2A6TA

Crystal structure of s.pombe mrna decapping enzyme dcp2p
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
245
structure length
230
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFEISKIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIANNTTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPAC19A8.12
publication title Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Rna binding protein,hydrolase
total genus 63
structure length 230
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a6tA01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2a6tA02
1PPVA 1VC8A 2O5WA 4KTBA 1KT9A 5GHMA 2KDVA 3N77A 3X0SA 1G0SA 4C9WA 5FSIA 3Q93A 3P5TA 5GHOA 3WHWA 1VRLA 5CFJA 3Q91A 5DEQA 1SU2A 5IW5A 3MDGA 4K6EA 1MQEA 2A8RA 3ID9A 4HFQA 2AZWA 3DUPA 1PUNA 2G73A 2DUKA 2O5FA 1SJYA 4C9XA 5DDGA 4N1UA 1X84A 1XSBA 3R03A 5FSOA 3X0MA 2ICJA 1SZ3A 1Q54A 1X83A 3A6VA 2ICKA 3A6TA 3DKUA 2CL3A 1VHGA 3GWYA 1KTGA 5GHPA 5ISYA 2YVMA 4YOQA 4ILQA 1NQYA 2FKBA 1MUTA 2W4EA 2YVPA 3O61A 5GHIA 3SHDA 1F3YA 2QKMB 5I8UA 1K26A 3O8SA 1R67A 3HYQA 2FMLA 5BONA 4S2VA 4NFWA 3HHJA 4ICKA 1IRYA 5ANSA 2I8TA 2GT2A 3GZ6A 3OGAA 2VNPA 3X0JA 5C7TA 3Q2TA 4YPRA 2PQVA 3COUA 2YVNA 3X0RA 1V8WA 3X0IA 1V8TA 3FJYA 3GZ5A 1PUSA 3O6ZA 1Q27A 3N9UA 3EF5A 2B06A 2QJTA 4NFXA 4KG4A 3Q1PA 5IW4A 1TUMA 1PPWA 3O69A 3X0PA 3ZR1A 3SMDA 3X0NA 1HX3A 5LPGA 4S2WA 2I6KA 3Q2SA 5FSLA 3F6AA 3F13A 2DSBA 2Q9PA 5ANVA 1V8LA 5CFIA 3CNGA 3KVHA 3L85A 1HZTA 3U53A 2A8TA 1V8MA 3J7Ye 2QJOA 1VHZA 1MQWA 4N1TA 3GZ8A 2A8SA 3EXQA 3P6YA 3FCMA 4YPHA 2A8PA 1I9AA 2A6TA 3FK9A 4S2YA 3I7VA 1V8SA 1XSCA 2FVVA 3AC9A 2O1CA 3BHOA 3EESA 1RYAA 3BAPA 5C8LA 2B2KA 3RH7A 3FSPA 1RRQA 1G9QA 1VCDA 2RRKA 1SOIA 1U20A 2A8QA 2DSCA 5GHQA 4ZG0A 1V8NA 2DSDA 2GB5A 3X0QA 5GHJA 1NFSA 3X0OA 4V14A 3GRNA 2XSQA 3BM4A 1V8RA 4JZSA 5GHNA 3GG6A 1Q33A 5FSNA 3QSJA 1V8UA 4KG3A 4DYWA 2QKLB 3ZR0A 1PPXA 5DPKA 1V8YA 3MDIA 3ACAA 1NFZA 2YYHA 4MPOA 2G74A 1VIUA 5C7QA 3H95A 5HZXA 4IJXA 1VK6A 3A6UA 4S2XA 4JZTA 5FSKA 3SONA 5FSMA 2JVBA 2VNQA 3I9XA 4KYXA 1JKNA 2J8QA 1QVJA 1NQZA 5BS6A 3EEUA 4HVYA 2B0VA 1V8IA 1VC9A 3G0QA 2PNYA 5ANUA 2I8UA 3FFUA 1XSAA 3O52A 4JZVA 1VIQA 4JZUA 1X51A 2DHOA 1MR2A 5ANWA 2KDWA 1KHZA 1PUQA 3A6SA 2YVOA 3E57A 3I7UA 3Q4IA 3X0LA 5ANTA 2R5WA 1RRSA 1JRKA 1GA7A 1K2EA 1PVFA 1MP2A 2GT4A 3MGMA 1V8VA 5DD4A 3X0KA 3MCFA 1MK1A 1OW2A
chains in the Genus database with same CATH superfamily
3QAHA 2FXAA 5KHDA 3TO6A 1U78A 1W5CC 1JUPA 3FXQA 3WTSC 2E34A 2EINH 4XMYA 5BMZA 4XICA 1RKWA 1EH8A 1R4MB 2WC2A 4O6JA 2W1OA 5GPCA 1VQLI 2XDVA 4NB5A 4K6EA 4BHPA 3WGHA 2RGVA 4E7HA 2NVXJ 3K4CA 2IP2A 2FJ1A 2BE5F 2DFFA 5ERIA 3WGGA 3D5SC 1XS9A 1F3YA 2UXNA 1TWGJ 3F21A 2BEOA 4LIUA 2L54A 3S14J 5TRDA 1NQYA 1MKMA 2FKBA 4PJLA 3BTLA 5IP6A 1JT6A 3FK6A 1BL0A 2QYOA 4Z6YA 2LD5A 3QPTA 1ZTRA 1ZYRF 4U7DA 1P6RA 2KZVA 3H5NA 4A3MJ 4UY8I 3LSKA 3X0JA 2DYSH 3LSHA 2CUFA 3LQRA 2KZGA 1FMVA 3SZTA 3LSTA 3QPSA 3NAUA 2VLAA 3T8TA 2B7EA 4BY7J 3GUDA 2DW4A 3V7RA 3GFMA 1T39A 2FQ3A 2DMNA 5DCMA 3W2AA 1PUEE 3BLYA 1RI7A 2M0CA 3FF5A 1SVMA 3EDPA 3KYDB 4EV0A 2R0QC 4ESJA 3G71I 4XRSA 1WJBA 3AG3H 4MIMA 3U53A 2DLLA 3LFUA 2L01A 5HS8A 3ZMSA 3DQVC 1A6QA 2VN2A 4M73A 3QODA 3TMOA 2K5CA 3SDBA 1X4OA 2DODA 2XKOA 2DI3A 3DTEA 3RQ4A 2PJRA 3ASOH 1VCDA 1R4NB 5B3SH 2E19A 4KISA 2QF7A 1ETVA 1BBYA 2TDXA 1KQ9A 3GVAA 2LFBA 3EUHA 2KQRA 2YR2A 3BTCA 3V7SA 2R7WA 2HGCA 4KUMA 1X3UA 3BDDA 5E18F 4BDZA 4A0ZA 4KG3A 2KRCA 3ZR0A 1FP1D 3LFKA 4A2UA 1IUFA 4MNUA 1T56A 3ECHA 3FX3A 5LLQA 2EQRA 3AG2H 4S2XA 1FT9A 4XBFA 4G7ZF 1VQ8I 2O6GE 2VNQA 1U9OA 2TRTA 1MJAA 4MQ9F 1OCTC 2CW0F 1RRJA 1IUYA 1VF9A 4C3HJ 1VC9A 2J5PA 2M87A 4C30A 3KZYA 4JZUA 1QO0D 4F55A 5EEAA 2OU2A 3Q4IA 1HW5A 3S1RJ 2ZJQF 4HYEA 5DTDA 2V7FA 4IJAA 4I0AA 3GTOJ 4KNYA 1RPWA 2CQNA 3E6CC 1V8VA 2E1NA 4IQJA 1B72A 2QUFA 2XAUA 3LSJA 2O5WA 2D1HA 3ELKA 5CQGA 1G3YA 4KITB 1I6XA 3OYHA 4WX9A 4U0WA 5FSIA 2CU7A 5GHOA 2VQLA 1I39A 4HX4A 1YJNI 2A05A 2JSPA 2LY1A 3ZQQA 1TQMA 3MKYB 2RDPA 2R7QA 3S8PA 3I0TA 5FSOA 2K02A 5K7FA 1Q54A 2ICKA 1SEUA 3PL8A 1D1BA 4R8HA 1I5ZA 1OYWA 5GHPA 2EB7A 4A3FJ 1ETKA 3OYIA 5JI6A 1S8NA 2NRAC 1DP7P 4C9YA 1W1WE 3HOZJ 1G2HA 1FEXA 1R58A 3IP4B 3DTIA 4Q47A 2PMHA 1KU9A 2OF7A 2RNGA 3HHJA 3J7YJ 1I1SA 2XKPA 1IRYA 3KP5A 2LP0A 1ETYA 4HF1A 4LITA 1X1AA 2H09A 2ZNYA 3ZMVA 3S1NJ 1TQIA 1J5YA 3JRAA 1SVLA 1I27A 1C0WA 3K4BA 5BOXA 1U5TB 1WQ2A 2L9VA 4PK4A 1Z05A 1YS7A 3FM5A 1P4WA 1PPWA 2GQQA 1D5VA 1T2KA 2VT3A 1KYWA 1MMNA 4M71A 1QA6A 2DT7B 3F13A 1SD6A 4OMZA 1IGNA 3G2BA 3ML6A 1ZG1A 5M5WJ 1OFCX 3NWTA 3L1PA 2O9LA 1YLFA 3BG6A 5JR3A 2JRMA 4KN7X 4BE0A 3L2WA 3EXQA 3HPHA 2F48A 3A0BC 3RJPA 3JRHA 4NBQA 5F1RA 4LK0F 3P9CA 2WB1N 3OS0A 3I7VA 2JJ7A 3VDXA 3HJEA 1U6GA 5LFAA 1YO5C 2F5DA 3T5XA 2H6BA 5K7HA 1U9NA 5EEGA 4BJ6C 3GTGJ 3O2PE 3Q3SA 1TC3C 1IDYA 1B6AA 1M1EB 4FX4A 2Z1DA 4KIFA 2ZMEB 5FLXZ 5FJ8J 2E1MB 1XGNA 2FE3A 4BL0B 1FSHA 4D7NA 4BEHB 1E3OC 4A3KJ 2EZLA 3JCUC 4F93B 3CUQA 1V8YA 1YJWI 2LKXA 2ELHA 4B4CA 3ZCOA 2P5VA 2H1KA 2CMPA 4XONA 1ORKA 2G74A 2OC6A 2Z33A 4EGYA 3DTKA 1R9TJ 4IJXA 3CP2A 1KZHA 3U2RA 1Z6TA 1QHHD 1FLIA 1OR7C 4U0YA 2EA2A 