4XNFA 2A8QA 4CCLA 3X0RA 3S3OA 2I8UA 4HFQA 3PSFA 2BVLA 2IGOA 3RPUD 3V42A 3HL2A 2HU9A 3KX2A 1QHGA 4BU2A 4J01A 3BHOA 4PJMA 3OR2C 4NC7A 2RREA 2M0MA 2W82A 3CJQB 1KT9A 1X83A 1SAUA 5GHJA 2DSDA 4NC8A 5HLTA 3OYEA 3HXLA 3VYSB 2MABA 2JSPA 3HG9A 3DTEA 2V9KA 5FSLA 1W36D 5BS6A 2VXZA 4IJXA 4XLCA 3VYRB 3UNGC 2M7BA 3LSGA 3TL4X 3MCFA 3M1CA 5CFIA 2F5VA 3RQ4A 3O6ZA 4N4OB 1J09A 4NNJA 3SDBA 5FROA 4NUBA 2KLOA 4BJ5C 4EATA 1YX3A 2CV0A 4CCJA 3PNYA 2W7NA 3CJRB 4ZJZA 5FSKA 3FJYA 3FKJA 2GT4A 2IS4A 1FMVA 3N77A 3K4CA 3TBIA 3EUHC 1E0EA 3OGAA 4Y4RA 2Q2EB 2Y0SA 3S3NA 2YVNA 3OYMA 3VSKA 3COUA 1VZ0A 4HVYA 3DQVC 3MDIA 2L9NA 1V5EA 4BQQA 1SJYA 2DXIA 2XF7A 2W00A 1Z3XA 1OR7C 4XKBA 3N05A 2A8PA 2I8TA 1SU2A 4QPQA 3P5TA 4N1TA 1V8YA 3Q2SA 2X6WA 2WBMA 4MLOA 1NG6A 3I9XA 3A6SA 5ANTA 2HPIA 1R6RA 3L85A 1MMGA 4J7HA 2WADA 2K3PA 3ZCOA 4DIQA 1V5GA 3M8JA 3BAPA 4Y3OA 3VYUB 3L2RA 3GWYA 1KTGA 1X1DA 3EUAA 3DUPA 4C2UA 1I9AA 1MMDA 2G73A 4LIUA 1TZLA 1PVFA 5DPKA 4CUGA 4IQJA 2KDVA 2VPLA 1X1BA 4KITB 2VNPA 2PMZA 4HPQA 2CW7A 3FCMA 3GZ5A 2VASA 2ICJA 4ILQA 4XMYA 2HDWA 2WB1A 3RSNA 3AKZA 1N75A 3X0MA 2V4JC 3MKWB 1WJ5A 3U53A 2IXSA 4CA0A 3AFHA 1VHZA 3P6YA 5HOOA 3AL0C 1VC9A 3VSLA 4XONA 3X0QA 3A6VA 1V8NA 3PSIA 1SZ3A 2KDWA 5FSMA 2R7RA 1PPWA 2HVSA 5C8LA 1K6YA 4XKWA 1Y6IA 1LKXA 3CF2A 2DSBA 3GZ8A 1MR2A 3OL3A 2Q9PA 1PPXA 4N4NB 4BEHA 3KYLA 1N78A 2WA0A 1LDKB 3LSIA 3OOUA 3QOEA 3Q91A 2ZSHB 4U87A 4FASD 3W2WA 4NFWA 1WJEA 4IX7A 3PNTA 2CUZA 1UAAA 2XSQA 3KVHA 3VDXA 3GRNA 3O61A 2AZWA 4BL0B 3VYTB 2QKLB 1LFPA 1LVKA 5LPGA 1X84A 4E7LA 3EUKL 4OAZA 4XLHA 1X1CA 3E0JB 3IAM2 1D1CA 4ZTFA 1GA7A 4S2VA 2NOJB 4XORA 2WAEA 1RRQA 1MQEA 4HNTA 3HUGB 2RNGA 2MYSA 4N1UA 3BCBA 1MW7A 4FETA 2AQFA 2E60A 4BJTA 2R7WA 3FSPA 2OC6A 3O69A 3N9UA 3PJRA 2L7KA 1RYAA 2YVOA 1YX5A 3A1YA 2RRKA 4HSTA 3K4KA 3S8PA 1V8LA 2HVQA 4XM3A 4K6EA 1HZTA 1UELB 3G2BA 4CCKA 3OYAA 4YEJA 2FMLA 3GZ6A 3DTIA 1JKNA 1G0SA 2MD0A 2ZFUA 3OYJA 3LSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZS A;  5FSK A;  2VNQ A;  3FJY A;  2GT4 A;  3A6U A;  3EEU A;  4C9W A;  5BON A;  2FVV A;  2G74 A;  3N77 A;  5HZX A;  1OW2 A;  3OGA A;  3J7Y e;  2GB5 A;  4JZU A;  1JRK A;  2GT2 A;  4KTB A;  1NQZ A;  2JVB A;  2YVN A;  5ANU A;  4S2W A;  3COU A;  5ANV A;  3QSJ A;  4HVY A;  2O5F A;  4ZG0 A;  3MDI A;  3ACA A;  1XSC A;  2W4E A;  1SJY A;  3ID9 A;  1VRL A;  5ANW A;  1PUQ A;  3GG6 A;  3I7U A;  2A8P A;  1TUM A;  1V8U A;  2I8T A;  1SU2 A;  3E57 A;  1K26 A;  3EXQ A;  3P5T A;  3ZR0 A;  4N1T A;  2QKM B;  4YPR A;  1V8Y A;  3Q2S A;  3X0I A;  5FSO A;  1V8R A;  2B0V A;  4YOQ A;  5GHQ A;  4YPH A;  3I9X A;  3A6S A;  1XSA A;  3MGM A;  4KG3 A;  5ANT A;  2R5W A;  4C9X A;  3L85 A;  2DHO A;  3BM4 A;  1V8T A;  2A8S A;  3BAP A;  5GHO A;  2B2K A;  2O5W A;  3MDG A;  3GWY A;  1KTG A;  5GHM A;  5IW4 A;  4S2Y A;  3DUP A;  2G73 A;  1I9A A;  4KG4 A;  4JZV A;  3FFU A;  3X0N A;  1X51 A;  1PVF A;  5DPK A;  3F13 A;  1K2E A;  1PUS A;  4JZT A;  3A6T A;  2KDV A;  1V8M A;  3EES A;  1Q33 A;  2ICK A;  2VNP A;  5DD4 A;  5FSN A;  1Q54 A;  5C7T A;  3Q4I A;  3FCM A;  3GZ5 A;  3EF5 A;  1MP2 A;  4NFX A;  3SHD A;  1VC8 A;  2ICJ A;  4ILQ A;  4DYW A;  3X0M A;  1XSB A;  2O1C A;  1VIQ A;  3U53 A;  2DSC A;  2A8R A;  1V8I A;  2J8Q A;  1VIU A;  3Q93 A;  1SOI A;  5GHI A;  3P6Y A;  1VHZ A;  1VC9 A;  2PNY A;  5FSI A;  5DDG A;  3X0L A;  3F6A A;  1MUT A;  3X0Q A;  3A6V A;  1V8N A;  1U20 A;  1SZ3 A;  2KDW A;  3HYQ A;  4ICK A;  5FSM A;  1PPW A;  5C8L A;  1VHG A;  5GHN A;  3Q2T A;  1RRS A;  1MK1 A;  2DSB A;  3GZ8 A;  5DEQ A;  1MR2 A;  2CL3 A;  2Q9P A;  1PPX A;  2QJT A;  1V8W A;  5GHP A;  2FKB A;  3I7V A;  5CFJ A;  5ISY A;  3SMD A;  3Q91 A;  3X0S A;  1VCD A;  2QJO A;  4NFW A;  1F3Y A;  1V8V A;  2XSQ A;  3KVH A;  3SON A;  3O61 A;  3X0K A;  2A6T A;  3GRN A;  3HHJ A;  2AZW A;  3O52 A;  3X0O A;  2YVP A;  2PQV A;  2QKL B;  3RH7 A;  5IW5 A;  1NFS A;  1NQY A;  1PUN A;  1MQW A;  1VK6 A;  2A8Q A;  1X84 A;  3H95 A;  4V14 A;  2I8U A;  3O8S A;  4HFQ A;  3X0R A;  5LPG A;  3R03 A;  1GA7 A;  5C7Q A;  3ZR1 A;  4MPO A;  4S2V A;  2I6K A;  1JKN A;  1R67 A;  1RRQ A;  2DUK A;  2B06 A;  1MQE A;  3BHO A;  1V8S A;  4N1U A;  1X83 A;  1KT9 A;  3AC9 A;  2YVM A;  5GHJ A;  1IRY A;  2DSD A;  3DKU A;  3FSP A;  3O69 A;  3N9U A;  4S2X A;  5ANS A;  1G9Q A;  1RYA A;  5FSL A;  2YVO A;  1QVJ A;  2RRK A;  4IJX A;  3X0P A;  5BS6 A;  4KYX A;  3WHW A;  1V8L A;  1Q27 A;  3Q1P A;  2YYH A;  3MCF A;  2A8T A;  4K6E A;  1HZT A;  1HX3 A;  5I8U A;  1NFZ A;  2FML A;  3O6Z A;  3CNG A;  3X0J A;  5CFI A;  1KHZ A;  3G0Q A;  3GZ6 A;  1G0S A;  1PPV A;  3FK9 A; 
#chains in the Genus database with same CATH topology
 1OCO H;  3RDI A;  3OMY A;  4X1E A;  3OYD A;  2V26 A;  2RVC A;  3JRC A;  4CYD A;  3EEU A;  1YW8 A;  4KFC A;  2GT2 A;  1TT0 A;  2EWN A;  3OR1 C;  2QWW A;  4BE1 A;  3I58 A;  2VOO A;  4LK0 F;  4XBF A;  3CQZ J;  3ABM H;  4TV7 A;  4W1U A;  2CH0 A;  3QU3 A;  1OQY A;  1FZP B;  2BY2 A;  4BXX J;  1FOK A;  4RB0 A;  2DFF A;  3JRG A;  1NHA A;  3CDL A;  1JGS A;  2BOL A;  3DPU A;  3G6E I;  2LMD A;  3J7Z I;  1QNT A;  3H5N A;  2CSO A;  3L2V A;  4BUP A;  4W97 A;  3RCO A;  1O3T A;  3H3V K;  3CCJ I;  3BM4 A;  3P9C A;  1HCR A;  1V4R A;  5GHO A;  3QYE A;  3WU2 C;  3MDG A;  3T0Y A;  2MH9 A;  3BTC A;  2CQQ A;  4EM1 A;  4MEX F;  2DJN A;  3W2A A;  5KCM A;  3PQK A;  5C4X J;  2M2E A;  1XSX A;  2LSO A;  3DWL E;  2E5Z A;  1Q54 A;  2I8D A;  1VQK I;  4M3D A;  4IQ4 A;  3SHD A;  3CMY A;  4BY7 J;  2BW3 B;  2E5N A;  1BR4 A;  5HVQ C;  5K5R A;  4BYY A;  1QVT A;  2UV1 A;  3NAR A;  4PFO A;  4DBR A;  1ORK A;  2WY7 Q;  3FXO A;  2FOK A;  4X6A J;  