3TP0A 3KP4A 3J7AO 2R7DA 2VBXA 4XQFA 1XCBA 1NK3P 1ETXA 1WJEA 3DV8A 3CQZJ 2WY8Q 4RS8A 4J01A 3F6VA 2KFDA 3HRTA 3R60A 1HA8A 2X4HA 2K3PA 1Z77A 3ZQLA 4D0PA 3OIPA 5BNGA 2GIVA 3RIRA 1U2WA 3S3NA 3A0HC 3F72A 4HOBA 4AC0A 4BS9A 1YHQI 1RESA 2VJ4A 4E70A 1W5TA 4NC8A 1CF7A 1WJCA 3CCJI 2LG4A 1WRJA 1G6NA 5DDGA 2GIZA 3GW2A 2DQLA 2FNAA 1HQCA 4RM3A 2DFEA 2EFNA 3W2VA 1KTGA 3CJQB 3TDUC 3GXOA 5BPDA 2R7FA 3DEEA 4HLYA 3CMEI 1MUTA 1W5SA 3IWFA 5TJJA 2YVPA 2KP6A 3B02A 2E5NA 4EJWA 2O61A 1MBEA 1YE9A 4BQQA 3ZXSA 3VSKA 3VEPA 1F5TA 1ONVA 3JSPA 4JX6A 3MD2A 3BR3A 4D5FA 3CJRB 2PQVA 2YVNA 3I9V2 3KP7A 5F0FA 3R6SA 1F43A 3JW4A 1X58A 1GXPA 1D8JA 4XM3A 3FBIB 4E7IA 5IT3A 2F5FA 4QWQA 3X0PA 3DEUA 1EV7A 2Y75A 4D5CA 1JKQC 3B73A 4XRFA 4NQWA 2Q9PA 5EG0A 5FKNA 2Y48A 3OYCA 2O3FA 3H5RA 2DA1A 2XAJA 2XUBA 2X0LA 4JBAA 1VHZA 5DM7F 2A8TA 1I50J 2LF7A 2MC4A 4UUTA 2A8SA 4N1TA 1KU3A 3KFWX 3S2WA 4G6TB 3OOUA 5HNFA 3HOYJ 2K9QA 4GO1A 2QA4I 1RYAA 1IN8A 2DMPA 5IOYA 1XGOA 1BA5A 1ZG5A 3OYAA 2LYCA 1YRNB 3K4KA 3HSEA 1SVOA 4V2FA 5C44J 4UUVA 3E5XA 3GRNA 3TBIA 2QQ9A 3ZMTA 5FRNA 4DZJA 3TEDA 3MDIA 4M6XA 1ZRFA 4BDYA 4LB5A 1SFXA 1TWAJ 4KJZA 3RKQA 2BW3A 4CZCA 3UNGC 2EPFA 3WGIA 3OL4A 4ZZDA 3JRIA 2GOMA 2J8QA 2P6SA 2Z99A 3Q5FA 4YFNF 5EYRA 2JVGA 2W7NA 2PNYA 1VQNI 2ZSIB 1UELB 2BV6A 1IDZA 2BY0A 2Q2EA 1XSAA 2JT1A 1JTYA 1Y56A 2ZXHA 1WI3A 2V1UA 2WB1A 4FCYA 4I99C 3FMRA 1K78A 2GXAA 4E7KA 3PO2J 1VQ4I 4ZYAA 5BPIA 1PPVA 3O8HA 1SFOJ 3BPXA 2KKOA 3Q91A 1J09A 4WXCA 3MDGA 4BJ5C 5ICFA 3VYRB 1R5ID 4AVPA 4HSRA 2VJIA 3K2ZA 1O3RA 1TP4A 4BJTA 1SJYA 1XPXA 3X0MA 4IHVA 2IJLA 4AIDA 1S7OA 3LA2A 1H89C 3KEYA 1FP2A 4RM2A 3N05A 3WG7H 4ILQA 5M5YJ 1RUOA 4HRIA 2VASA 2DPUA 2VE9A 5HOOA 2D2WA 2KDOA 4BACA 2AXTC 1XG1A 3TOAA 2LY9A 3LOCA 5E3LA 5EGOA 1HBXG 3S1QJ 1UJ8A 3BG9A 1YW8A 3KP2A 5LHGA 4NFWA 3QP6A 3FXOA 5JFRA 4QLCU 4TV7A 4YPRA 4HQMA 2KLOA 4L0YB 3OS1A 1YX5A 1V8WA 4NUBA 2L9NA 4IZZA 1V8TA 3P7NA 3HOTA 2KPMA 3EF5A 2FF4A 1GVDA 1W36C 2IGNA 1BW6A 2O8KA 3IRQA 2OJED 1A04A 3O69A 3I55I 1WJFA 4U0VA 3PUBA 3M9AA 4CCLA 2NYXA 3LSRA 1B8IA 3G73A 2VT2A 1E3PA 4RLFA 1FOKA 1ACIA 5CVRA 1LVKA 2A6EF 1MQWA 3KZZA 2P5KA 3O6BB 1ZLJA 2KIMA 4PGGA 4B47A 4E4HA 1QZZA 3FXJA 4KMUX 2IXSA 4HNUA 4IF4A 2ZB9A 2HVRA 4MQVA 3A01A 3MKWB 1NFSA 3X0OA 4KYWA 4BBRJ 3JAMZ 4YIRX 1V8RA 2MG4A 1Q33A 5D5WB 5FSNA 3RKXA 1TWCJ 2NVTJ 3NWSA 1ZELA 1K4TA 4HW0A 1PPXA 3NQOA 1YX3A 2K40A 1SD4A 3FDYA 4LLLA 1BOAA 5HZXA 4IL6C 5K7ZA 4QTRA 2VODA 2CO5A 1EJ9A 4ZC3A 1P4XA 2R3SA 4A3GJ 1LEBA 1RUNA 2HFHA 3IL2A 2LBFB 1XX5A 4DNCA 3ZPLA 2OD5A 4KFCA 5ANUA 1FZPB 2I8UA 1EKEA 2B0LA 2EH3A 4UUSA 4EJTA 2JUGA 1N75A 2IA0A 2JA2A 4Q4ZF 2L2OA 2JMWA 3I3LA 3PSIA 1JRKA 1MMDA 2MC3A 4LLGF 3ABMH 2DFHA 3Q9VA 3X0KA 4C9WA 2CV2A 4YFXF 1G3TA 3EUAA 3JRFA 1BIBA 3OYLA 3P5TA 2QWWA 1KA8A 1W7PB 2AQEA 3CZ6A 1J75A 1JJ6C 2X85A 3M8EA 2ISZA 4RAFA 2OTLI 1ERDA 2STWA 4GCVA 2LVSA 1SZ3A 1UHMA 1R1UA 1FY7A 2QQBA 5K5OA 1IN7A 1TZLA 1MMSA 2RVCA 2XF7A 3I5UA 4HLXA 4CCMA 2GM4A 1Z6RA 2M5WA 2HXOA 1XDUA 3CCMI 1EA3A 3EUHC 3J80Z 5I8UA 1LFBA 1GV5A 3G6EI 2W84A 1S7AA 1Z7UA 2ZSHB 4UB8C 5ANSA 2VPRA 2W4SA 5GAHJ 1LE8B 3BR1A 1BN5A 2OZ6A 2HPMA 2FQ4A 1AKHB 1KONA 1XGSA 3DP7A 1ETOA 5J47A 2DA2A 3PM1A 3MZYA 3FISA 1ZQ3P 2EV0A 4OAYA 1B9MA 3FXMA 1D3YA 3MKZA 1X3WB 5D8LB 2IRFG 5CVJA 3SMDA 3QU3A 3PNTA 5JVTA 5GAEJ 2DJNA 2W48A 3TQNA 1BJZA 1BI3A 2V79A 2HDWA 1IRXA 5B1BH 4I02A 1V8MA 3J7Ye 3PFIA 2ZC2A 4GYIA 2P7CB 5LGTA 1D1AA 1QZEA 4UV8A 1FIAA 1I9AA 4S2YA 3LSGA 4HF0A 1ZREA 1F36A 1OKRA 2CW8A 2DU9A 2MD0A 1G9QA 3I71A 2WADA 3ASNH 4ENJA 5E20A 1HOMA 1R7JA 2DAOA 2R7UA 4AIHA 3X0QA 3WE2A 2W00A 1N77A 4HX8A 1X1CA 4AUXA 4Y15A 3JSOA 3NRVA 2CUJA 2EJRA 3KEOA 3HOVJ 3HRUA 1ZAOA 3BG3A 4BGDA 2VONA 2DOEA 2OCCH 3LSMA 3HRSA 3SXYA 2CV0A 4ZDOA 2FRHA 4L9JA 2QSHX 4RAYA 1UG2A 4B3XA 4IRGA 1K83J 3SEQA 5F0HA 2QCOA 1UAAA 1QVJA 1IN5A 2HXIA 5DYMA 3IH2A 2HTSA 3H36A 4HVYA 4A12A 3KYCB 1Y39A 2DT5A 1APLC 4BQAA 5IP9J 4K2EA 4L9TA 3C7JA 3DLAA 1T0FA 1ZHFA 3G4SI 1PVFA 3V42A 3E5QA 3W6KB 4AIKA 2VPLA 1MP2A 2VJJA 4PSXA 3I59A 3PNYA 4BU2A 5HS9A 3F3XA 3N77A 1RC9A 3GTMJ 3W6JB 1VTNC 2V6EA 1IRFA 4M3GA 3DKYA 3I54A 2TCTA 1PUNA 4QPOA 3DLLF 1WWXA 3CCLI 1PUFA 4ZZLA 2ICJA 3IUOA 2GAUA 1V55H 4A3EJ 2QQAA 4ZDPA 1FJLA 1FTZA 2BXYA 2EIKH 2OV7A 5E17F 2R5ZB 1REPC 4PJJA 4V19K 2ZBKA 3CDLA 4KT5C 3TDZC 5BONA 2K4JA 5GAGJ 1MZBA 3HZJA 5LEJA 2RQQA 4LD5A 3I4NJ 2GT2A 3CUQC 1RR7A 2VNPA 4OWRB 3GCMA 4UNOA 2X1EA 1X2MA 3COUA 1Y1WJ 5GPAA 2IW5A 5L3FA 2KT0A 1T33A 2R5YA 3DFGA 3IH4A 3L2CA 2LH9A 1OCCH 1ZH5A 2AO9A 3Q2SA 1SFEA 1PYVA 1QQIA 2UUZA 2XPUA 5L3EA 3HGYA 2V6CA 3K1MA 1IW7F 3O8GA 2L02A 2LLKA 1AOYA 3PUFA 1STZA 4FISA 3HOWJ 4EMSA 4HV6A 3GZ8A 1Z91A 5KCMA 1VQMI 1MNDA 2BVMA 2Y0SN 2HTJA 3HB9A 2LC2A 3JTGA 4M9SA 3VYTB 2DSCA 3TO9A 4I2OA 3W6VA 2C6YA 2EV5A 3CLOA 4EJUA 3CDIA 4V14A 3OYGA 3FXLA 4LIVA 3OOPA 5DUIA 2JSCA 4I01A 3QSJA 2ZXJA 2EILH 3E5UA 3ZGKA 5DPKA 4HNVA 3ACAA 4ESBA 4XNFA 4MPOA 4GFBA 3O3KA 4OU0A 4UVCA 5FFZA 2L3DA 2E35A 1D0ZA 4JZTA 1N25A 2W85A 3PJRA 1P7JA 2V1XA 4FHTA 2K7LA 5KVRA 4J7HA 2QM3A 1NQZA 4L9NA 5EDNA 4AIJA 2B0VA 2WAQN 3FIWA 1V8IA 4IVNA 4BAYA 4ZYEA 2HQ5A 4M9XA 4YELA 1MNEA 5ANWA 2KDWA 4CCKA 2JWTA 2YVOA 3S15J 2ZKZA 4JP0A 5TGTA 4Y17A 1SAXA 2R5WA 3C3WA 3BC8A 2OZUA 4LMYA 3E7LA 3E6MA 2V4JC 3CCEI 3PSFA 5LRSA 3AAFA 5IYDJ 1UZCA 4P9FA 4C2MJ 5FRMA 3Q93A 2I5UA 2FBHA 3WTXC 3IKTA 1GXQA 4F52A 1WH7A 1O3TA 1SU2A 3H0GJ 3H3UA 1W7PD 2PJRB 2G7HA 3SEZA 3FM3A 5E1XA 3P9KA 1Z67A 2STTA 1X83A 3DKUA 1Y8QB 2G9WA 1HW2A 3F8FA 2P6TA 5CLSA 4MGRA 2L9SA 1JHFA 4PSWA 4A69C 5E8GA 2YX4A 3OYBA 3ZQCA 3DKXA 2DPDA 2DA6A 3WU0A 2AXLA 4AD9A 3REOA 5FLMJ 2RAEA 5E1WA 3RYPA 2I8TA 1S6LA 3CUOA 1FPQA 4KN4X 5C7TA 3CTAA 4XIDA 4LGWA 4DYQA 2M4KA 1DPUA 2YUSA 3N9UA 1FBSA 1DDNA 2DOAA 1KU7A 4MLOA 2V1NA 2LREA 5IW4A 2FA5A 3U9GA 3RYRA 3RPQA 1Z21A 1TUMA 1HX3A 1O3SA 5ICEA 1ZN2A 2E71A 5D5UB 3ABTA 2L4MA 1V8LA 3G1OA 3K10A 5J3LA 1B72B 3DPTA 1B59A 1GVJA 2K9MA 2P8TA 2BGCA 3C2GA 3F8CA 2IAIA 2NS0A 3F6OA 3P6YA 2M3AA 4LG3A 3T8RA 4EM2A 3TP3A 1B9NA 3SJMA 2GA1A 3ISPA 3AC9A 2FVVA 4ABZA 3RH7A 3BR0A 3IV5A 3ERMA 2NVYJ 2OA4A 1DGWY 2QENA 3L2UA 1SOIA 1WZ2A 3RSNA 5JHUA 1R00A 3TGNA 3NARA 4II3A 4MEXF 4Q48A 2GLOA 2ID3A 3BM4A 5E8IA 2PEXA 2DO7A 1DQUA 2IEKA 4A0YA 2HOSA 1BR4A 1S7EA 3OMYA 4M6YA 4CH7A 3BR5A 3GTJJ 1FYMA 3CDHA 1YJ9I 1LNWA 4G6QA 2VI6A 4RGUA 4GXOA 3ERED 3TW6A 2D45A 1LDKB 1GT0C 2RREA 5B66C 3F0CA 4A5NA 3MWMA 4G7OF 3K6GA 3GTKJ 4E7ZA 3COAC 5GTHC 3AL0C 3CF5F 1AU7A 2XASA 5IOZA 4CYCA 3LAPA 2Y0SA 4WF2A 2ETHA 3RI4A 3UR3C 4DGWB 4DIQA 4QIWN 1MW7A 1R22A 1HXDA 3E3VA 3L2RA 1H0MA 2M34A 3ZQGA 2DK5A 4B09A 2Q0OA 3EETA 4PUSA 2L9RA 1MK1A 4ZTFA 2X1DA 3WTYC 4RGXA 3F22A 1U8RA 3ZQ7A 4W1UA 3GFIA 5CFJA 2RQPA 2A8RA 1VQ9I 4YG2F 2BY2A 4DW6A 3C1DA 2V26A 2FUG2 2NXNB 3D0SA 5DCFA 5FKMA 2DXIA 2DUKA 1D0XA 2UV1A 4P5OA 3HPGA 1MSEC 4U88A 4A0XA 4EJVA 4ZYHA 2VQHA 2WWYA 3F8MA 5DV5A 4B43A 4CXFA 3GTQJ 4E6KG 1K6OA 1FNNA 2NVUB 4FTHA 5DS9A 2DA3A 3LMMA 1Z0XA 2Y30A 2W4EA 1SMTA 3SHDA 2E7WA 2WAQA 5D6FA 4BUPA 2IBDA 1WJ5A 3FXKA 3WTUC 3BTIA 3DBLB 1FOXA 1I6HJ 4GRIA 2PBIA 4S2VA 4BYYA 2E1CA 2LDUA 1ODDA 3BCAA 3K4MA 1W36D 1BI0A 1BR1A 5IYBJ 3HSFA 3CC4I 1PUSA 2Z5UA 3BT9A 1UMQA 2FEZA 3PQKA 1T95A 2XF6A 3LA3A 4GGGA 4M3DA 3IAS2 4WXHA 4Y33A 1G4DA 2XGDA 1LDJA 3JRDA 3ZR1A 2NS8A 3X0NA 4I09A 3QQAA 4MTEA 2PJPA 2IS6A 4IEJA 1UCRA 4F7ZA 1JE8A 5F0CA 1GV2A 2M1BA 2M4GA 2VBZA 5LHHA 1MBKA 5J1UA 3V8KA 2IVMA 4ITVA 2ME6A 3WHBA 1CF7B 1XMXA 2FBKA 4II2A 3MFKA 2H94A 2EFPA 2QEXI 1G3SA 3V4GA 3ZRGA 1PP7U 4BXFA 2JQ7A 4XLAA 3KLOA 1LEAA 2X9DA 2VKHA 5EZHA 1LDDA 4IX7A 4KT6A 4XSZF 4A6DA 3WHCA 5A2QK 3TKYA 1JKRC 3TW7A 3N4MA 5J1RA 4CCNA 4PGHA 5L3CA 3B6CA 5L3BA 5E3MA 3LA7A 1SAUA 2DFIA 5C7QA 3MQ0A 5F04A 4M74A 4J7GA 1FBQA 3C2HA 1HKSA 3LSIA 2R7ZJ 2BOLA 1YG2A 1GDTA 4AYBN 5BS6A 2DBBA 3Q0VA 4L18B 2V9KA 1JUMA 1HKTA 3DPUA 2QBYA 4A93J 4E7LA 4QPQA 1TBXA 4DYRA 5CVVA 3KZIC 1H9TA 4IHWA 2LKSA 4NQWB 1TQPA 1BI1A 3RZOJ 3DF8A 1IC8A 1A31A 4ENNA 2GT4A 4EJOA 3MGMA 2EBIA 1ZR2A 1DU0A 5H6RA 3BROA 2KDVA 2F4MB 4S0HB 3K9TA 3MZ8A 1CQTA 2K85A 3RDIA 1DP3A 3WHWA 2HR3A 3BR2A 1LVAA 2Y0MA 4HV5A 3U21A 1HW1A 2JA6J 2F5VA 4KMFA 1FBUA 3NEUA 1J2XA 3IWZA 4WK8F 3IH3A 3BZ6A 5KNLA 1BIAA 2LKPA 2H1LA 3MKLA 4UB6C 2JTVA 3JTHA 4DQ2A 4RAGA 2CV1A 2MBFA 3HGGA 4XLCA 4ETSA 5KAIC 3PO3J 1WGXA 3ESWB 4I98B 4HDVA 3BQYA 3OR1C 5HVQC 2BW3B 2JA7J 1MH3A 3CF2A 2H8WA 3U1KA 2Y9YA 3RKWA 2IT0A 2KIUA 2O7OA 2WAEA 2IS1A 1SANA 3RPUA 3J81K 3N97A 3BG7A 5DM6F 5HDNA 1Q27A 1FIPA 2L7MP 3I58A 2B06A 4EM0B 1RETA 2Q2EB 1SD5A 2FBIA 2KL4A 2QQ8A 2RN7A 2ISYA 5KAFC 1K78B 3MCZA 2NOJB 3VYUB 3OL3A 1HCRA 2ZFWA 4OINF 5IPAA 3BJOA 1N78A 1HZTA 2IPQX 3M07A 3DU6A 1HF0A 3PIOF 2XIGA 5IT9K 1T0FC 3M7GA 2BY1A 5FROA 3V8JA 4XLPF 3OIOA 2EZHA 4MO7A 2JK3A 3OYNA 1EF4A 2YS9A 4P55A 3EESA 3BHOA 4ZJZA 3FSPA 2YSRA 3ZMDA 2EFWA 1ITYA 2DSDA 2PMZN 5LD2C 5BQTA 2H8RA 1LB2A 4KIGA 2KJCA 4LB6B 4GDFA 2JA8J 3M1CA 4UHTA 2EIMH 1TL8A 5LBQA 3GBGA 1TT0A 2DQRA 5EGOB 1O57A 2CWEA 4DYWA 3SYTA 3ZR8X 1DUXC 1A5JA 4DOZA 2ZXWH 5JVGF 2N8GA 3CCYA 3MVPA 3OR2C 3AL0B 2EZKA 3ZMUA 2LNBA 3HUGA 3GYHX 4IOCF 1Y0NA 5CVUA 4YFKF 4CYDA 2HYFA 3FFUA 2YU9J 4JZVA 5FKOA 4A3CJ 2DHOA 4BXXJ 4P9UA 4PJNA 3E57A 1Q1HA 2NVQJ 5HDKA 3HL2A 2WTEA 1B8IB 2EZIA 3IHUA 5FB2A 2Y31A 1IXRC 2ACJA 4UXNA 1CGPA 1HC8A 2ZJRF 1VC8A 2K27A 5GTIC 2A68F 1Y0UA 2VXDA 2DA5A 2DMUA 2HPIA 2CZRA 3A2KA 4JX5A 4HFQA 3DU5A 4A3BJ 2O03A 2JN6A 1SMYF 3HKZN 4LG0A 1F1ZA 1LFUP 1P4AA 1WFXA 2HQRA 2JVHA 3QP5A 2H27A 3BG5A 3A01B 1E0EA 3H9GA 2XF5A 2CL3A 3HTUA 5EEHA 1OPCA 4JYKA 1HSJA 1T38A 1YI2I 4AYBA 4WWCA 1G3WA 3QWLA 3K4LA 3S32A 1ON1A 2J5OA 3BPVA 4A3DJ 1VZ0A 5HLIA 3GX4X 3HYQA 2L7FP 2ESHA 4NC7A 3SFIA 5LEKA 1O4XA 2R7SA 1LUJB 2HQNA 5L3GA 2X6YA 1IN6A 2XSDC 2WV0A 3MAJA 2ZXIA 3CO7C 5HLHA 3FJYA 4LJZF 3R03A 2HS5A 3F8BA 5CJ9A 1A6IA 4G94A 4UUSB 3VOEA 3RZDJ 2HVSA 4M3BA 4PJMA 5LPGA 2HZDA 2BZTA 2JZYA 4L9VA 2PX9A 5KK1A 5ANVA 5CFIA 3W3CA 1YIOA 1P2FA 2BHYA 2E2HJ 1MDMA 2VKVA 1XDSA 3M8JA 3CJTB 2X51A 2ZFUA 3DBHB 1E3HA 4XLHA 1O3QA 5M3FJ 1WVRA 3CJNA 1YTYA 4BXUA 1K61A 3VSLA 3FKJA 3GLXA 2CFOA 1R6RA 3RKYA 2B2KA 1RKTA 2A5YB 3KIOA 1HLVA 4YEJA 2RRKA 2A8QA 2JA5J 4N4OB 5GHJA 2VKEA 4DYCA 1ZLKA 2CG4A 4ENKA 5ILVA 3OYMA 3W2WA 5M3MJ 2Y2ZA 1V8UA 1XN7A 2H6CA 1E17A 4D1QA 3DPLC 2M2EA 2HOAA 4J19A 4Y13A 1NFZA 