2QBY B;  1LUJ B;  3TMO A;  2FOW A;  2KRH A;  4R79 A;  1DUX C;  1W1W E;  2PNY A;  1M1E B;  1XB4 A;  5K5Q A;  2A5Y B;  4ENJ A;  3BCA A;  1APL C;  2VON A;  3FIS A;  2R5Y A;  4LFU A;  1TWC J;  1W4M A;  4P5O A;  2DU9 A;  1W0T A;  1WJA A;  2KIM A;  2X6Y A;  3W3C A;  3LAP A;  1ZG3 A;  1T0F C;  3RZO J;  3X0S A;  1VCD A;  4LLN A;  1F3Y A;  2QVO A;  4HNU A;  2JA7 J;  2YVP A;  4LMY A;  3QOP A;  3H95 A;  1FBU A;  1MQW A;  2FSW A;  1VK6 A;  5D5W B;  1OYW A;  3O8S A;  4FT8 A;  2HOA A;  1T39 A;  3R03 A;  1FTT A;  1MNE A;  5K5O A;  2I6K A;  4FCY A;  2H09 A;  1WJB A;  3IH4 A;  3JRB A;  3RKQ A;  1IN4 A;  4F52 A;  5JHF A;  5C44 J;  1Z6T A;  4PJJ A;  3KLO A;  4U0W A;  5FKM A;  2DTZ A;  4HV5 A;  5TIS C;  4S2X A;  1T0F A;  1GVJ A;  2EZH A;  2K40 A;  2XPV A;  3SEQ A;  3D5S C;  5M5W J;  4MFD A;  3WHW A;  1HKT A;  1Q27 A;  5F1R A;  2XKP A;  2CO5 A;  3VPR A;  2KP6 A;  2FRH A;  1YW9 A;  4L9V A;  1TC3 C;  2JN6 A;  2HVR A;  1RKT A;  2DT7 B;  4E70 A;  3HC7 A;  4A3L J;  4F91 B;  5ANV A;  2XAG A;  4PJ0 C;  4C3H J;  3W6K B;  3Q5F A;  2HKX A;  1G3S A;  4V2F A;  2IS6 A;  2W4E A;  1VRL A;  1ETK A;  1MGT A;  3O8G A;  3CJT B;  1PUQ A;  2A68 F;  3TKY A;  5D6F A;  1ERD A;  2JUG A;  3ZR0 A;  2DN0 A;  4LB5 A;  3HDD A;  2OCE A;  5F0C A;  1K79 A;  2CUE A;  4YRV A;  4YOQ A;  2LG4 A;  4OIN F;  4XID A;  2R92 J;  4XOP A;  1JGG A;  1A6Q A;  4Z6Y A;  5KAF C;  2EIK H;  4WXC A;  2DCE A;  2OUM A;  3ERE D;  2UZK A;  1D1B A;  2JVH A;  3JSO A;  4BNC A;  2D1H A;  3LL7 A;  2HPM A;  2AXL A;  2M4G A;  3ZPL A;  4ITV A;  4YFX F;  2B9S A;  2E7W A;  2NVY J;  2CV2 A;  1ETX A;  1ZRC A;  2JA5 J;  2VB6 A;  1D3Y A;  1V8M A;  1SFK A;  4M72 A;  3KE2 A;  5IY5 H;  3H36 A;  1WFX A;  3H5A A;  3HJE A;  3NWS A;  3AG1 H;  4N9H A;  3CUQ B;  4AIH A;  4H4K C;  1MZB A;  4FX0 A;  2XKO A;  3IH2 A;  3U1K A;  2Z2S B;  4I6Z A;  2ZCW A;  3F6A A;  4BJ6 C;  4RM2 A;  4BQN A;  1U20 A;  4ZDP A;  5AIQ A;  4A3M J;  2ZBK A;  2Y0S N;  3ELK A;  1QHH D;  3K4J A;  3BR1 A;  4M73 A;  1YLF A;  5GPA A;  3I9V 2;  1SVO A;  2V9V A;  2ZNY A;  2VOP A;  5GHP A;  4RAY A;  4RLQ A;  3FK7 A;  2HI3 A;  5ISY A;  2EFW A;  4ZYG A;  5E17 F;  2B7E A;  1PJR A;  3E6C C;  2RGV A;  2ISZ A;  3OIP A;  1JUM A;  1Q1H A;  1R7J A;  1T98 A;  5DD8 A;  2Q8K A;  2KIF A;  4UVC A;  2MG4 A;  4LJZ F;  2H27 A;  2XSD C;  2JRM A;  1DPR A;  4NQW B;  3OIQ A;  5DV5 A;  4F3Q A;  1EV7 A;  1MDM A;  4S0H B;  1F36 A;  3M07 A;  3FX3 A;  3RI4 A;  2A3S A;  2VC1 A;  3DV8 A;  3SEZ A;  4PJL A;  5ANS A;  5KNL A;  1K61 A;  3HTU A;  3T5X A;  5LFA A;  2CFX A;  1FYK A;  5H2F C;  4C2T A;  1DQU A;  1ONV A;  3IRR A;  1BBY A;  4KIF A;  3CC2 I;  1HX3 A;  3R61 A;  5M5X J;  2WB1 N;  3C2H A;  3OYG A;  3SHF A;  5C3E J;  3ZN0 A;  1XS9 A;  1HDP A;  3CCQ I;  2TRT A;  3CES A;  2LKS A;  1O4X A;  4EVI A;  1WJD A;  2FVV A;  4PK4 A;  2G74 A;  4JZU A;  4R1H A;  3MD2 A;  5M3M J;  2JPB A;  1Z67 A;  4RS8 A;  4I02 A;  1ZEL A;  3QYB A;  4BHC A;  1FBS A;  3E3V A;  5K1Y A;  5J4Y A;  1ZRE A;  4Q47 A;  4XOT A;  3ESW B;  3WTZ A;  2K85 A;  2EIJ H;  3E57 A;  4C3I J;  4YPR A;  3QPT A;  2M4K A;  3JRI A;  5FRM A;  4M3B A;  2XC7 A;  1WHU A;  1IXS B;  2R5Z B;  4GDF A;  2EZI A;  3JRH A;  1CGP A;  1V54 H;  4FTH A;  1Y0U A;  2XDV A;  2VN2 A;  1QBJ A;  2IS2 A;  3WTT C;  2W57 A;  1H9T A;  3OOP A;  3GFJ A;  1O3Q A;  5IW4 A;  3CCR I;  3N97 A;  1IZ1 A;  2MLK A;  4XLA A;  4IEJ A;  4B4C A;  2ZKZ A;  4XIC A;  4IKF A;  3DPT A;  3G71 I;  2IA2 A;  1TQI A;  2DOA A;  5J6X A;  3GTQ J;  3A6T A;  1I39 A;  2EFP A;  2YPR A;  5DD4 A;  2V6E A;  2PJR B;  2LY1 A;  1JI8 A;  2M8E A;  4ZZL A;  1T38 A;  3C2G A;  3F72 A;  5BMZ A;  1HOM A;  3KFW X;  1R36 A;  3HRM A;  3MMY B;  4YEL A;  1XSB A;  2P81 A;  2F4I A;  1FTZ A;  3H9G A;  1PVE A;  5CVI A;  4E7H A;  1R1T A;  3I59 A;  1R1V A;  1FPQ A;  3TO7 A;  3HYI A;  1AKH B;  1RC9 A;  5E1X A;  4NDL A;  1YYV A;  2GQQ A;  2QUF A;  2VE9 A;  2HXI A;  4WK8 F;  2ZO4 A;  1D0Y A;  1ZTR A;  5J8F A;  2HNH A;  2R7D A;  1BJZ A;  2FJ1 A;  2P8T A;  1X19 A;  4RMN A;  4BE0 A;  3KP3 A;  2OTJ I;  4G6T B;  2IA0 A;  3MQ0 A;  1SD4 A;  2O61 A;  3E6B A;  4YPH A;  2L7M P;  1UCR A;  3RZD J;  3U2R A;  2A8Q A;  2I8U A;  2ZC2 A;  5CJ9 A;  2BVL A;  2IGO A;  3V42 A;  3KX2 A;  1FYM A;  1RKW A;  1H8A C;  1T08 B;  4B1R A;  1IW7 F;  1X3Z B;  3OR2 C;  1ZRD A;  5GTI C;  1KT9 A;  3TDZ C;  2DFE A;  4M3F A;  5ED4 A;  2NVQ J;  5GTH C;  1IXC A;  1Z77 A;  2XGX A;  3HG9 A;  2P4W A;  5DUI A;  2CJJ A;  2CWE A;  2AXT C;  2M8G X;  5BS6 A;  4HF1 A;  2VXZ A;  4IJX A;  3VYR B;  4EGY A;  1I6X A;  2VC0 A;  2F5V A;  1XD7 A;  4NNJ A;  5FRO A;  3QPH A;  5EDN A;  3H0G J;  5TJJ A;  2GT4 A;  2OPT A;  1FMV A;  2YU3 A;  3BR6 A;  2IS4 A;  1PUF B;  1W5S A;  3TBI A;  3OGA A;  1TQM A;  1XSV A;  4ABZ A;  5D6E A;  2H6C A;  2DQR A;  3E6D A;  1BL0 A;  3OYM A;  5LLQ A;  1KYZ A;  2FBI A;  4P9U A;  1IDY A;  3S14 J;  2XF7 A;  2W00 A;  3N05 A;  2I8T A;  5LBQ A;  2P5V A;  1OJL A;  4F7Z A;  4OOI A;  2VUM J;  3ZMZ A;  5M3F J;  1VFC A;  1NG6 A;  5HDG A;  4ESJ A;  2O8K A;  5ANT A;  5EEH A;  1ODD A;  1R6R A;  4V19 K;  4J7H A;  3ZCO A;  4CZZ A;  1V5G A;  2Y69 H;  3REO A;  3JW4 A;  1OCP A;  2OBP A;  2L9R A;  3BAP A;  4DYR A;  3L2R A;  2M34 A;  3EUA A;  1BC7 C;  1MMD A;  3MEX A;  3TW6 A;  1PVF A;  2A61 A;  4FHT A;  4IQJ A;  3WTU C;  5DCF A;  3WU1 B;  2KDV A;  1X1B A;  2ICW G;  3RYR A;  4C3J J;  3HUG A;  3LFK A;  1U3E M;  4ZYH A;  2VNP A;  3FCM A;  3GZ5 A;  1VI0 A;  1K83 J;  3G4S I;  4XMY A;  5A2Q Z;  3RSN A;  1RR8 C;  2V4J C;  2DT5 A;  4NHJ A;  2E19 A;  4I01 A;  4UUS A;  1Y1V J;  3IRQ A;  