2YYHA 2V1DA 2LMDA 3OYDA 3M1EA 1ZK8A 3OSFA 3S2DJ 1IRGA 2LOOA 4KYXA 4XKVA 2KIFA 3CCUI 2IS4A 3F9KA 4M6VA 5IYCJ 4C2UA 2HDCA 1OCZH 6PAXA 1NTCA 5E3NA 5J8CA 1V3FA 2Y69H 3K70D 5GADJ 1MR2A 1S3JA 5C3EJ 1S9HA 1FOWA 2NAZA 3CMMA 1QRYA 1OYIA 3HHGA 2ZO4A 2AS5F 4DZPA 2PMZA 2CUEA 3GWZA 3FMSA 1USSA 1G0SA 2HOTA 1XSVA 1QPMA 2PQ8A 2NS7A 2FD5A 2GBYA 3QOEA 2DN0A 5J1YA 2VC1A 4EGZA 4IRIA 2AZWA 2G73A 5D5XB 4C9XA 1NH3A 1GHCA 4C3IJ 5FKLA 3WE3A 4M72A 1H8AC 1AHDP 4A3LJ 3GWYA 4EVIA 2MW8A 1S72I 1U0JA 3FMQA 1MNMC 5JLWA 1R23A 3JRCA 2PMUA 1T08B 1B1BA 2OPTA 4F91B 3AFHA 5ED4A 1KQ0A 4PCQA 1X3ZB 3HOUJ 4IXAA 3JR9A 2BXZA 5DUKA 4L5JA 2EA4A 1DGRM 4CSWA 2XPWA 5AIPA 4XLNF 1Z3YA 4XRMA 1VQPI 2LSOA 3H92A 4RDUA 1IAWA 3O6ZA 1ZKGA 1R5HA 1QPIA 2PI0A 3K0LA 5TISC 4KG4A 4LK1F 3V7CA 4CA0A 1TW3A 2D1VA 5D4SA 2PLYA 2EFOA 3KP3A 1EH7A 1OCOH 3LAJA 1X19A 1WCMJ 3ZQHA 1HKQA 4AU7A 2KIQA 1IXCA 3VFZA 2B9SA 2BBYA 3MEXA 2CFXA 4EEFG 4Q5SF 2AHQA 1BW5A 2X6OA 3FHZA 2VBWA 5HLTA 9ANTA 2HI3A 5C8LA 4G12A 1RRQA 1R1VA 1PUFB 3BOQA 1LKXA 4RB1A 1QU3A 3DWLE 3OWTA 1IN4A 1P9QC 3FHNA 4A3JJ 1WHUA 4OOIA 1SFUA 1P92A 2COBA 3C2BA 3DKWA 4M3FA 3GG6A 4IHXA 1OLTA 5CYVA 2DDBA 3H9QA 1J59A 1XMAA 2XAQA 2OBPA 4HF2A 3M3YJ 1IRZA 5ILUA 1VK6A 3RQIA 4EQQA 3M8FA 3SONA 1WI9A 5FLXK 1XB4A 4ZTJA 3K2AA 1W0TA 1BC7C 1JKNA 4GYGA 2R5YB 1O7FA 4BH9A 1J9IA 3CC7I 2WV1A 4XKBA 4CUGA 4BQOA 3L2QA 1VFCA 4DBQA 2NOGA 3WTZA 1D0YA 2M8EA 2QZ8A 3A6SA 2LF8A 1Z1DA 3X0LA 4IKFA 2K9LA 2W82A 4PZJA 1K2EA 4IHYA 1BC8C 3AG4H 4HQEA 2K4BA 1KQ8A 5EJCA 1JKOC 2Q1ZB 4MFEA 3X0SA 5C4JJ 3CESA 2VE8A 1MGTA 4PFPA 3GZNB 3CMYA 1T98A 2R93J 4RB3C 2F4IA 1R36A 3DCFA 1QNTA 3BJAA 4S04A 5D8KB 1MSFC 3HDDA 3DUPA 4G9YA 2XB5A 2KRFA 2XGXA 4WCGA 4CGZA 1A35A 2ZNZA 1ETQA 1NHAA 2WY7Q 1XSBA 3ONQA 2VQGA 2Q8KA 2V9VA 5DCMB 5EZGA 1H88C 2CQ7A 3X2QH 2LRDA 5F27A 4BY1J 3I4MJ 3G1LA 2F5CA 3BZCA 2IGMA 3KYLA 1OJLA 1YS6A 4RLQA 1VQ6I 2QKMB 4EM1A 3S17J 4OIRF 3K70C 2X6WA 3SQNA 1R67A 2LY2A 2OCEA 2MH2A 3CCRI 2ZJ2A 4P1WA 1TWHJ 2HYJA 2MLGA 5E1ZB 3KX2A 5EF6A 4U7BA 2GOXB 2HKOA 3QOPA 1PDNC 3EYIA 2D5VA 2QJTA 2F4OB 1V4RA 3RTRA 4EATA 5FD6A 3HEFA 3IKVA 1LPQA 4NDLA 4BHCA 3VWBA 1V54H 2X48A 2I6KA 3F6AA 1XSXA 3H35A 5FSLA 2QVOA 3L85A 3DBRB 2XGCA 2DA7A 3L9FA 2FMYA 2M7BA 1JTXA 1A36A 3OYEA 2VB6A 4XKWA 5CVIA 5B1AH 3QU6A 3CCSI 1JUSA 3I53A 1XSCA 1YYVA 3BAPA 1U3EM 3DEWA 1TWFJ 2OQRA 3LQQA 4RGSA 1UHWA 4ZG0A 2OQGA 2NNNA 1IV6A 2P7VB 1XMKA 2COMA 4B44A 4JZSA 1LFPA 1ZGWA 2VQCA 1BJAA 5ICCA 3LNQA 4Z2YA 2O5RA 1XD7A 1TTYA 1VNDA 1H9GA 2ADUA 5J4VA 2DT6A 1GUUA 3AG1H 1I3QJ 5JLXA 3P5JA 2UWMA 2KJBA 4OMYA 2V9PA 4CZZA 2IGOA 5E3OA 1K7AA 3SHFA 3F8NA 3KEQA 4IHTA 1YQAA 2R7XA 1WJAA 4FETA 1X1DA 3T1BA 2HWVA 3EEUA 2ESNA 4PDKA 2E36A 5L3DA 4D9JA 1SFKA 3OV8A 5J4YA 2ECBA 1U5TA 4RGRA 4O3MA 1JJ8C 3H3ZA 1YOVB 1R49A 3I7UA 4A3IJ 1T8IA 2FOKA 2LR8A 4HAMA 3A4CA 4IOAF 1GA7A 1FSEA 4CCOA 1JGSA 2KMUA 4CHUA 4HX7A 2BYVE 3K4NA 5F6FA 1OW2A 1OYYA 4KTBA 4XOPA 5M5XJ 2CH0A 1UG0A 4FT8A 1IF1A 2VUMJ 5IW5A 3HXLA 5DEQA 3ZN1A 1MQEA 3ID9A 1L0OC 2YPRA 3GFLA 4NC6A 2O5FA 3I4PA 3LWFA 1BOBA 1X84A 2VKDA 3D1NI 2EFQA 3BY6A 3K7AJ 4CICA 3A6VA 2O8XA 1KU2A 3A6TA 4YOQA 2YVMA 3ZQFA 1R5GA 1V5EA 3L00A 2ZMEA 4OIOF 3O61A 1DU6A 5C4XJ 4BEHA 3O8SA 4RMNA 2P4WA 1QHGA 5J8FA 3ULQB 2OAZA 3TL4X 3R61A 2DA4A 3OGAA 3SZGA 5K5QA 1YITI 3X0RA 4MHGA 3HSRA 1JT0A 2PFBA 4M9ZA 2HZTA 4HPQA 1ZG3A 4Y3OA 4CYCB 5D6EA 1ZR4A 4RB0A 3WODF 4NFXA 1RR8C 5LGUA 1X2NA 2MABA 3M4OJ 1SC7A 2DCEA 4FE4A 4FE7A 4NHJA 2XVCA 3CUQB 2QJOA 5LRRA 4HEA2 1ENHA 4F92B 2L5QA 2L7ZA 1TT5B 3FCMA 3U1DA 4RBOA 2A6TA 2VBYA 1Q1VA 4ON0A 1BR2A 1UB9A 2EK5A 4YPHA 1TLHB 4FASD 1V8SA 1I3AA 1NG7A 1IO2A 2HOEA 3WTVC 1QZYA 1TW2A 3K1NA 3KPHA 1E2XA 1POGA 2A3SA 2E7XA 3V8LA 1XSDA 1FX7A 1HSTA 1U20A 1K6YA 5GHQA 2OUMA 2GB5A 3D5RC 4LOCA 1RNLA 1V5GA 1X1PA 2R7VA 2RKHA 5D4RA 3CCQI 2VOOA 2A61A 3T0YA 4D7MA 1F9NA 4G8XA 1V5FA 3H5AA 1IJWC 1ULYA 3BR6A 2AQFA 3FXUA 4XOTA 1XCVA 1HDPA 2PG4A 2W25A 3A6UA 2M30A 3EYYA 2ID6A 4N4NB 3ZP5A 4G7HF 5IY5H 2Z2SB 3JAMK 2UXXA 1FOYA 1G8XA 1HDDC 3JREA 3FXRA 4LFUA 4A6EA 2XSJC 3CCVI 3O52A 1S5LC 2G7UA 1MJBA 3SFZA 3CC2I 2CGPA 1USTA 2BHZA 1W0UA 3BJ6A 2Z9OA 5F64A 3ZQIA 5HLGA 5ANTA 3L7WA 3BCBA 1QVTA 3A1YA 1ZGAA 2XAFA 2F5EA 3R0AA 1D8KA 2HYGD 4DJAA 3FBNB 4ZYDA 1MH4A 3D5LA 2VOPA 2QGUA 2XROA 1PP8F 4L5IA 4O5VA 1VRLA 2DTRA 1XC5A 3A03A 4N0BA 3OYJA 2FU4A 4KIBA 4YIFA 4YRVA 3E6DA 5CKTA 1YRNA 2FNPA 3H9JA 1VQKI 1BI2A 4HBLA 1ETWA 3PQJA 4MEYF 2X6XA 2M0MA 2GZWA 3QYBA 2F6CA 2WAFA 5HS7A 2GA2A 1ZRCA 5GHIA 5EG0B 2HEOA 1AA7A 4I76A 1K79A 2DTZA 4FX0A 1VQ7I 1QGPA 4W97A 1IV8A 4ICKA 2ME0A 3Q2TA 1I1GA 2WA0A 3BQZA 3K1PA 2E1OA 4B8XA 2HDDA 3IAM2 1J7KA 1JHHA 2KRHA 3J80K 2QBYB 3GTLJ 3S16J 1MMGA 5FD5A 2GWRA 1U8BA 5H2FC 5CQEA 2DMQA 1FYLA 4HG2A 2R7OA 2ELKA 3MN2A 5D5VB 1YFHA 2P5LC 2B63J 3KETA 1ZARA 4XR6A 3GTPJ 2MSYA 3A02A 3WU2C 2MD5A 2LK2A 1O7LA 3EQLF 2HVQA 3S3OA 5B5EC 5AONA 4HZFA 3FKIJ 2E2JJ 3QYFA 4RAZA 3HC7A 5GHNA 1JXSA 1SD7A 3HOXJ 2MA3A 3R4KA 2PN6A 2DK8A 3BZKA 4Y4RA 5ILSA 4IRHA 3CLQA 3QPHA 1QBJA 4XSXF 5FKKA 1ZGJA 3C18A 3ZOBA 2XAGA 2XPVA 1VIUA 3FK7A 3H95A 3HRMA 4OAZA 2Z3YA 4KDPA 2K9NA 1LQ1A 4XN3A 3PFYA 2JVBA 1IZ1A 4X1EA 4S05A 4BE1A 1OMIA 5HNHA 3G0QA 2BY3A 1Y6IA 5H20A 1OQYA 2XRLA 1VIQA 2RNJA 3Q0WA 2R7RA 3CO6C 1KHZA 3OYKA 3JRGA 2GXBA 3KCCA 4PJ0C 3ROUA 3J7ZI 4UVBA 5DD4A 2MH9A 3CMAI 2DYRH 1T6SA 4FQGA 5HDGA 1L3LA 1KT9A 5GHMA 3I64A 4ASNA 2DJIA 1YW7A 1LJ9A 2BVLA 3DXJF 3HYIA 4IQ4A 4HDUA 4JOMA 2IA1A 3LL7A 5E79C 4X0GA 3ABLH 3QRFF 1MBJA 4R79A 1MJ9A 3PIPF 4OIQF 5ISYA 4WXDA 2HKXA 2L4AA 4I6ZA 2W24A 3QYEA 4QSHA 5FO5A 2YU3A 1YIJI 3CP8A 2CQKA 1WJDA 1X4PA 2I8DA 3ECOA 5CPRB 1JKPC 4MFDA 1K26A 4B48A 1NG6A 2CQQA 1Z7LA 1OR7A 2EV6A 2HU9A 3GZ6A 2R7TA 4C3JJ 3HUGB 1OISA 3WU1B 1FMWA 4UV9A 3ABKH 3X0IA 3OY9A 4AVZA 2JPCA 1KGSA 2LBFA 4XK4A 2MLKA 2O0YA 4BKXA 3E0JB 1RZ4A 3Q1PA 3HM5A 3BWGA 3Q9SA 2ECCA 2G0EA 4H0EA 2VIXA 1D1CA 4S2WA 1MBHA 3KE2A 3E6BA 2NNYA 2XRNA 2WBMA 1OCPA 3CNGA 3KVHA 4XRSG 2M45A 3HIFA 1FC3A 2VJ5A 4L5EA 4JK1X 1ON2A 5K5RA 2ICWG 3L2VA 2A8PA 2VL8A 3FK9A 3HHHA 5A2QZ 4XKCA 1KYZA 3IRRA 3H3VK 4LG0B 1R71A 1W7PA 3JRBA 2E5ZA 3PNVA 1IXSB 2QSFX 3IC7A 4OIPF 4BE2A 1PJRA 4RB2C 1V8NA 4XLEA 2UZKA 3MZHA 2IS2A 5JHFA 4KA4A 4XLFA 5DD8A 1JI8A 2XHKA 3SZPA 2FOWA 3Q0UA 2CRGA 4MTDA 1W4MA 3OYFA 3ZN0A 2KISA 1AWCA 2A5WA 4G6DA 1P7IA 2MYSA 3HBLA 1LE8A 2JUCA 1FTTA 1VI0A 4HA8A 3I9XA 2ZCWA 3I56I 4B3AA 1AKHA 1EH6A 1TNTA 1FYKA 1MBFA 3G3ZA 4XORA 2KHMA 1WSUA 2FX0A 4XL9A 4R1HA 1FWZA 2EWNA 2IA2A 3QPLA 5HODA 1WH5A 3UKGA 1X51A 3WTTC 1Z3XA 2QSGX 3K4JA 4I7HA 4PFOA 1PUQA 2HNHA 3MMYB 2E2IJ 1S29A 1RRSA 2CUZA 1Y8RB 1MIJA 2RC4A 4U87A 1WPKA 5H6QA 3CD6I 1ZRDA 3MCFA 2DMTA 1MDMB 4I0BA 2EIJH 4LLNA 3E97A 2CJJA 4V2GA 2CQXA 2DSBA 3F23A 1Y1VJ 4ZDLA 3K69A 2XGEA 4E7SA 1UFMA 4BNCA 2I10A 1DPRA 1IG7A 4HNTA 5F08A 2CS3A 2KDZA 1VQOI 4CCJA 1XTAA 3P9IA 1G59A 4P96A 4B1RA 4N1UA 4BBSJ 3OIQA 2M7AA 2XB0X 2DOFA 2K86A 3EPZA 4BQNA 2JPBA 4ANJA 4CDGA 1VHGA 3OSGA 4ENMA 2HQAA 1X1BA 3J81Z 3FZVA 3WTWC 4ZH4F 2R4GA 3S1MJ 4XN0A 1UHSA 3VPRA 5J6XA 1PVEA 4KICA 2K3FA 2Y9ZA 5J40A 4CO8A 4ESFA 2FMLA 2Z16A 1K4SA 3EUKL 2K9SA 1RIOH 1J0RA 1F4KA 3VB2A 4YIIA 2M8GX 1NK2P 5AIQA 3HOSA 2GXGA 3ABUA 1MBGA 3GZ5A 4BHBA 3S93A 3G1MA 2VXZA 2MGQA 3J7AY 5IT9Z 2YX7A 4NNJA 5FGMA 3WG9A 1MD0A 2IGKA 4IPAA 1XGMA 3TO7A 3GO5A 4H4KC 2ELJA 2XV4S 4E7JA 1JGGA 4IHSA 1U5TC 2JRTA 2A07F 3OS2A 3GFJA 4UVAA 2LTPA 2R92J 4F3QA 2CW7A 5IP7J 3E1SA 2W57A 2VC0A 3GMEA 3ZMZA 3HTSB 2DDAA 2M9HA 5F1JA 1Z9CA 1MMAA 4JX4A 5FFXA 3KLNA 2A69F 2O1CA 3KP6A 2CYYA 4Y52J 2XC7A 2P0WA 4A5MA 2F2EA 3VYSB 5K1YA 2QLZA 2XSQA 1OCRH 1WKMA 3HKZA 3R0JA 3VODA 5FLVA 2R5ZA 2QKLB 3SDGA 1BM9A 4N9IA 2FSWA 4AM3A 3RCOA 2ZMEC 3I59B 4AWXB 3LSPA 2E1MC 4J00A 3S3MA 2OTJI 5LHIA 2MFZA 4M3EA 5GP9A 2A6HF 4C2TA 5FSKA 5FSMA 3HG9A 3S2HJ 4HSTA 3RPUD 3GEZA 3L09A 3BP8A 2XAHA 4IO9F 4N9HA 3TOBA 3AKZA 3BTJA 1D5YA 1GLNA 4RA2A 1YW9A 1R1TA 2X1CA 5ICGA 3H0DA 4X6AJ 4ZYGA 3H1CA 2E60A 4DBRA 3GF2A 3GLLA 5LGNA 1VQ5I 2ZJPF 1B4AA 2P81A 2RV8A 2L0KA 1TNSA 4Y7NJ 2L7KA 4JQFA 4L0ZB 3FWEA 3B6AA 1QVUA 2CSOA
chains in the Genus database with same CATH topology
5KHDA 3EUAA 4KTBA 4XOPA 2KDVA 2CH0A 1UG0A 3OYLA 3P5TA 4XMYA 3WHWA 1DP3A 5IW5A 3HXLA 5DEQA 4K6EA 1MQEA 3ID9A 2W1OA 2XDVA 3U21A 2AQEA 3CZ6A 2O5FA 4E7HA 2X85A 2F5VA 1BOBA 1ERDA 1X84A 2VKDA 3K4CA 3D5SC 1SZ3A 3A6VA 1F3YA 3A6TA 4YOQA 5KNLA 4LIUA 2YVMA 1TZLA 1NQYA 2FKBA 1V5EA 3O61A 2XF7A 4PJLA 4CCMA 2CV1A 4XLCA 4BEHA 1EA3A 3EUHC 5I8UA 3O8SA 3OR1C 4RMNA 5HVQC 1QHGA 2BW3B 2ZSHB 3TL4X 2KZVA 5ANSA 3CF2A 2W4SA 3H5NA 3LSKA 3OGAA 3X0JA 3LSHA 3SZGA 2HPMA 1FMVA 3X0RA 2WAEA 2IS1A 1KONA 2VLAA 3BG7A 1Q27A 4HPQA 2B06A 4Y3OA 2Q2EB 4OAYA 4NFXA 3W2AA 2KL4A 3BLYA 3MKZA 3SMDA 3PNTA 2NOJB 3VYUB 2MABA 3OL3A 2DCEA 1WJBA 2HDWA 1IRXA 1N78A 1HZTA 3U53A 3DU6A 3J7Ye 1V8MA 2QJOA 3LFUA 1T0FC 4HEA2 5FROA 3DQVC 4F92B 2L5QA 1D1AA 3FCMA 4YPHA 2A6TA 3QODA 3OYNA 3TMOA 1BR2A 1I9AA 4S2YA 2K5CA 3LSGA 3SDBA 4FASD 1V8SA 1NG7A 3BHOA 4ZJZA 3EESA 1X4OA 2CW8A 3DTEA 3FSPA 2MD0A 3RQ4A 2PJRA 1G9QA 1VCDA 2WADA 1U20A 1K6YA 2R7UA 5GHQA 2OUMA 2DSDA 3D5RC 2GB5A 5LD2C 3X0QA 1V5GA 2W00A 1N77A 4KISA 1X1CA 2R7VA 3M1CA 2CUJA 3GBGA 2KQRA 1TT0A 2R7WA 4BGDA 1V5FA 3H5AA 4BDZA 4KG3A 4DYWA 3SYTA 2KRCA 3ZR8X 2AQFA 3LSMA 4XOTA 3ZR0A 4DOZA 2CV0A 4ZDOA 3OR2C 3A6UA 4B3XA 4S2XA 3AL0B 3SEQA 4N4NB 2Z2SB 2VNQA 1G8XA 1UAAA 1QVJA 4HVYA 2XSJC 1VC9A 4C30A 3FFUA 3O52A 4JZVA 4JZUA 4F55A 2DHOA 4PJNA 3E57A 3Q4IA 3HL2A 5ANTA 2V7FA 3DLAA 1PVFA 3V42A 1MP2A 3BCBA 2VPLA 1V8VA 3A1YA 2VJJA 4IQJA 4PSXA 3PNYA 2XAUA 4BU2A 1VC8A 2O5WA 5CQGA 4DJAA 3FBNB 4KITB 3N77A 2VXDA 3D5LA 3OYHA 5FSIA 2HPIA 2CZRA 5GHOA 1VRLA 2VQLA 3A2KA 2V6EA 3OYJA 4HFQA 3DKYA 3DU5A 2JSPA 2LY1A 3ZQQA 4YRVA 3MKYB 4QPOA 1PUNA 2R7QA 3S8PA 5CKTA 1WFXA 5FSOA 2ICJA 2JVHA 1E0EA 1Q54A 3IUOA 3H9GA 3H9JA 2ICKA 2XF5A 1D1BA 3PL8A 2CL3A 5GHPA 4ZDPA 3OYIA 2X6XA 2M0MA 4AYBA 2OV7A 2F6CA 2WAFA 3QYBA 5GHIA 3K4LA 3S32A 4C9YA 1AA7A 3IP4B 3DTIA 4PJJA 1VZ0A 3HYQA 2RNGA 5BONA 4NC7A 3HHJA 4ICKA 2RQQA 1IRYA 2GT2A 2R7SA 2VNPA 4OWRB 3Q2TA 2WA0A 2X6YA 2X1EA 3COUA 4LITA 1X1AA 2ZXIA 3IAM2 3FJYA 3K4BA 2KRHA 4PK4A 1MMGA 2LH9A 2HVSA 1PPWA 4PJMA 5LPGA 5CQEA 2HZDA 1MMNA 3Q2SA 1PYVA 2UUZA 4HG2A 2R7OA 2DT7B 3F13A 5ANVA 3G2BA 5CFIA 