2C6Y A;  3EET A;  3AFH A;  3GFL A;  1VHZ A;  3GF2 A;  3P6Y A;  4OIO F;  4XON A;  4EJO A;  2FBH A;  4CDG A;  1SZ3 A;  4I99 C;  2KDW A;  3A02 A;  2R7R A;  2HVS A;  2KKO A;  1K6Y A;  2ZJ2 A;  4KN4 X;  1LKX A;  1A6I A;  2OAZ A;  3SJM A;  1YTY A;  3TQN A;  2HTS A;  5EG0 A;  1R5I D;  2PEX A;  2WA0 A;  5KAI C;  5D5X B;  3CME I;  3CCV I;  3Q91 A;  1FIP A;  4YII A;  5K7F A;  4HLX A;  1WJE A;  5EJC A;  4UNO A;  2XSQ A;  4U0V A;  3O61 A;  4BL0 B;  2Y9Y A;  4IOA F;  2QKL B;  2QQ9 A;  1LVK A;  5LPG A;  4E7L A;  4KDP A;  1A31 A;  4XLH A;  1X1C A;  3IAM 2;  1D1C A;  1QPM A;  5E1Z B;  1K4S A;  3VOE A;  4O5V A;  4N1U A;  3S2H J;  4RGX A;  4EMS A;  1G4D A;  2X48 A;  2ZB9 A;  1S7A A;  3V8J A;  3TP3 A;  3L2C A;  3B73 A;  1KU3 A;  1R4M B;  1VQ4 I;  3B02 A;  1B6A A;  2ID3 A;  5FLX Z;  3A1Y A;  2RRK A;  4UVA A;  3GLX A;  3CCY A;  4IOC F;  2LK2 A;  1O57 A;  3CLO A;  4R8H A;  3GZ6 A;  2EIM H;  3DTI A;  1KHZ A;  1WRJ A;  4E7S A;  3LSM A;  3O8H A;  3GFI A;  4BKX A;  1JHF A;  1F1Z A;  2CGP A;  2MC4 A;  2FUG 2;  6PAX A;  3NAU A;  4BHB A;  2P0W A;  2BZT A;  3J7Y e;  4KTB A;  2RNJ A;  3GME A;  2IVM A;  4KT6 A;  3HPG A;  4Y33 A;  4BEH B;  2JVB A;  1SEU A;  1FBQ A;  1RZ4 A;  4ZG0 A;  1SFU A;  1MJB A;  2OV7 A;  4HAM A;  2H6B A;  2KT0 A;  4KIB A;  4XL9 A;  1I6H J;  2X6X A;  3E5Q A;  1VQM I;  3I53 A;  1VQP I;  4E6K G;  2VXD A;  3QRF F;  2WAF A;  3ZQQ A;  3JTG A;  4I98 B;  2XB0 X;  4WWC A;  4XK4 A;  1XTA A;  4A0Z A;  2E2I J;  2X6O A;  2E1O A;  3S1N J;  3OS2 A;  2ESH A;  1BI0 A;  2N8G A;  4HX4 A;  2EQR A;  2DLL A;  4DJA A;  5F64 A;  1S7E A;  2G0E A;  1QGP A;  4HEA 2;  1X51 A;  1R58 A;  4MO7 A;  2NRA C;  3R60 A;  4JZT A;  3DBH B;  2COM A;  2XAQ A;  1VQ7 I;  1MMN A;  2EFN A;  3FIW A;  2XV4 S;  3CCS I;  3CC7 I;  3EES A;  4EJW A;  2EH3 A;  2QQ8 A;  3WTY C;  4EGZ A;  3EDP A;  5CVV A;  1X2N A;  1LJ9 A;  5K7Z A;  4RGR A;  4RGU A;  2DAO A;  1SAN A;  3QU6 A;  1XX5 A;  2EFQ A;  3PUB A;  2J8Q A;  3OYK A;  2O9L A;  1XSD A;  3SYT A;  1J5Y A;  2FNP A;  2A5W A;  2R5Z A;  1YO5 C;  3DKY A;  5FSI A;  5DDG A;  4MFE A;  1YJ9 I;  2L2O A;  2Q0O A;  4IHT A;  3I56 I;  2GOM A;  1G8X A;  1UMQ A;  4J19 A;  2LYC A;  3V7R A;  5LGN A;  2IBD A;  2IS1 A;  4IVN A;  1MMA A;  2X51 A;  3WGI A;  4E7K A;  1QQI A;  1YJW I;  2QJT A;  2QGU A;  3J80 Z;  1TL8 A;  2LH9 A;  2K3F A;  1SFE A;  1IJW C;  3CCE I;  2FU4 A;  1P7J A;  5FKK A;  5E79 C;  1FT9 A;  3LSR A;  5CKT A;  2ZME A;  3HHJ A;  3DKX A;  3O52 A;  2CUF A;  5EGO B;  1UST A;  5ICC A;  3W2V A;  2VBX A;  2KIU A;  2LVS A;  1IXR C;  2JA2 A;  3CDI A;  2CZR A;  4UVB A;  1NH3 A;  4PSW A;  2XGD A;  3DP7 A;  4RBO A;  2IGN A;  5BPI A;  3CLQ A;  2X1C A;  3QWL A;  4O3M A;  1FX7 A;  5FKO A;  4OAY A;  2K86 A;  5DCM B;  2R7X A;  2B06 A;  4QSH A;  3AC9 A;  5IPA A;  5CLS A;  1BR1 A;  2K9M A;  3SXY A;  3S3M A;  3J81 Z;  1FSH A;  4CO8 A;  1AKH A;  1W36 C;  3FXQ A;  4LIT A;  1BM9 A;  4LGW A;  5L3E A;  4L5I A;  2Y48 A;  2UWM A;  5CQE A;  1IUY A;  1K2E A;  3WTV C;  4RA2 A;  2JVG A;  2DMU A;  2KDO A;  1W7P A;  1XDU A;  4XQF A;  4UV8 A;  4JOM A;  4OWR B;  2FQ3 A;  3FMQ A;  1PDN C;  2BEO A;  2XF5 A;  5BON A;  4EM2 A;  4RB1 A;  2DQL A;  1KZH A;  4YG2 F;  1NQZ A;  3LA7 A;  4G12 A;  1ZK8 A;  3SDG A;  2GBY A;  2L3D A;  4RLF A;  2D1V A;  1R71 A;  5IOY A;  1GVD A;  2JPC A;  3OY9 A;  1S7O A;  4GYI A;  2VL8 A;  1X1A A;  2OD5 A;  4C9Y A;  1LE8 B;  2L02 A;  3M1E A;  1EA3 A;  1PP8 F;  1S5L C;  1G3Y A;  2ME6 A;  3LNQ A;  1JKQ C;  2QKM B;  1VF9 A;  5ILU A;  3OS0 A;  4HBL A;  2OQR A;  3SZG A;  2B0V A;  2GZW A;  2V1D A;  1WGX A;  2LR8 A;  3K4B A;  2P6S A;  4RAF A;  3I4M J;  4Q5S F;  3CCU I;  2DTR A;  3KP6 A;  4L9N A;  1T95 A;  3GTP J;  2LC2 A;  1U8R A;  2GA1 A;  4GCV A;  2B2K A;  4U0Y A;  1Z9C A;  2RAE A;  3BOQ A;  2A69 F;  2YSR A;  2LDU A;  3HM5 A;  3VEP A;  1QU3 A;  3FXL A;  1U5T B;  1TTY A;  2DFH A;  4ESF A;  1G3W A;  3RJP A;  1FJL A;  1TWF J;  4JQF A;  4XN0 A;  3HOV J;  1Q33 A;  3M9A A;  5TRD A;  3DEW A;  1OCT C;  4B43 A;  1ETY A;  2FNA A;  1REP C;  1ZYR F;  2BE5 F;  2GWR A;  2GIZ A;  3WGG A;  1FC3 A;  3ZQI A;  4BQO A;  3LA2 A;  1XMA A;  4A6D A;  2MGQ A;  2MW8 A;  2LOO A;  5FLV A;  4E7J A;  4MHG A;  2FQ4 A;  1IN7 A;  2F5E A;  3KP7 A;  2BY3 A;  2HQA A;  2COB A;  4IHW A;  4UUT A;  1IV8 A;  3CC4 I;  1N77 A;  5JFR A;  2CRG A;  1ZR2 A;  1FEX A;  4MIM A;  3TGN A;  1A04 A;  3FXK A;  1OMI A;  1GUU A;  3K4M A;  4PFP A;  1TQP A;  4ZZD A;  1R23 A;  3GTK J;  1ITY A;  1WJF A;  3SZP A;  2A6T A;  2A07 F;  2LNB A;  3NQO A;  3GCM A;  3RH7 A;  3CCM I;  3O2P E;  2RQQ A;  3IAS 2;  3JCU C;  1BN5 A;  2KJB A;  1AHD P;  1S8N A;  3HOX J;  2W1O A;  1R67 A;  2KRC A;  1WI3 A;  1GXQ A;  4FQG A;  2DDB A;  2R7O A;  2WAQ N;  3IH3 A;  2ME0 A;  2K9Q A;  4PJN A;  3OSG A;  2QYO A;  2NS0 A;  2PI0 A;  3OWT A;  2NNN A;  4PCQ A;  3BPV A;  5IT9 K;  3LST A;  3T8T A;  4I0A A;  3UKG A;  3M4O J;  3DTK A;  4DYQ A;  4PDK A;  3SZT A;  4A5N A;  4FX4 A;  1IGN A;  2Z16 A;  5TGT A;  1YRN A;  3CNG A;  2EBI A;  3G0Q A;  3FK9 A;  1YJN I;  2RV8 A;  1X2M A;  2WAQ A;  2VNQ A;  2PJP A;  2DDA A;  2VQG A;  4C9W A;  2JUC A;  5AIP A;  1OW2 A;  2ESN A;  1F4K A;  2Q1Z B;  2GM4 A;  1JRK A;  5JHU A;  3LWF A;  3CMM A;  3PIP F;  4U7D A;  5ANU A;  1WJC A;  3HSR A;  2DA3 A;  5H20 A;  3FHZ A;  1K4T A;  4F92 B;  3WOD F;  1OR7 A;  3F8N A;  1SMY F;  1XCB A;  2F5C A;  1FSE A;  2M7A A;  2P7C B;  5D5U B;  2OTL I;  2F48 A;  3QQA A;  4LG3 A;  4QTR A;  4X0G A;  3ISP A;  1E3O C;  2KFD A;  1J59 A;  1X58 A;  4XN3 A;  3ZQH A;  3RTR A;  1U8B A;  2X1E A;  3MGM A;  1LVA A;  