3W3CA 3NWTA 3BG6A 4BE0A 3M8JA 3L2WA 3EXQA 3HPHA 3GZ8A 2X51A 5KCMA 2ZFUA 1MNDA 4XR6A 2BVMA 4XLHA 3I7VA 3OS0A 3VSLA 2LC2A 3FKJA 3VDXA 2CFOA 1R6RA 2B2KA 3VYTB 2HVQA 5LFAA 4YEJA 2RRKA 2A8QA 3S3OA 2DSCA 4BJ6C 4N4OB 5GHJA 2Z1DA 4V14A 3QYFA 3OYGA 2E1MB 4LIVA 3HC7A 3OYMA 3W2WA 4BL0B 5GHNA 4BEHB 3QSJA 1V8UA 4Y4RA 4F93B 3ZGKA 4D1QA 5DPKA 1V8YA 3DPLC 3ACAA 3ZCOA 1NFZA 2YYHA 4XNFA 2CMPA 4XONA 4MPOA 2G74A 2OC6A 1VIUA 3H95A 3DTKA 4IJXA 3CP2A 4OAZA 3OYDA 1D0ZA 4JZTA 3PJRA 4XN3A 3PFYA 1QHHD 2JVBA 2LOOA 4J7HA 1OR7C 4XKVA 4KYXA 2IS4A 3F9KA 1NQZA 4BE1A 4C2UA 4XQFA 1WJEA 2B0VA 5HNHA 1V8IA 3G0QA 2WY8Q 4J01A 1Y6IA 1VIQA 4YELA 3K70D 2R7RA 1MNEA 1MR2A 5ANWA 2KDWA 4CCKA 1KHZA 2YVOA 1S9HA 3OYKA 1HA8A 5TGTA 2R5WA 3CMMA 2K3PA 5DD4A 3OIPA 3BC8A 2PMZA 2V4JC 3S3NA 1KT9A 5GHMA 3PSFA 1G0SA 2DJIA 5FRMA 4BS9A 3Q93A 2BVLA 2VJ4A 4F52A 1SU2A 4IQ4A 4NC8A 1WJCA 3QOEA 2LG4A 3LL7A 4JOMA 2PJRB 2AZWA 2G73A 3SEZA 4X0GA 5DDGA 4C9XA 4RM3A 4R79A 1X83A 3DKUA 5ISYA 3GWYA 3W2VA 1KTGA 3CJQB 3QYEA 1U0JA 3DEEA 2L9SA 1MUTA 2YVPA 3CP8A 2KP6A 1WJDA 1X4PA 2E5NA 2I8DA 3AFHA 4PSWA 5CPRB 4F91B 3OYBA 3DKXA 1YE9A 4BQQA 3ZXSA 3VSKA 1K26A 4B48A 1NG6A 1Z7LA 2HU9A 2I8TA 3GZ6A 3MD2A 2R7TA 5C7TA 1DGRM 4CSWA 3HUGB 3CJRB 2PQVA 2YVNA 1FMWA 2M4KA 3I9V2 3X0IA 1Z3YA 3OY9A 4AVZA 3O6ZA 3N9UA 2LBFA 2DOAA 4XM3A 3FBIB 4MLOA 4E7IA 2V1NA 3E0JB 4KG4A 2LREA 4CA0A 3Q1PA 5IW4A 1TUMA 1Z21A 3X0PA 1HX3A 2VIXA 1D1CA 4S2WA 2Q9PA 2WBMA 1X19A 1V8LA 3CNGA 3KVHA 3K10A 3OYCA 4AU7A 3DPTA 3H5RA 2A8TA 2K9MA 1VHZA 3C2GA 2VJ5A 2MC4A 4N1TA 2A8SA 3P6YA 3L2VA 4G6TB 2M3AA 3OOUA 4LG3A 2A8PA 2VL8A 5HNFA 3FK9A 5HLTA 5C8LA 4XKCA 2FVVA 3AC9A 3RH7A 1RYAA 1RRQA 2E5ZA 3PNVA 1DGWY 1LKXA 3L2UA 1QU3A 3OYAA 2LYCA 3DWLE 3OWTA 1SOIA 1P9QC 3RSNA 1PJRA 3FHNA 3K4KA 4BE2A 1V8NA 4II3A 4XLEA 2IS2A 5JHFA 3GRNA 4XLFA 3BM4A 1DQUA 3TBIA 3GG6A 1JI8A 1OLTA 1BR4A 5FRNA 3OMYA 3H9QA 3MDIA 4CH7A 4BDYA 4KJZA 3OYFA 2A5WA 2BW3A 4CZCA 3UNGC 1VK6A 2MYSA 3SONA 3OL4A 1LDKB 2RREA 3I9XA 4ZTJA 1JKNA 2GOMA 2J8QA 3K6GA 4E7ZA 4XORA 2KHMA 2JVGA 3AL0C 4XKBA 4XL9A 4BQOA 4CUGA 2W7NA 3L2QA 2PNYA 1UELB 2ZSIB 4DBQA 1XSAA 2Y0SA 1Y56A 2ZXHA 3UR3C 2WB1A 1X51A 1D0YA 1Z3XA 3K4JA 4DGWB 3A6SA 4PFOA 1PUQA 4DIQA 3X0LA 1MW7A 4IKFA 2K9LA 2HNHA 3MMYB 3L2RA 1RRSA 2CUZA 2W82A 1K2EA 4E7KA 4U87A 3MCFA 4PUSA 1MK1A 4ZTFA 2DSBA 2X1DA 4ZYAA 1PPVA 2Q1ZB 3X0SA 4ZDLA 4C9WA 3CESA 4E7SA 5CFJA 3Q91A 1J09A 4PFPA 3MDGA 4BJ5C 2A8RA 4HNTA 3VYRB 2CS3A 2F4IA 3DUPA 4HSRA 2VJIA 2V26A 2FUG2 4CCJA 2DXIA 2DUKA 1G59A 4BJTA 1SJYA 1D0XA 2UV1A 4P5OA 3HPGA 1XSBA 2WY7Q 3R03A 3OIQA 3ONQA 2VQHA 2VQGA 4N1UA 2M7AA 4B43A 3X0MA 4E6KG 3EPZA 4BQNA 4ANJA 1VHGA 2LRDA 3KEYA 4RM2A 3N05A 4ILQA 2HQAA 3LMMA 1X1BA 2IGMA 2W4EA 2R4GA 2VASA 3KYLA 4HRIA 4XN0A 5HOOA 3SHDA 2KDOA 2WAQA 4RLQA 2QKMB 4BACA 4BUPA 3K70C 1WJ5A 2X6WA 1R67A 2LY2A 2FMLA 4GRIA 2Z16A 4S2VA 4NFWA 3EUKL 4YPRA 4P1WA 3K4MA 2KLOA 3BCAA 1W36D 3OS1A 1YX5A 1V8WA 4NUBA 1BR1A 3HOSA 2L9NA 4IZZA 1V8TA 3GZ5A 3S93A 3KX2A 1PUSA 3HOTA 2KPMA 2VXZA 3EF5A 3J7AY 1T95A 2XF6A 4Y33A 4NNJA 2GOXB 3IAS2 2IGNA 4U7BA 1W36C 2QJTA 2IGKA 3RTRA 4EATA 3O69A 3ZR1A 3X0NA 1WJFA 4H4KC 2ELJA 4E7JA 3VWBA 3PUBA 4CCLA 2I6KA 3F6AA 3H35A 5FSLA 3OS2A 2IS6A 3L85A 4RLFA 2CW7A 4F3QA 3E1SA 1LVKA 2M4GA 1MQWA 2M7BA 3OYEA 2VB6A 4XKWA 1MMAA 4B47A 4ITVA 4E4HA 1XSCA 4II2A 2O1CA 3BAPA 2IXSA 4HNUA 3ZRGA 4BXFA 4ZG0A 4XLAA 2XC7A 2P0WA 2VKHA 2HVRA 3VYSB 3MKWB 1NFSA 3X0OA 2XSQA 4B44A 4IX7A 4KT6A 1V8RA 4JZSA 1LFPA 1Q33A 3HKZA 2VQCA 5FSNA 2QKLB 3NWSA 1ZELA 1PPXA 3RCOA 4CCNA 2E1MC 1YX3A 2O5RA 3FDYA 4J00A 1SAUA 3S3MA 5C7QA 5HZXA 2MFZA 2DT6A 4J7GA 3C2HA 4C2TA 5FSKA 3LSIA 5FSMA 3HG9A 2UWMA 4ZC3A 4HSTA 3RPUD 2IGOA 2BOLA 2R7XA 1WJAA 4FETA 1X1DA 5BS6A 3EEUA 2LBFB 2V9KA 3AKZA 4D9JA 1SFKA 1GLNA 3DPUA 2I8UA 4E7LA 4QPQA 5ANUA 2X1CA 3H0DA 2JUGA 1N75A 2JA2A 2E60A 4DBRA 3I7UA 2L2OA 4NQWB 3I3LA 3PSIA 1JRKA 3A4CA 2L7KA 1MMDA 4JQFA 4CCOA 1GA7A 2KMUA 2GT4A 3MGMA 3K4NA 3X0KA 2CV2A 1OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPV A;  1VC8 A;  2O5W A;  4KTB A;  1KT9 A;  5GHM A;  2KDV A;  3N77 A;  3X0S A;  1G0S A;  4C9W A;  5FSI A;  3Q93 A;  3P5T A;  5GHO A;  3WHW A;  1VRL A;  5CFJ A;  3Q91 A;  5DEQ A;  1SU2 A;  5IW5 A;  3MDG A;  4K6E A;  1MQE A;  2A8R A;  3ID9 A;  4HFQ A;  2AZW A;  3DUP A;  1PUN A;  2G73 A;  2DUK A;  2O5F A;  1SJY A;  4C9X A;  5DDG A;  4N1U A;  1X84 A;  1XSB A;  3R03 A;  5FSO A;  3X0M A;  2ICJ A;  1SZ3 A;  1Q54 A;  1X83 A;  3A6V A;  2ICK A;  3A6T A;  3DKU A;  2CL3 A;  1VHG A;  3GWY A;  1KTG A;  5GHP A;  5ISY A;  2YVM A;  4YOQ A;  4ILQ A;  1NQY A;  2FKB A;  1MUT A;  2W4E A;  2YVP A;  3O61 A;  5GHI A;  3SHD A;  1F3Y A;  2QKM B;  5I8U A;  1K26 A;  3O8S A;  1R67 A;  3HYQ A;  2FML A;  5BON A;  4S2V A;  4NFW A;  3HHJ A;  4ICK A;  1IRY A;  5ANS A;  2I8T A;  2GT2 A;  3GZ6 A;  3OGA A;  2VNP A;  3X0J A;  5C7T A;  3Q2T A;  4YPR A;  2PQV A;  3COU A;  2YVN A;  3X0R A;  1V8W A;  3X0I A;  1V8T A;  3FJY A;  3GZ5 A;  1PUS A;  3O6Z A;  1Q27 A;  3N9U A;  3EF5 A;  2B06 A;  2QJT A;  4NFX A;  4KG4 A;  3Q1P A;  5IW4 A;  1TUM A;  1PPW