2R7V A;  1CF7 B;  3IWZ A;  3WG9 A;  3RQI A;  4J00 A;  2DHO A;  4AYB N;  3HHH A;  4HNV A;  4A12 A;  3L2U A;  2NOG A;  3BTJ A;  2UXN A;  3G73 A;  3A0H C;  4ENM A;  3SQN A;  2HGC A;  4LG0 B;  3BC8 A;  5ILS A;  1ZLK A;  2IPQ X;  2XRN A;  3A01 A;  5JVG F;  2HYG D;  5C7T A;  4CYC A;  4I09 A;  4A0X A;  3WGH A;  4B48 A;  4CH7 A;  1KU2 A;  2R93 J;  4XRF A;  5H6Q A;  2MSY A;  4U88 A;  1R4N B;  2VKH A;  5BOX A;  3EYY A;  4AYB A;  1D5Y A;  3GBG A;  1MMS A;  1RET A;  1MBH A;  3LSK A;  3L2W A;  2CG4 A;  1R9T J;  4BGD A;  4IHS A;  3ZMS A;  4BBS J;  1LDJ A;  3BG7 A;  3H1C A;  1T56 A;  2IGK A;  1V55 H;  4L0Z B;  2ZFW A;  3HYQ A;  2ZJR F;  5LD2 C;  4IPA A;  1SD5 A;  4A3E J;  4ZH4 F;  1VHG A;  2FF4 A;  2LP0 A;  2YS9 A;  4RM3 A;  2LBF B;  1K78 A;  5JLW A;  1YIJ I;  3BZK A;  2CL3 A;  2Q2E A;  4G94 A;  2LKX A;  3PFY A;  4AID A;  2L7F P;  2D5V A;  2R7S A;  1IRG A;  3SMD A;  2E1M B;  1P4A A;  1Z3Y A;  4IF4 A;  5FFX A;  1Z7U A;  4F55 A;  1Y56 A;  5IW5 A;  4G7O F;  1ZAR A;  2KJC A;  3P5J A;  1ON1 A;  4XNF A;  4A5M A;  3HGG A;  4HFQ A;  3HL2 A;  2CQX A;  1OKR A;  2OJE D;  2P6T A;  4UXN A;  3V8L A;  3TW7 A;  4AIJ A;  1ZHF A;  5IP9 J;  2E7X A;  1P4W A;  1W7P D;  3BHO A;  1JXS A;  4NC7 A;  2RRE A;  2OZ6 A;  2RKH A;  4M6X A;  2GXG A;  3ZP5 A;  3Q0W A;  5F0H A;  4UHT A;  4YFK F;  2I10 A;  2DSD A;  4NC8 A;  5DTD A;  1L3L A;  2F5F A;  3HXL A;  2MAB A;  2JSP A;  1FWZ A;  2V9K A;  1W36 D;  4XLC A;  3S2W A;  3LSG A;  3TL4 X;  1VQO I;  3B6A A;  4RAG A;  1Y8R B;  4HA8 A;  4N4O B;  1J09 A;  4EAT A;  4NUB A;  4CGZ A;  1NTC A;  1YX3 A;  5E1W A;  1B72 B;  1XG1 A;  2HYF A;  2XPW A;  4I2O A;  3V4G A;  1MIJ A;  1BA5 A;  1T6S A;  1U9N A;  3FXM A;  3K4C A;  3HOY J;  4XLN F;  2AS5 F;  2P5L C;  2Y0S A;  2STT A;  1O7F A;  3COU A;  1R49 A;  4HVY A;  4A6E A;  3IKV A;  4BQQ A;  1SJY A;  1T2K A;  1DU6 A;  3I54 A;  3GTG J;  1SU2 A;  2W48 A;  3T8R A;  3X2Q H;  3QPL A;  3Q0V A;  4I76 A;  3ZMD A;  3P5T A;  3TO9 A;  3Q2S A;  2EZL A;  4N1T A;  2X6W A;  1KGS A;  2DA5 A;  2XGE A;  3I9X A;  1QA6 A;  4OIQ F;  2WAD A;  2CU7 A;  2K3P A;  4DIQ A;  1IUF A;  2IA1 A;  1IV6 A;  2YU9 J;  3BRO A;  2F2E A;  3VYU B;  4L18 B;  1KU9 A;  1X1D A;  3OV8 A;  2HFH A;  2DBB A;  3I64 A;  2DK8 A;  3P7N A;  1I27 A;  3U1D A;  4V2G A;  2Y9Z A;  1I9A A;  3GW2 A;  3ZMT A;  4LIU A;  2HQR A;  3KZZ A;  1SVM A;  1XGO A;  2IAI A;  3L00 A;  1E3P A;  1FOY A;  3G3Z A;  5GAD J;  2EA2 A;  4KIT B;  3DLL F;  3JTH A;  4Y17 A;  2Y75 A;  5BQT A;  4AIK A;  2QEN A;  2WB1 A;  1N75 A;  2HXO A;  4ZYE A;  3MKW B;  2DA7 A;  1WJ5 A;  3K1N A;  3U53 A;  3HIF A;  4CA0 A;  3ROU A;  5F27 A;  1W0U A;  5BNG A;  3B6C A;  1VC9 A;  3SFI A;  3X0Q A;  2WC2 A;  4A3J J;  5FSM A;  4IHY A;  5C8L A;  2KDZ A;  1U9O A;  2DSB A;  3GZ8 A;  4N4N B;  1EH8 A;  3QP6 A;  3BG3 A;  3KYL A;  3LSI A;  1V3F A;  3OOU A;  1XMX A;  4M9X A;  4IX7 A;  4A3B J;  2CUZ A;  1MBE A;  4Q4Z F;  3VDX A;  2WV0 A;  2YR2 A;  5IYC J;  3WTW C;  3N4M A;  1I3A A;  5ICE A;  1LFP A;  1X84 A;  1H88 C;  2BXY A;  3RIR A;  5A2Q K;  4OAZ A;  3PO3 J;  5D4S A;  1GA7 A;  3BTI A;  1XCV A;  2BY1 A;  2WAE A;  4OIR F;  1FLI A;  5HS8 A;  1HDD C;  1MQE A;  3P9I A;  2MYS A;  3BCB A;  1MW7 A;  2J5O A;  2AQF A;  2E60 A;  3MN2 A;  1WWX A;  2CW0 F;  2QZ8 A;  4BJT A;  4P9F A;  2JMW A;  2ISY A;  2IJL A;  1RUN A;  1EH6 A;  4JK1 X;  4IO9 F;  1YX5 A;  1V8L A;  2HVQ A;  3A03 A;  4XM3 A;  3S1R J;  1XPX A;  4A3F J;  1YS6 A;  1UEL B;  2FXA A;  2GXA A;  4YEJ A;  3F23 A;  2HR3 A;  4RB3 C;  2ADU A;  2ZFU A;  2OU2 A;  1G0S A;  1PPV A;  1ENH A;  3S1Q J;  1R1U A;  2W84 A;  5ICF A;  2P5K A;  3JSP A;  1A35 A;  3HPH A;  3I0T A;  2BW3 A;  1QPI A;  3C2B A;  1OCR H;  2QA4 I;  2XPU A;  1MBJ A;  1LDD A;  4S2W A;  3ZQC A;  2DA1 A;  2ID6 A;  4ZDL A;  5DM7 F;  2QBY A;  3J7A Y;  1VND A;  1IC8 A;  2QSF X;  3KYC B;  3GG6 A;  1QRY A;  2BVM A;  2K9S A;  2R7T A;  3AL0 B;  4QPO A;  3BWG A;  2HQN A;  2VKV A;  4B3A A;  2M1B A;  3CO6 C;  3K1M A;  1GHC A;  4MQ9 F;  2FX0 A;  1J7K A;  3RYP A;  4DBQ A;  2O5W A;  2DMT A;  3K70 C;  1GXP A;  3CDH A;  1G3T A;  3F9K A;  2ELJ A;  5E20 A;  2Z9O A;  4KG4 A;  1JE8 A;  1YIT I;  1B8I B;  4P96 A;  5AON A;  3F13 A;  2YX7 A;  2K9L A;  1OYI A;  1FIA A;  3BR2 A;  2Y31 A;  4MTE A;  2AQE A;  1S29 A;  1PYV A;  1TP4 A;  4IXA A;  1HLV A;  5J4V A;  3F22 A;  1BI1 A;  3BG6 A;  2JA6 J;  5B1B H;  1FMW A;  2VBW A;  3C18 A;  3RKW A;  3CZ6 A;  4S04 A;  1MJA A;  5LGU A;  3KEY A;  1S6L A;  1ZGW A;  1B9N A;  3GZN B;  1JKO C;  2UUZ A;  3K69 A;  4AD9 A;  4HYE A;  3OYF A;  1VQ8 I;  3ULQ B;  4UV9 A;  1OLT A;  2PN6 A;  1Q1V A;  1J75 A;  2NNY A;  1OFC X;  3Q9V A;  3DU5 A;  2QLZ A;  2FKB A;  1OCZ H;  3BT9 A;  5JR3 A;  4P1W A;  4L0Y B;  3F3X A;  2IP2 A;  2LKP A;  2YX4 A;  2WTE A;  1I3Q J;  1MBK A;  1P4X A;  2X1D A;  4PSX A;  1IO2 A;  1DP7 P;  3PNV A;  3J7A O;  1NFS A;  2XB5 A;  4CCM A;  4M3G A;  4IRH A;  5C7Q A;  3I4P A;  2KPM A;  3FMS A;  3D5R C;  4CCO A;  2ECB A;  4IHV A;  4G6Q A;  3BLY A;  1X1P A;  1JT6 A;  1HBX G;  3CUQ C;  2YVM A;  4BDY A;  3DXJ F;  5FB2 A;  2ELH A;  4KN7 X;  3MWM A;  4UB6 C;  3NEU A;  2BY0 A;  1GDT A;  5E8G A;  1MNM C;  5LEJ A;  3E5U A;  3X0P A;  2BHY A;  3OYN A;  2BGC A;  3RPU A;  1ZQ3 P;  3J80 K;  1K6O A;  5F6F A;  3FBI B;  4HZF A;  3BG5 A;  2MC3 A;  1UG0 A;  2TCT A;  4JZS A;  5JI6 A;  2R5Y B;  3KP4 A;  3D5L A;  4HLY A;  4YIF A;  1N25 A;  2NAZ A;  2PLY A;  2GB5 A;  3CUQ A;  1UHM A;  3H5R A;  4JBA A;  3H3U A;  1DPU A;  4A69 C;  1YHQ I;  2ETH A;  3GLL A;  2DOD A;  3ACA A;  4II3 A;  2YUS A;  3CTA A;  1I1S A;  4E7I A;  1KQ9 A;  1X4P A;  3WG7 H;  5J3L A;  1K26 A;  3ZQL A;  3K4L A;  2VQH A;  5E3L A;  2LRE A;  4C9X A;  2R5W A;  1WPK A;  3JR9 A;  3DKW A;  1LQ1 A;  1DGR M;  4GXO A;  2WWY A;  3M8E A;  4OMZ A;  3CF5 F;  2OA4 A;  3CUO A;  4PUS A;  5L3D A;  3FM3 A;  2R7Z J;  3GXO A;  2XAS A;  3WTX C;  3OS1 A;  3BP8 A;  5FLM J;  5DS9 A;  2ZXH A;  1Z6R A;  3LSJ A;  5FSN A;  4NQW A;  4JX4 A;  3Q4I A;  1RNL A;  2PBI A;  4D7N A;  1KU7 A;  5K7H A;  2R7U A;  2QM3 A;  3IC7 A;  2O1C A;  2L5Q A;  1HF0 A;  4RB2 C;  2K7L A;  3OYI A;  4N0B A;  1EKE A;  2M5W A;  3DLA A;  3Q93 A;  3FZV A;  3HHG A;  3HRT A;  1NK2 P;  3HKZ N;  4F93 B;  2HEO A;  1D0Z A;  2IW5 A;  3K2A A;  1VQ9 I;  1JJ8 C;  4ICK A;  4BXF A;  4IL6 C;  2O03 A;  3ZQF A;  1RES A;  2DMN A;  2VJ5 A;  1U2W A;  2EJR A;  3S2D J;  2VPR A;  2DO7 A;  4LB6 B;  2L0K A;  2MA3 A;  2XAU A;  3JRD A;  2OF7 A;  2CW8 A;  4M74 A;  3GTM J;  4MEY F;  4NC6 A;  3U9G A;  2PQV A;  2XAH A;  1O7L A;  3HKZ A;  4DOZ A;  4V14 A;  2ZME C;  2L7Z A;  3R0A A;  1D1A A;  3PL8 A;  2CMP A;  4G7H F;  4NB5 A;  3H3Z A;  5L3C A;  3L9F A;  1LFB A;  1JUP A;  3K0L A;  4XSZ F;  4E4H A;  1BC8 C;  2Y2Z A;  3NWT A;  4UUV A;  1GLN A;  2FBK A;  1IN8 A;  3DKU A;  4M9Z A;  3F6O A;  4A3D J;  3BR0 A;  1P7I A;  3LAJ A;  1LB2 A;  4BAC A;  3IP4 B;  5J40 A;  1LNW A;  2EZK A;  3FXR A;  1BOB A;  5L3G A;  1DGW Y;  5CPR B;  1VQL I;  3X0J A;  4AVP A;  2ACJ A;  4Q48 A;  3ZXS A;  3E1S A;  2PJR A;  2EIL H;  1BI3 A;  2AHQ A;  3WE3 A;  3KYD B;  2DT6 A;  3A6U A;  3FKI J;  4GRI A;  4D0P A;  5E18 F;  1KQ0 A;  2K02 A;  3E6M A;  5J1R A;  2EA4 A;  3H9J A;  3I71 A;  3O6B B;  4LOC A;  3LFU A;  4XLF A;  3QSJ A;  5HS9 A;  2O5F A;  1AU7 A;  2DJI A;  4M3E A;  4Y15 A;  3QAH A;  3R4K A;  1G6N A;  3R0J A;  3S32 A;  2ZXJ A;  1ZR4 A;  2H94 A;  3H35 A;  5B66 C;  2H1L A;  3EXQ A;  3DBL B;  3H92 A;  4AVZ A;  1UB9 A;  3KET A;  1I50 J;  3A4C A;  4I0B A;  4EJV A;  3ZMV A;  2R4G A;  4ZC3 A;  2IT0 A;  1MDM B;  2HYJ A;  2F5D A;  5HDK A;  1H0M A;  1V8T A;  3ONQ A;  3ZN1 A;  2HWV A;  3FXU A;  2NS8 A;  2CFO A;  4S2Y A;  1D8K A;  1MBF A;  1OYY A;  3HSF A;  3H0D A;  2ZXI A;  4QIW N;  1KYW A;  3K70 D;  2KMU A;  3L09 A;  2JWT A;  3FBN B;  2X4H A;  4RDU A;  4A3K J;  4LIV A;  4MGR A;  3WE2 A;  5FD6 A;  1KQ8 A;  3AG3 H;  1Z21 A;  1VC8 A;  1SD6 A;  3ABK H;  5CVR A;  1RPW A;  2PG4 A;  4S05 A;  2BV6 A;  4BY1 J;  2EPF A;  2DSC A;  1QVU A;  4WXD A;  3VFZ A;  1VIU A;  4L5J A;  4XLE A;  4IJA A;  3IKT A;  3OL4 A;  3K4N A;  2O3F A;  2NYX A;  1AWC A;  1RIO H;  3HOS A;  2IRF G;  1XGN A;  4Y13 A;  3C7J A;  3X0L A;  4ENN A;  1HST A;  1IRX A;  2KL4 A;  2O8X A;  3U21 A;  1SD7 A;  4M71 A;  3WTS C;  3OYH A;  5FRN A;  4GO1 A;  2JJ7 A;  1PUF A;  2M9H A;  1LEB A;  3T1B A;  2W4S A;  1XN7 A;  1V8W A;  3BJ6 A;  4JP0 A;  2KZV A;  5HLH A;  1ZKG A;  3HTS B;  3CP8 A;  4RGS A;  4J7G A;  4PZJ A;  2JQ7 A;  3W6J B;  5LHG A;  1B9M A;  3S3O A;  1EF4 A;  1Y1W J;  3RPU D;  4KIG A;  1WKM A;  1BW6 A;  4BU2 A;  4J01 A;  1MKM A;  4PJM A;  2DMP A;  2W82 A;  2M0M A;  4P55 A;  1X83 A;  1SAU A;  3G1L A;  5GHJ A;  1LFU P;  1L0O C;  3OYE A;  5HLT A;  3A0B C;  3VYS B;  3LA3 A;  5LGT A;  2DYS H;  3LSP A;  3BZC A;  2OZU A;  1ZRF A;  5FSL A;  3I59 B;  3L7W A;  2M7B A;  5HLI A;  1VQ6 I;  1A5J A;  4EQQ A;  2DK5 A;  3MCF A;  1YW7 A;  5CFI A;  4GFB A;  3SDB A;  2F4M B;  2KLO A;  2QQB A;  3BQY A;  2L4M A;  2CV0 A;  1P6R A;  1BIA A;  3PNY A;  2W7N A;  2GLO A;  1CQT A;  5E3O A;  4ZJZ A;  5FSK A;  4OMY A;  3FJY A;  3N77 A;  1E0E A;  2EK5 A;  3HRS A;  2YVN A;  3DEU A;  3VSK A;  2K4B A;  3KZI C;  1VZ0 A;  5FKN A;  1C0W A;  1ZLJ A;  2OQG A;  1POG A;  3DQV C;  1YI2 I;  2XAF A;  1JJ6 C;  3MDI A;  3V7C A;  3CCL I;  1J0R A;  3V7S A;  4BQA A;  1OR7 C;  4XKB A;  3EYI A;  2R7F A;  2A8P A;  1BJA A;  4KIC A;  2DOF A;  3K7A J;  3AAF A;  5L3B A;  3I4N J;  1V8Y A;  2XUB A;  2RN7 A;  4MLO A;  5LHI A;  1ACI A;  3G1O A;  3MVP A;  3TOA A;  1EJ9 A;  3A6S A;  1JKP C;  1STZ A;  4M9S A;  3L85 A;  3CD6 I;  3GVA A;  2DYR H;  3MZH A;  3M8J A;  3Q9S A;  2JK3 A;  1U78 A;  4CHU A;  2JRT A;  1KTG A;  5CVU A;  5LRR A;  5JLX A;  5LRS A;  1E2X A;  3J7Y J;  4C2U A;  2G73 A;  3NRV A;  4DZJ A;  1TZL A;  1B1B A;  5IYB J;  5ICG A;  2HZT A;  3IL2 A;  3GTL J;  2VPL A;  4A3G J;  1Z1D A;  3K2Z A;  1ETO A;  4ESB A;  3C3W A;  3BDD A;  2CW7 A;  2VI6 A;  2VAS A;  2X9D A;  1BOA A;  2ICJ A;  4ILQ A;  2HDW A;  3AKZ A;  1D5V A;  1GT0 C;  3P9K A;  3FM5 A;  2IXS A;  4AWX B;  2PX9 A;  3F8F A;  2NXN B;  4HF0 A;  3ZQG A;  2K4J A;  2E71 A;  4A3I J;  4BH9 A;  1V8N A;  2P7V B;  3PSI A;  4IRI A;  1FOX A;  2KIQ A;  2HTJ A;  3JAM Z;  1NK3 P;  2JTV A;  2NVT J;  4XKW A;  1Y6I A;  3MCZ A;  3CF2 A;  1ZGJ A;  4DQ2 A;  1MR2 A;  1PPX A;  2HQ5 A;  4BEH A;  1N78 A;  3QOE A;  2R3S A;  2ZSH B;  4U87 A;  2PMH A;  3W2W A;  1IRF A;  4FAS D;  1UG2 A;  5LEK A;  1YQA A;  2JZY A;  3GRN A;  2AZW A;  3HOU J;  3VYT B;  4MNU A;  3E0J B;  3SFZ A;  2NOJ B;  5J1Y A;  1YFH A;  1RRQ A;  2VBZ A;  3HUG B;  4BXU A;  4A0Y A;  4D7M A;  2RNG A;  2Z99 A;  3S17 J;  4KYW A;  4FET A;  2Y0M A;  1ZH5 A;  1ZGA A;  3GWZ A;  4FIS A;  3HBL A;  2OC6 A;  1MBG A;  3O69 A;  1JHH A;  1R22 A;  2L7K A;  3ABU A;  1RYA A;  4UUS B;  5L3F A;  1TLH B;  1YS7 A;  3K4K A;  3RKX A;  2GAU A;  4K6E A;  2RC4 A;  3G2B A;  2FML A;  3ERM A;  3OYA A;  2H8R A;  3ECO A;  1JKN A;  4ANJ A;  3GX4 X;  2LD5 A;  3K10 A;  1SAX A;  1S3J A;  2A6E F;  2KIS A;  4ETS A;  5HZX A;  3CJN A;  1DP3 A;  3ZR8 X;  5EG0 B;  2MD5 A;  1HW1 A;  3E97 A;  4WXH A;  2XGC A;  2OCC H;  1D8J A;  5M5Y J;  4HQE A;  4DNC