A;  3O69 A;  3X0P A;  3ZR1 A;  3SMD A;  3X0N A;  1HX3 A;  5LPG A;  4S2W A;  2I6K A;  3Q2S A;  5FSL A;  3F6A A;  3F13 A;  2DSB A;  2Q9P A;  5ANV A;  1V8L A;  5CFI A;  3CNG A;  3KVH A;  3L85 A;  1HZT A;  3U53 A;  2A8T A;  1V8M A;  3J7Y e;  2QJO A;  1VHZ A;  1MQW A;  4N1T A;  3GZ8 A;  2A8S A;  3EXQ A;  3P6Y A;  3FCM A;  4YPH A;  2A8P A;  1I9A A;  2A6T A;  3FK9 A;  4S2Y A;  3I7V A;  1V8S A;  1XSC A;  2FVV A;  3AC9 A;  2O1C A;  3BHO A;  3EES A;  1RYA A;  3BAP A;  5C8L A;  2B2K A;  3RH7 A;  3FSP A;  1RRQ A;  1G9Q A;  1VCD A;  2RRK A;  1SOI A;  1U20 A;  2A8Q A;  2DSC A;  5GHQ A;  4ZG0 A;  1V8N A;  2DSD A;  2GB5 A;  3X0Q A;  5GHJ A;  1NFS A;  3X0O A;  4V14 A;  3GRN A;  2XSQ A;  3BM4 A;  1V8R A;  4JZS A;  5GHN A;  3GG6 A;  1Q33 A;  5FSN A;  3QSJ A;  1V8U A;  4KG3 A;  4DYW A;  2QKL B;  3ZR0 A;  1PPX A;  5DPK A;  1V8Y A;  3MDI A;  3ACA A;  1NFZ A;  2YYH A;  4MPO A;  2G74 A;  1VIU A;  5C7Q A;  3H95 A;  5HZX A;  4IJX A;  1VK6 A;  3A6U A;  4S2X A;  4JZT A;  5FSK A;  3SON A;  5FSM A;  2JVB A;  2VNQ A;  3I9X A;  4KYX A;  1JKN A;  2J8Q A;  1QVJ A;  1NQZ A;  5BS6 A;  3EEU A;  4HVY A;  2B0V A;  1V8I A;  1VC9 A;  3G0Q A;  2PNY A;  5ANU A;  2I8U A;  3FFU A;  1XSA A;  3O52 A;  4JZV A;  1VIQ A;  4JZU A;  1X51 A;  2DHO A;  1MR2 A;  5ANW A;  2KDW A;  1KHZ A;  1PUQ A;  3A6S A;  2YVO A;  3E57 A;  3I7U A;  3Q4I A;  3X0L A;  5ANT A;  2R5W A;  1RRS A;  1JRK A;  1GA7 A;  1K2E A;  1PVF A;  1MP2 A;  2GT4 A;  3MGM A;  1V8V A;  5DD4 A;  3X0K A;  3MCF A;  1MK1 A;  1OW2 A; 
#chains in the Genus database with same CATH topology
 3QAH A;  2FXA A;  5KHD A;  3TO6 A;  1U78 A;  1W5C C;  1JUP A;  3FXQ A;  3WTS C;  2E34 A;  2EIN H;  4XMY A;  5BMZ A;  4XIC A;  1RKW A;  1EH8 A;  1R4M B;  2WC2 A;  4O6J A;  2W1O A;  5GPC A;  1VQL I;  2XDV A;  4NB5 A;  4K6E A;  4BHP A;  3WGH A;  2RGV A;  4E7H A;  2NVX J;  3K4C A;  2IP2 A;  2FJ1 A;  2BE5 F;  2DFF A;  5ERI A;  3WGG A;  3D5S C;  1XS9 A;  1F3Y A;  2UXN A;  1TWG J;  3F21 A;  2BEO A;  4LIU A;  2L54 A;  3S14 J;  5TRD A;  1NQY A;  1MKM A;  2FKB A;  4PJL A;  3BTL A;  5IP6 A;  1JT6 A;  3FK6 A;  1BL0 A;  2QYO A;  4Z6Y A;  2LD5 A;  3QPT A;  1ZTR A;  1ZYR F;  4U7D A;  1P6R A;  2KZV A;  3H5N A;  4A3M J;  4UY8 I;  3LSK A;  3X0J A;  2DYS H;  3LSH A;  2CUF A;  3LQR A;  2KZG A;  1FMV A;  3SZT A;  3LST A;  3QPS A;  3NAU A;  2VLA A;  3T8T A;  2B7E A;  4BY7 J;  3GUD A;  2DW4 A;  3V7R A;  3GFM A;  1T39 A;  2FQ3 A;  2DMN A;  5DCM A;  3W2A A;  1PUE E;  3BLY A;  1RI7 A;  2M0C A;  3FF5 A;  1SVM A;  3EDP A;  3KYD B;  4EV0 A;  2R0Q C;  4ESJ A;  3G71 I;  4XRS A;  1WJB A;  3AG3 H;  4MIM A;  3U53 A;  2DLL A;  3LFU A;  2L01 A;  5HS8 A;  3ZMS A;  3DQV C;  1A6Q A;  2VN2 A;  4M73 A;  3QOD A;  3TMO A;  2K5C A;  3SDB A;  1X4O A;  2DOD A;  2XKO A;  2DI3 A;  3DTE A;  3RQ4 A;  2PJR A;  3ASO H;  1VCD A;  1R4N B;  5B3S H;  2E19 A;  4KIS A;  2QF7 A;  1ETV A;  1BBY A;  2TDX A;  1KQ9 A;  3GVA A;  2LFB A;  3EUH A;  2KQR A;  2YR2 A;  3BTC A;  3V7S A;  2R7W A;  2HGC A;  4KUM A;  1X3U A;  3BDD A;  5E18 F;  4BDZ A;  4A0Z A;  4KG3 A;  2KRC A;  3ZR0 A;  1FP1 D;  3LFK A;  4A2U A;  1IUF A;  4MNU A;  1T56 A;  3ECH A;  3FX3 A;  5LLQ A;  2EQR A;  3AG2 H;  4S2X A;  1FT9 A;  4XBF A;  4G7Z F;  1VQ8 I;  2O6G E;  2VNQ A;  1U9O A;  2TRT A;  1MJA A;  4MQ9 F;  1OCT C;  2CW0 F;  1RRJ A;  1IUY A;  1VF9 A;  4C3H J;  1VC9 A;  2J5P A;  2M87 A;  4C30 A;  3KZY A;  4JZU A;  1QO0 D;  4F55 A;  5EEA A;  2OU2 A;  3Q4I A;  1HW5 A;  3S1R J;  2ZJQ F;  4HYE A;  5DTD A;  2V7F A;  4IJA A;  4I0A A;  3GTO J;  4KNY A;  1RPW A;  2CQN A;  3E6C C;  1V8V A;  2E1N A;  4IQJ A;  1B72 A;  2QUF A;  2XAU A;  3LSJ A;  2O5W A;  2D1H A;  3ELK A;  5CQG A;  1G3Y A;  4KIT B;  1I6X A;  3OYH A;  4WX9 A;  4U0W A;  5FSI A;  2CU7 A;  5GHO A;  2VQL A;  1I39 A;  4HX4 A;  1YJN I;  2A05 A;  2JSP A;  2LY1 A;  3ZQQ A;  1TQM A;  3MKY B;  2RDP A;  2R7Q A;  3S8P A;  3I0T A;  5FSO A;  2K02 A;  5K7F A;  1Q54 A;  2ICK A;  1SEU A;  3PL8 A;  1D1B A;  4R8H A;  1I5Z A;  1OYW A;  5GHP A;  2EB7 A;  4A3F J;  1ETK A;  3OYI A;  5JI6 A;  1S8N A;  2NRA C;  1DP7 P;  4C9Y A;  1W1W E;  3HOZ J;  1G2H A;  1FEX A;  1R58 A;  3IP4 B;  3DTI A;  4Q47 A;  2PMH A;  1KU9 A;  2OF7 A;  2RNG A;  3HHJ A;  3J7Y J;  1I1S A;  2XKP A;  1IRY A;  3KP5 A;  2LP0 A;  1ETY A;  4HF1 A;  4LIT A;  1X1A A;  2H09 A;  2ZNY A;  3ZMV A;  3S1N J;  1TQI A;  1J5Y A;  3JRA A;  1SVL A;  1I27 A;  1C0W A;  3K4B A;  5BOX A;  1U5T B;  1WQ2 A;  2L9V A;  4PK4 A;  1Z05 A;  1YS7 A;  3FM5 A;  1P4W A;  1PPW A;  2GQQ A;  1D5V A;  1T2K A;  2VT3 A;  1KYW A;  1MMN A;  4M71 A;  1QA6 A;  2DT7 B;  3F13 A;  1SD6 A;  4OMZ A;  1IGN A;  3G2B A;  3ML6 A;  1ZG1 A;  5M5W J;  1OFC X;  3NWT A;  3L1P A;  2O9L A;  1YLF A;  3BG6 A;  5JR3 A;  2JRM A;  4KN7 X;  4BE0 A;  3L2W A;  3EXQ A;  3HPH A;  2F48 A;  3A0B C;  3RJP A;  3JRH A;  4NBQ A;  5F1R A;  4LK0 F;  3P9C A;  2WB1 N;  3OS0 A;  3I7V A;  2JJ7 A;  3VDX A;  3HJE A;  1U6G A;  5LFA A;  1YO5 C;  2F5D A;  3T5X A;  2H6B A;  5K7H A;  1U9N A;  5EEG A;  4BJ6 C;  3GTG