A;  1HW2 A;  1WSU A;  2DOE A;  2HS5 A;  1IF1 A;  2VBY A;  4RAZ A;  1IN6 A;  4CCN A;  1J9I A;  1UJ8 A;  1MND A;  4D5C A;  1V8R A;  5GHQ A;  2IEK A;  1XSA A;  2E1C A;  2K5C A;  1P92 A;  5BPD A;  2LY9 A;  1WI9 A;  4DYC A;  5IP7 J;  5EGO A;  4U7B A;  5IT9 Z;  3S93 A;  4CSW A;  4Y7N J;  3X0N A;  3RKY A;  1X4O A;  1D0X A;  1IAW A;  1HKQ A;  3CMA I;  2LF8 A;  4B44 A;  2ICK A;  1XDS A;  5DCM A;  1OPC A;  2QSG X;  4HQM A;  2M45 A;  5FFZ A;  5HDN A;  3EF5 A;  4NFX A;  4KT5 C;  2EV6 A;  2G7U A;  2XHK A;  1X3U A;  4YIR X;  4IRG A;  1MH4 A;  4L5E A;  2DA6 A;  2A8R A;  1PP7 U;  1U0J A;  5LHH A;  5D5V B;  3QOD A;  4D9J A;  3CO7 C;  4CIC A;  2FEZ A;  2DI3 A;  3ZRG A;  1Z91 A;  1P9Q C;  4HV6 A;  2AO9 A;  1MUT A;  4II2 A;  1IN5 A;  2M87 A;  2X85 A;  3KCC A;  2VJ4 A;  3PM1 A;  1WVR A;  2LTP A;  3Q2T A;  2V1X A;  2NS7 A;  3DU6 A;  1RRS A;  3BJO A;  5HOD A;  2F4O B;  1MK1 A;  1WZ2 A;  3DF8 A;  1UZC A;  4MTD A;  3F8B A;  3GEZ A;  1BIB A;  2CQ7 A;  2M0C A;  3PFI A;  5E3M A;  3HZJ A;  2L9S A;  2DW4 A;  5KVR A;  2CYY A;  1KON A;  1U5T C;  1B4A A;  1LE8 A;  1NQY A;  1PUN A;  3LMM A;  2HZD A;  3MAJ A;  3FK6 A;  3DEE A;  2VE8 A;  3OSF A;  3ZR1 A;  4MPO A;  5GAE J;  3VWB A;  3F0C A;  2WV1 A;  2CUJ A;  2ZNZ A;  5IP6 A;  4G7Z F;  2EV0 A;  3M8F A;  3QP5 A;  5IOZ A;  1HA8 A;  3ZGK A;  2CS3 A;  1TNT A;  3ABT A;  2XF6 A;  1Y0N A;  1G2H A;  4G8X A;  4EEF G;  1ZAO A;  1V5F A;  3D1N I;  1QVJ A;  3OYB A;  4FE4 A;  3BG9 A;  4PGG A;  1SFO J;  2JA8 J;  3Q1P A;  1U5T A;  2CV1 A;  3BQZ A;  3A2K A;  2A8T A;  3FWE A;  5I8U A;  1TW2 A;  5B5E C;  4JX6 A;  1NFZ A;  4ZDO A;  2L01 A;  3KP5 A;  4JZV A;  4QWQ A;  4UB8 C;  2O7O A;  4LLL A;  5ERI A;  3FMR A;  1BR2 A;  2F6C A;  1VQN I;  4AM3 A;  2H1K A;  1F9N A;  2VT2 A;  3TO6 A;  2FA5 A;  3DPL C;  2DFI A;  1S9H A;  1MSE C;  3VOD A;  1QZY A;  3G1M A;  3CP2 A;  3FXJ A;  2ZJP F;  2TDX A;  5HNH A;  2JSC A;  1R5H A;  3WHC A;  5KHD A;  4XRM A;  3ID9 A;  5ANW A;  2ZME B;  1WH7 A;  4OU0 A;  3LQR A;  2Z3Y A;  3FDY A;  3I7U A;  2KQR A;  1V8U A;  1MJ9 A;  3LSH A;  4Y52 J;  4BS9 A;  1TT5 B;  3EPZ A;  4ZTJ A;  4OIP F;  1Z05 A;  2XSJ C;  4KG3 A;  5JVT A;  3M7G A;  1ETQ A;  3BR3 A;  3K6G A;  4ZYA A;  2MH2 A;  4XSX F;  5E3N A;  5B3S H;  2VLA A;  3FF5 A;  2RDP A;  4DW6 A;  1K7A A;  3BR5 A;  2EFO A;  4B8X A;  3ABL H;  1AA7 A;  3HRU A;  1TWA J;  1QZZ A;  2E34 A;  1T33 A;  2VT3 A;  4I7H A;  2W25 A;  1ZG1 A;  3GYH X;  1JKR C;  4HSR A;  1DDN A;  5HS7 A;  4KJZ A;  3TOB A;  3BJA A;  1W7P B;  1IDZ A;  4XKC A;  3BZ6 A;  2KHM A;  5DYM A;  2D2W A;  4DYW A;  1NG7 A;  1YE9 A;  4HG2 A;  1RRJ A;  1VIQ A;  5FLX K;  2D45 A;  1SVL A;  4EJT A;  4KMF A;  3K1P A;  2VQL A;  3JRF A;  2HKO A;  4HDU A;  2HDD A;  1FOW A;  3MKY B;  3UR3 C;  1QO0 D;  2HOS A;  5FJ8 J;  3RPQ A;  3BY6 A;  2VIX A;  1X3W B;  2Z1D A;  4IZZ A;  1TWH J;  4HOB A;  1JT0 A;  4NBQ A;  4GGG A;  4K2E A;  1MSF C;  3MKZ A;  1XGS A;  4B3X A;  1FYL A;  3I7V A;  4D1Q A;  4AU7 A;  3OYL A;  3ASO H;  5D4R A;  3SON A;  2V7F A;  3X0K A;  3X0O A;  3Q3S A;  3IUO A;  4EJU A;  1T8I A;  3JRE A;  3KLN A;  4IHX A;  3LOC A;  1E17 A;  1IG7 A;  2V6C A;  4ON0 A;  1JUS A;  2KZG A;  4KIS A;  2DUK A;  2CQN A;  2VKD A;  2QEX I;  1V8S A;  3KZY A;  1CF7 A;  4M6Y A;  3PO2 J;  3MKL A;  2O5R A;  1RI7 A;  1IRY A;  4BE2 A;  1WH5 A;  3DFG A;  1XC5 A;  3HGY A;  4WX9 A;  1UFM A;  2JT1 A;  3KPH A;  4LD5 A;  4N9I A;  3ECH A;  2DA2 A;  2B0L A;  1AOY A;  3QYF A;  1G9Q A;  4A3C J;  1XGM A;  2BYV E;  5CQG A;  4LG0 A;  1UHS A;  2W24 A;  5EEA A;  4KYX A;  1J2X A;  2YYH A;  1ON2 A;  3HOW J;  5FD5 A;  4PGH A;  1EH7 A;  3H9Q A;  2R7Q A;  2VJI A;  2ELK A;  2V1N A;  2E1M C;  2HOE A;  3BPX A;  2L9V A;  4YFN F;  1WCM J;  1Z7L A;  2ZXW H;  1XSC A;  2M3A A;  4QLC U;  2QF7 A;  2BBY A;  1TUM A;  3O3K A;  2A05 A;  1WQ2 A;  3I55 I;  2XVC A;  1W5T A;  4Z2Y A;  5FSO A;  2VJJ A;  2LBF A;  1TNS A;  5F0F A;  2H8W A;  3PUF A;  4HRI A;  1USS A;  1YOV B;  4G6D A;  3D0S A;  3LQQ A;  2A8S A;  1TW3 A;  4XLP F;  3HOT A;  3L2Q A;  5HNF A;  4LLG F;  4B47 A;  3KP2 A;  3Q0U A;  5GHM A;  2V9P A;  2MLG A;  4C30 A;  4H0E A;  5FKL A;  4CZC A;  3FFU A;  1PUS A;  4XR6 A;  2QQA A;  2GOX B;  2ZSI B;  5DM6 F;  1YRN B;  1RR7 A;  5F08 A;  5J1U A;  5D8L B;  5E8I A;  4DZP A;  2MFZ A;  3M3Y J;  3FHN A;  4C2M J;  3J81 K;  4BDZ A;  2XRL A;  1MP2 A;  2A6H F;  4DGW B;  2X0L A;  2VQC A;  2IGM A;  1F43 A;  2LY2 A;  5H6R A;  2PMU A;  1ETW A;  1V8I A;  1SOI A;  4E7Z A;  5GHI A;  2LRD A;  1GV2 A;  4LK1 F;  3OYC A;  3AG4 H;  4AUX A;  1F5T A;  1G59 A;  1B72 A;  4M6V A;  5CVJ A;  4BBR J;  3HB9 A;  1O3R A;  5GHN A;  3I3L A;  3MFK A;  1DU0 A;  1B59 A;  2MBF A;  5DEQ A;  5B1A H;  2QCO A;  4ZYD A;  2WY8 Q;  4GYG A;  4XKV A;  5CFJ A;  2GIV A;  4BAY A;  4JX5 A;  3QPS A;  4KA4 A;  1IRZ A;  2LFB A;  2QJO A;  4HF2 A;  1V8V A;  2DA4 A;  1S72 I;  1HSJ A;  1P2F A;  4KUM A;  2L54 A;  1GV5 A;  1OIS A;  3AG2 H;  3IHU A;  3X0I A;  4CCL A;  3EQL F;  3X0R A;  3PSF A;  3E5X A;  2Z33 A;  2HU9 A;  1QHG A;  3A01 B;  2ZJQ F;  2G7H A;  3ASN H;  3F8C A;  3MZY A;  3C1D A;  2BHZ A;  2EIN H;  3CJQ B;  4CYC B;  3GTO J;  1ZN2 A;  2K9N A;  4HX7 A;  1HKS A;  5J8C A;  4UY8 I;  5EF6 A;  3ZQ7 A;  3DTE A;  5IYD J;  1Y39 A;  1FNN A;  2EV5 A;  2Y30 A;  1R5G A;  3UNG C;  3MZ8 A;  5IT3 A;  5GAH J;  4HDV A;  1E3H A;  3M1C A;  3RQ4 A;  2W85 A;  5F1J A;  3O6Z A;  2E1N A;  2FE3 A;  4BJ5 C;  5EZG A;  1R00 A;  2HDC A;  1MH3 A;  1JTX A;  5EEG A;  4CCJ A;  3HSE A;  2GXB A;  3CJR B;  4G9Y A;  3FKJ A;  3L1P A;  3TED A;  3F6V A;  1ZG5 A;  5ILV A;  3WU0 A;  1K78 B;  3EUH C;  3K9T A;  4WF2 A;  4Y4R A;  2J5P A;  1PUE E;  2Q2E B;  2E2J J;  3S3N A;  1HC8 A;  1VTN C;  5HLG A;  2HOT A;  2FMY A;  2PQ8 A;  1XMK A;  2L9N A;  4XRS G;  3BTL A;  4A2U A;  1TBX A;  1V5E A;  2GA2 A;  2DXI A;  4HX8 A;  2CQK A;  2V1U A;  2B63 J;  1Z3X A;  3KEO A;  4ASN A;  3DCF A;  4QPQ A;  4HW0 A;  3GO5 A;  1KA8 A;  3S16 J;  2K27 A;  4JYK A;  2M30 A;  2WBM A;  2XRO A;  2PMZ N;  1SFX A;  3GFM A;  4L9J A;  3WHB A;  2EB7 A;  2HPI A;  4BHP A;  2STW A;  1BI2 A;  1MMG A;  2LLK A;  2VKE A;  4FE7 A;  3S15 J;  3KEQ A;  2KRF A;  2LF7 A;  3E7L A;  3EUH A;  1YG2 A;  3GUD A;  5D8K B;  3IV5 A;  4KMU X;  2XIG A;  4Y3O A;  2E2H J;  3GTJ J;  2L4A A;  3GWY A;  1TWG J;  5GPC A;  3DUP A;  5CYV A;  3PIO F;  1W5C C;  3TP0 A;  5GP9 A;  2VOD A;  5DPK A;  1Y8Q B;  2DMQ A;  4CUG A;  5GAG J;  2RQP A;  3KIO A;  4KNY A;  1YIO A;  4EV0 A;  3IWF A;  2PMZ A;  5DUK A;  1FP2 A;  4HPQ A;  1SMT A;  1QZE A;  9ANT A;  2XAJ A;  1I1G A;  4XRS A;  3X0M A;  1HW5 A;  3ML6 A;  3HEF A;  2BXZ A;  1A36 A;  4B09 A;  4WCG A;  4ENK A;  2V79 A;  1JTY A;  1RUO A;  5HOO A;  3AL0 C;  5F04 A;  3VSL A;  2Z5U A;  2O0Y A;  5C4J J;  3A6V A;  2G9W A;  2FD5 A;  1PPW A;  4L9T A;  1FP1 D;  4MQV A;  5FGM A;  5J47 A;  3JRA A;  3R6S A;  3OL3 A;  2Q9P A;  2E36 A;  3TDU C;  4O6J A;  1O3S A;  3W6V A;  1UHW A;  1LDK B;  5FO5 A;  1Z0X A;  3OIO A;  1LPQ A;  2DPU A;  3F21 A;  4NFW A;  1H89 C;  1HXD A;  1U6G A;  3F8M A;  3PNT A;  3VB2 A;  1UAA A;  3KVH A;  2DPD A;  1BW5 A;  3S1M J;  4AC0 A;  1ULY A;  1ETV A;  1I5Z A;  3V8K A;  3EUK L;  1SC7 A;  3PQJ A;  2I5U A;  2UXX A;  3HOZ J;  4ZTF A;  3ZMU A;  1VQ5 I;  4S2V A;  4XOR A;  2NVU B;  5KK1 A;  1LEA A;  4HNT A;  3COA C;  3ZOB A;  4EM0 B;  4A93 J;  4CXF A;  2PFB A;  2NVX J;  3DBR B;  1HQC A;  2R7W A;  3FSP A;  1FY7 A;  2O6G E;  3N9U A;  5EYR A;  3JAM K;  3PJR A;  2ECC A;  1OCC H;  1MD0 A;  5EZH A;  2YVO A;  1H9G A;  2E35 A;  1B8I A;  4HST A;  3S8P A;  3I5U A;  1HZT A;  2QSH X;  4CCK A;  2R0Q C;  4D5F A;  2MD0 A;  3OYJ A; 
#chains in the Genus database with same CATH homology
 3OMY A;  3OYD A;  2V26 A;  2MC4 A;  2FUG 2;  3K10 A;  3HPH A;  1KHZ A;  2BW3 A;  3EEU A;  2P0W A;  5HZX A;  3J7Y e;  1DP3 A;  3ZR8 X;  2GT2 A;  4KTB A;  4Y33 A;  2JVB A;  1TT0 A;  3OR1 C;  3HPG A;  4KT6 A;  4BEH B;  4BE1 A;  4S2W A;  4ZDL A;  4ZG0 A;  3J7A Y;  2OV7 A;  2CH0 A;  4XL9 A;  3GG6 A;  2X6X A;  2BVM A;  2R7T A;  4E6K G;  2VXD A;  3AL0 B;  4QPO A;  1PPV A;  2WAF A;  4CCN A;  3ZQQ A;  1MND A;  1V8R A;  2BOL A;  3DPU A;  5GHQ A;  1XSA A;  2K5C A;  3H5N A;  3L2V A;  4BUP A;  3RCO A;  3BM4 A;  4DBQ A;  3OS2 A;  5GHO A;  3QYE A;  3MDG A;  2O5W A;  3K70 C;  4DJA A;  4U7B A;  3F9K A;  3S93 A;  2ELJ A;  4KG4 A;  3W2A A;  5KCM A;  4CSW A;  4HEA 2;  3X0N A;  1X51 A;  3F13 A;  1X4O A;  4JZT A;  1D0X A;  2K9L A;  3EES A;  1MMN A;  4B44 A;  2ICK A;  3DWL E;  2E5Z A;  1Q54 A;  2AQE A;  1PYV A;  2I8D A;  4IQ4 A;  3EF5 A;  4NFX A;  3SHD A;  2BW3 B;  2E5N A;  1BR4 A;  3BG6 A;  5HVQ C;  2UV1 A;  4PFO A;  4DBR A;  3PUB A;  2A8R A;  1FMW A;  2WY7 Q;  2J8Q A;  1U0J A;  3OYK A;  3QOD A;  3SYT A;  3TMO A;  2KRH A;  3CZ6 A;  4D9J A;  4R79 A;  2A5W A;  2PNY A;  3ZRG A;  3DKY A;  5FSI A;  1P9Q C;  5DDG A;  3KEY A;  1MUT A;  2L2O A;  4II2 A;  2X85 A;  2GOM A;  2VJ4 A;  2UUZ A;  1G8X A;  3BCA A;  3Q2T A;  2LYC A;  3OYF A;  3DU6 A;  2IS1 A;  1RRS A;  1OLT A;  1MMA A;  2X51 A;  4P5O A;  4E7K A;  1MK1 A;  1WJA A;  2X6Y A;  3W3C A;  2QJT A;  3DU5 A;  2LH9 A;  1T0F C;  2FKB A;  3X0S A;  2L9S A;  1VCD A;  4P1W A;  1F3Y A;  4HNU A;  2X1D A;  4PSX A;  5CKT A;  1KON A;  3DKX A;  3HHJ A;  3O52 A;  2YVP A;  3PNV A;  1NFS A;  1NQY A;  1MQW A;  1PUN A;  3LMM A;  2HZD A;  3W2V A;  1VK6 A;  3DEE A;  3H95 A;  3O8S A;  2JA2 A;  4CCM A;  2CZR A;  3R03 A;  5C7Q A;  1MNE A;  4PSW A;  4MPO A;  2KPM A;  2I6K A;  3ZR1 A;  2IGN A;  3VWB A;  1WJB A;  2X1C A;  3D5R C;  4CCO A;  2B06 A;  4OAY A;  2CUJ A;  2R7X A;  3BLY A;  3AC9 A;  2YVM A;  1BR1 A;  2K9M A;  4BDY A;  3S3M A;  4F52 A;  5JHF A;  4PJJ A;  1HA8 A;  1W36 C;  3ZGK A;  2CS3 A;  4S2X A;  2XF6 A;  4LIT A;  2UWM A;  1V5F A;  3D5S C;  5CQE A;  3SEQ A;  3OYB A;  1QVJ A;  3X0P A;  3OYN A;  3WHW A;  1Q27 A;  2CV1 A;  3Q1P A;  3A2K A;  2A8T A;  5I8U A;  2JVG A;  1NFZ A;  4ZDO A;  2KDO A;  4JZV A;  3FBI B;  4XQF A;  4JOM A;  1BR2 A;  1UG0 A;  2F6C A;  2KP6 A;  4JZS A;  4OWR B;  2HVR A;  2DT7 B;  3D5L A;  2XF5 A;  5BON A;  3DPL C;  3HC7 A;  1S9H A;  2GB5 A;  3H5R A;  4F91 B;  3CP2 A;  1NQZ A;  5ANV A;  4RLF A;  5HNH A;  3ACA A;  4II3 A;  5KHD A;  2IS6 A;  2W4E A;  3OY9 A;  1VRL A;  3ID9 A;  2VL8 A;  5ANW A;  1X1A A;  1PUQ A;  4C9Y A;  3FDY A;  4E7I A;  3I7U A;  2KQR A;  1EA3 A;  1V8U A;  1X4P A;  3LSH A;  1ERD A;  1K26 A;  2JUG A;  3ZR0 A;  2QKM B;  4BS9 A;  3OS0 A;  3K4L A;  3SZG A;  3EPZ A;  2B0V A;  2VQH A;  4YRV A;  4ZTJ A;  4YOQ A;  2LRE A;  2XSJ C;  2LG4 A;  4KG3 A;  3K4B A;  2R5W A;  4C9X A;  4XOP A;  3K6G A;  4ZYA A;  2DCE A;  1T95 A;  2OUM A;  1D1B A;  2JVH A;  1DGR M;  2LC2 A;  2VLA A;  2B2K A;  3LL7 A;  2HPM A;  2M4G A;  4ITV A;  1QU3 A;  4PUS A;  1AA7 A;  2CV2 A;  2VB6 A;  3OS1 A;  1V8M A;  1SFK A;  1Q33 A;  2ZXH A;  4HSR A;  4JQF A;  4KJZ A;  4XN0 A;  5FSN A;  3Q4I A;  4XKC A;  4B43 A;  2KHM A;  1WFX A;  3H5A A;  4DYW A;  2R7U A;  1NG7 A;  3NWS A;  1YE9 A;  4HG2 A;  2O1C A;  2L5Q A;  1VIQ A;  4BQO A;  4H4K C;  3OYI A;  3DLA A;  3Q93 A;  2LOO A;  2VQL A;  4E7J A;  2Z2S B;  4F93 B;  1D0Z A;  3MKY B;  3F6A A;  4BJ6 C;  4RM2 A;  2HQA A;  4BQN A;  4BXF A;  3UR3 C;  1U20 A;  4ICK A;  4ZDP A;  2VIX A;  1QHH D;  4IZZ A;  2Z1D A;  3K4J A;  2VJ5 A;  3I9V 2;  1N77 A;  5GHP A;  3MKZ A;  2XAU A;  4B3X A;  4PFP A;  4RLQ A;  3K4M A;  3I7V A;  5ISY A;  4D1Q A;  4AU7 A;  2CW8 A;  3OYL A;  1WJF A;  1PJR A;  3SON A;  2V7F A;  3X0K A;  2A6T A;  3X0O A;  3OIP A;  3IUO A;  2PQV A;  3RH7 A;  3HKZ A;  4DOZ A;  4V14 A;  2RQQ A;  3IAS 2;  1D1A A;  3PL8 A;  2CMP A;  2W1O A;  1R67 A;  2KRC A;  4KIS A;  2DUK A;  2VKD A;  2R7O A;  4E4H A;  1V8S A;  4NQW B;  3OIQ A;  4PJN A;  4F3Q A;  3NWT A;  2O5R A;  1IRY A;  4ANJ A;  1GLN A;  4BE2 A;  3DKU A;  3OWT A;  3SEZ A;  4PJL A;  5ANS A;  3QYF A;  1G9Q A;  5KNL A;  4BAC A;  3IP4 B;  3DTK A;  5LFA A;  5CQG A;  1BOB A;  4KYX A;  1DGW Y;  5CPR B;  4C2T A;  1DQU A;  2YYH A;  3X0J A;  1HX3 A;  2Z16 A;  5TGT A;  3CNG A;  3G0Q A;  3C2H A;  3ZXS A;  3OYG A;  3E1S A;  2PJR A;  3FK9 A;  3H9Q A;  2R7Q A;  2WAQ A;  3CES A;  2VNQ A;  2VJI A;  2DT6 A;  3A6U A;  2VQG A;  4GRI A;  4C9W A;  1WJD A;  2FVV A;  2V1N A;  4PK4 A;  2E1M C;  1OW2 A;  2G74 A;  4JZU A;  2Q1Z B;  3H9J A;  1JRK A;  3MD2 A;  3CMM A;  4XLF A;  3LFU A;  5ANU A;  1WJC A;  1Z7L A;  3QSJ A;  2O5F A;  4F92 B;  1ZEL A;  3QYB A;  2DJI A;  1XSC A;  2M3A A;  4XOT A;  3S32 A;  2M7A A;  1TUM A;  3H35 A;  4LG3 A;  3E57 A;  3EXQ A;  4X0G A;  4YPR A;  4AVZ A;  2M4K A;  5FSO A;  2VJJ A;  2LBF A;  5FRM A;  2XC7 A;  4XN3 A;  3RTR A;  3A4C A;  2X1E A;  3MGM A;  2R7V A;  2R4G A;  4ZC3 A;  4HRI A;  4J00 A;  2DHO A;  2XDV A;  1V8T A;  2A8S A;  3ONQ A;  3HOT A;  3L2Q A;  2IS2 A;  5HNF A;  4B47 A;  3L2U A;  5GHM A;  5IW4 A;  2CFO A;  4S2Y A;  4C30 A;  3H0D A;  2ZXI A;  4CZC A;  3FFU A;  3K70 D;  3BC8 A;  4XLA A;  2KMU A;  1K2E A;  4XR6 A;  1PUS A;  4IKF A;  3DPT A;  3A6T A;  2DOA A;  3FBN B;  2GOX B;  2ZSI B;  5DD4 A;  4LIV A;  2V6E A;  5C7T A;  2MFZ A;  2PJR B;  2LY1 A;  1JI8 A;  3FHN A;  4CH7 A;  4B48 A;  4BDZ A;  3C2G A;  1MP2 A;  1Z21 A;  4DGW B;  1VC8 A;  3MMY B;  4YEL A;  2VKH A;  1XSB A;  2VQC A;  4AYB A;  3GBG A;  2IGM A;  2F4I A;  2DSC A;  3LSK A;  2LY2 A;  3H9G A;  3L2W A;  4E7H A;  1V8I A;  4BGD A;  1VIU A;  4XLE A;  3OL4 A;  3K4N A;  4E7Z A;  2LRD A;  1SOI A;  5GHI A;  3BG7 A;  3OYC A;  3HOS A;  2IGK A;  3X0L A;  1G59 A;  3HYQ A;  4E7S A;  5LD2 C;  1IRX A;  2KL4 A;  1VHG A;  3I3L A;  5GHN A;  3U21 A;  4RM3 A;  2LBF B;  3OYH A;  5FRN A;  5DEQ A;  1D0Y A;  2CL3 A;  2W4S A;  1V8W A;  2HNH A;  2WY8 Q;  4XKV A;  2KZV A;  5CFJ A;  4BE0 A;  1X19 A;  3PFY A;  3CP8 A;  4RMN A;  2R7S A;  3SMD A;  2QJO A;  2E1M B;  1Z3Y A;  4G6T B;  1V8V A;  4J7G A;  4YPH A;  4F55 A;  1Y56 A;  5IW5 A;  3X0I A;  4XNF A;  2A8Q A;  4CCL A;  3X0R A;  3S3O A;  2I8U A;  4HFQ A;  3PSF A;  2BVL A;  2IGO A;  3RPU D;  3V42 A;  3HL2 A;  2HU9 A;  3KX2 A;  1QHG A;  4BU2 A;  4J01 A;  3BHO A;  4PJM A;  3OR2 C;  4NC7 A;  2RRE A;  2M0M A;  2W82 A;  3CJQ B;  1KT9 A;  1X83 A;  1SAU A;  5GHJ A;  2DSD A;  4NC8 A;  5HLT A;  3OYE A;  3HXL A;  3VYS B;  2MAB A;  2JSP A;  3HG9 A;  3DTE A;  2V9K A;  5FSL A;  1W36 D;  5BS6 A;  2VXZ A;  4IJX A;  4XLC A;  3VYR B;  3UNG C;  2M7B A;  3LSG A;  3TL4 X;  3MCF A;  3M1C A;  5CFI A;  2F5V A;  3RQ4 A;  3O6Z A;  4N4O B;  1J09 A;  4NNJ A;  3SDB A;  5FRO A;  4NUB A;  2KLO A;  4BJ5 C;  4EAT A;  1YX3 A;  2CV0 A;  4CCJ A;  3PNY A;  2W7N A;  3CJR B;  4ZJZ A;  5FSK A;  3FJY A;  3FKJ A;  2GT4 A;  2IS4 A;  1FMV A;  3N77 A;  3K4C A;  3TBI A;  3EUH C;  1E0E A;  3OGA A;  4Y4R A;  2Q2E B;  2Y0S A;  3S3N A;  2YVN A;  3OYM A;  3VSK A;  3COU A;  1VZ0 A;  4HVY A;  3DQV C;  3MDI A;  2L9N A;  1V5E A;  4BQQ A;  1SJY A;  2DXI A;  2XF7 A;  2W00 A;  1Z3X A;  1OR7 C;  4XKB A;  3N05 A;  2A8P A;  2I8T A;  1SU2 A;  4QPQ A;  3P5T A;  4N1T A;  1V8Y A;  3Q2S A;  2X6W A;  2WBM A;  4MLO A;  1NG6 A;  3I9X A;  3A6S A;  5ANT A;  2HPI A;  1R6R A;  3L85 A;  1MMG A;  4J7H A;  2WAD A;  2K3P A;  3ZCO A;  4DIQ A;  1V5G A;  3M8J A;  3BAP A;  4Y3O A;  3VYU B;  3L2R A;  3GWY A;  1KTG A;  1X1D A;  3EUA A;  3DUP A;  4C2U A;  1I9A A;  1MMD A;  2G73 A;  4LIU A;  1TZL A;  1PVF A;  5DPK A;  4CUG A;  4IQJ A;  2KDV A;  2VPL A;  1X1B A;  4KIT B;  2VNP A;  2PMZ A;  4HPQ A;  2CW7 A;  3FCM A;  3GZ5 A;  2VAS A;  2ICJ A;  4ILQ A;  4XMY A;  2HDW A;  2WB1 A;  3RSN A;  3AKZ A;  1N75 A;  3X0M A;  2V4J C;  3MKW B;  1WJ5 A;  3U53 A;  2IXS A;  4CA0 A;  3AFH A;  1VHZ A;  3P6Y A;  5HOO A;  3AL0 C;  1VC9 A;  3VSL A;  4XON A;  3X0Q A;  3A6V A;  1V8N A;  3PSI A;  1SZ3 A;  2KDW A;  5FSM A;  2R7R A;  1PPW A;  2HVS A;  5C8L A;  1K6Y A;  4XKW A;  1Y6I A;  1LKX A;  3CF2 A;  2DSB A;  3GZ8 A;  1MR2 A;  3OL3 A;  2Q9P A;  1PPX A;  4N4N B;  4BEH A;  3KYL A;  1N78 A;  2WA0 A;  1LDK B;  3LSI A;  3OOU A;  3QOE A;  3Q91 A;  2ZSH B;  4U87 A;  4FAS D;  3W2W A;  4NFW A;  1WJE A;  4IX7 A;  3PNT A;  2CUZ A;  1UAA A;  2XSQ A;  3KVH A;  3VDX A;  3GRN A;  3O61 A;  2AZW A;  4BL0 B;  3VYT B;  2QKL B;  1LFP A;  1LVK A;  5LPG A;  1X84 A;  4E7L A;  3EUK L;  4OAZ A;  4XLH A;  1X1C A;  3E0J B;  3IAM 2;  1D1C A;  4ZTF A;  1GA7 A;  4S2V A;  2NOJ B;  4XOR A;  2WAE A;  1RRQ A;  1MQE A;  4HNT A;  3HUG B;  2RNG A;  2MYS A;  4N1U A;  3BCB A;  1MW7 A;  4FET A;  2AQF A;  2E60 A;  4BJT A;  2R7W A;  3FSP A;  2OC6 A;  3O69 A;  3N9U A;  3PJR A;  2L7K A;  1RYA A;  2YVO A;  1YX5 A;  3A1Y A;  2RRK A;  4HST A;  3K4K A;  3S8P A;  1V8L A;  2HVQ A;  4XM3 A;  4K6E A;  1HZT A;  1UEL B;  3G2B A;  4CCK A;  3OYA A;  4YEJ A;  2FML A;  3GZ6 A;  3DTI A;  1JKN A;  1G0S A;  2MD0 A;  2ZFU A;  3OYJ A;  3LSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...