J;  3O2P E;  3Q3S A;  1TC3 C;  1IDY A;  1B6A A;  1M1E B;  4FX4 A;  2Z1D A;  4KIF A;  2ZME B;  5FLX Z;  5FJ8 J;  2E1M B;  1XGN A;  2FE3 A;  4BL0 B;  1FSH A;  4D7N A;  4BEH B;  1E3O C;  4A3K J;  2EZL A;  3JCU C;  4F93 B;  3CUQ A;  1V8Y A;  1YJW I;  2LKX A;  2ELH A;  4B4C A;  3ZCO A;  2P5V A;  2H1K A;  2CMP A;  4XON A;  1ORK A;  2G74 A;  2OC6 A;  2Z33 A;  4EGY A;  3DTK A;  1R9T J;  4IJX A;  3CP2 A;  1KZH A;  3U2R A;  1Z6T A;  1QHH D;  1FLI A;  1OR7 C;  4U0Y A;  2EA2 A;  3TP0 A;  3KP4 A;  3J7A O;  2R7D A;  2VBX A;  4XQF A;  1XCB A;  1NK3 P;  1ETX A;  1WJE A;  3DV8 A;  3CQZ J;  2WY8 Q;  4RS8 A;  4J01 A;  3F6V A;  2KFD A;  3HRT A;  3R60 A;  1HA8 A;  2X4H A;  2K3P A;  1Z77 A;  3ZQL A;  4D0P A;  3OIP A;  5BNG A;  2GIV A;  3RIR A;  1U2W A;  3S3N A;  3A0H C;  3F72 A;  4HOB A;  4AC0 A;  4BS9 A;  1YHQ I;  1RES A;  2VJ4 A;  4E70 A;  1W5T A;  4NC8 A;  1CF7 A;  1WJC A;  3CCJ I;  2LG4 A;  1WRJ A;  1G6N A;  5DDG A;  2GIZ A;  3GW2 A;  2DQL A;  2FNA A;  1HQC A;  4RM3 A;  2DFE A;  2EFN A;  3W2V A;  1KTG A;  3CJQ B;  3TDU C;  3GXO A;  5BPD A;  2R7F A;  3DEE A;  4HLY A;  3CME I;  1MUT A;  1W5S A;  3IWF A;  5TJJ A;  2YVP A;  2KP6 A;  3B02 A;  2E5N A;  4EJW A;  2O61 A;  1MBE A;  1YE9 A;  4BQQ A;  3ZXS A;  3VSK A;  3VEP A;  1F5T A;  1ONV A;  3JSP A;  4JX6 A;  3MD2 A;  3BR3 A;  4D5F A;  3CJR B;  2PQV A;  2YVN A;  3I9V 2;  3KP7 A;  5F0F A;  3R6S A;  1F43 A;  3JW4 A;  1X58 A;  1GXP A;  1D8J A;  4XM3 A;  3FBI B;  4E7I A;  5IT3 A;  2F5F A;  4QWQ A;  3X0P A;  3DEU A;  1EV7 A;  2Y75 A;  4D5C A;  1JKQ C;  3B73 A;  4XRF A;  4NQW A;  2Q9P A;  5EG0 A;  5FKN A;  2Y48 A;  3OYC A;  2O3F A;  3H5R A;  2DA1 A;  2XAJ A;  2XUB A;  2X0L A;  4JBA A;  1VHZ A;  5DM7 F;  2A8T A;  1I50 J;  2LF7 A;  2MC4 A;  4UUT A;  2A8S A;  4N1T A;  1KU3 A;  3KFW X;  3S2W A;  4G6T B;  3OOU A;  5HNF A;  3HOY J;  2K9Q A;  4GO1 A;  2QA4 I;  1RYA A;  1IN8 A;  2DMP A;  5IOY A;  1XGO A;  1BA5 A;  1ZG5 A;  3OYA A;  2LYC A;  1YRN B;  3K4K A;  3HSE A;  1SVO A;  4V2F A;  5C44 J;  4UUV A;  3E5X A;  3GRN A;  3TBI A;  2QQ9 A;  3ZMT A;  5FRN A;  4DZJ A;  3TED A;  3MDI A;  4M6X A;  1ZRF A;  4BDY A;  4LB5 A;  1SFX A;  1TWA J;  4KJZ A;  3RKQ A;  2BW3 A;  4CZC A;  3UNG C;  2EPF A;  3WGI A;  3OL4 A;  4ZZD A;  3JRI A;  2GOM A;  2J8Q A;  2P6S A;  2Z99 A;  3Q5F A;  4YFN F;  5EYR A;  2JVG A;  2W7N A;  2PNY A;  1VQN I;  2ZSI B;  1UEL B;  2BV6 A;  1IDZ A;  2BY0 A;  2Q2E A;  1XSA A;  2JT1 A;  1JTY A;  1Y56 A;  2ZXH A;  1WI3 A;  2V1U A;  2WB1 A;  4FCY A;  4I99 C;  3FMR A;  1K78 A;  2GXA A;  4E7K A;  3PO2 J;  1VQ4 I;  4ZYA A;  5BPI A;  1PPV A;  3O8H A;  1SFO J;  3BPX A;  2KKO A;  3Q91 A;  1J09 A;  4WXC A;  3MDG A;  4BJ5 C;  5ICF A;  3VYR B;  1R5I D;  4AVP A;  4HSR A;  2VJI A;  3K2Z A;  1O3R A;  1TP4 A;  4BJT A;  1SJY A;  1XPX A;  3X0M A;  4IHV A;  2IJL A;  4AID A;  1S7O A;  3LA2 A;  1H89 C;  3KEY A;  1FP2 A;  4RM2 A;  3N05 A;  3WG7 H;  4ILQ A;  5M5Y J;  1RUO A;  4HRI A;  2VAS A;  2DPU A;  2VE9 A;  5HOO A;  2D2W A;  2KDO A;  4BAC A;  2AXT C;  1XG1 A;  3TOA A;  2LY9 A;  3LOC A;  5E3L A;  5EGO A;  1HBX G;  3S1Q J;  1UJ8 A;  3BG9 A;  1YW8 A;  3KP2 A;  5LHG A;  4NFW A;  3QP6 A;  3FXO A;  5JFR A;  4QLC U;  4TV7 A;  4YPR A;  4HQM A;  2KLO A;  4L0Y B;  3OS1 A;  1YX5 A;  1V8W A;  4NUB A;  2L9N A;  4IZZ A;  1V8T A;  3P7N A;  3HOT A;  2KPM A;  3EF5 A;  2FF4 A;  1GVD A;  1W36 C;  2IGN A;  1BW6 A;  2O8K A;  3IRQ A;  2OJE D;  1A04 A;  3O69 A;  3I55 I;  1WJF A;  4U0V A;  3PUB A;  3M9A A;  4CCL A;  2NYX A;  3LSR A;  1B8I A;  3G73 A;  2VT2 A;  1E3P A;  4RLF A;  1FOK A;  1ACI A;  5CVR A;  1LVK A;  2A6E F;  1MQW A;  3KZZ A;  2P5K A;  3O6B B;  1ZLJ A;  2KIM A;  4PGG A;  4B47 A;  4E4H A;  1QZZ A;  3FXJ A;  4KMU X;  2IXS A;  4HNU A;  4IF4 A;  2ZB9 A;  2HVR A;  4MQV A;  3A01 A;  3MKW B;  1NFS A;  3X0O A;  4KYW A;  4BBR J;  3JAM Z;  4YIR X;  1V8R A;  2MG4 A;  1Q33 A;  5D5W B;  5FSN A;  3RKX A;  1TWC J;  2NVT J;  3NWS A;  1ZEL A;  1K4T A;  4HW0 A;  1PPX A;  3NQO A;  1YX3 A;  2K40 A;  1SD4 A;  3FDY A;  4LLL A;  1BOA A;  5HZX A;  4IL6 C;  5K7Z A;  4QTR A;  2VOD A;  2CO5 A;  1EJ9 A;  4ZC3 A;  1P4X A;  2R3S A;  4A3G J;  1LEB A;  1RUN A;  2HFH A;  3IL2 A;  2LBF B;  1XX5 A;  4DNC A;  3ZPL A;  2OD5 A;  4KFC A;  5ANU A;  1FZP B;  2I8U A;  1EKE A;  2B0L A;  2EH3 A;  4UUS A;  4EJT A;  2JUG A;  1N75 A;  2IA0 A;  2JA2 A;  4Q4Z F;  2L2O A;  2JMW A;  3I3L A;  3PSI A;  1JRK A;  1MMD A;  2MC3 A;  4LLG F;  3ABM H;  2DFH A;  3Q9V A;  3X0K A;  4C9W A;  2CV2 A;  4YFX F;  1G3T A;  3EUA A;  3JRF A;  1BIB A;  3OYL A;  3P5T A;  2QWW A;  1KA8 A;  1W7P B;  2AQE A;  3CZ6 A;  1J75 A;  1JJ6 C;  2X85 A;  3M8E A;  2ISZ A;  4RAF A;  2OTL I;  1ERD A;  2STW A;  4GCV A;  2LVS A;  1SZ3 A;  1UHM A;  1R1U A;  1FY7 A;  2QQB A;  5K5O A;  1IN7 A;  1TZL A;  1MMS A;  2RVC A;  2XF7 A;  3I5U A;  4HLX A;  4CCM A;  2GM4 A;  1Z6R A;  2M5W A;  2HXO A;  1XDU A;  3CCM I;  1EA3 A;  3EUH C;  3J80 Z;  5I8U A;  1LFB A;  1GV5 A;  3G6E I;  2W84 A;  1S7A A;  1Z7U A;  2ZSH B;  4UB8 C;  5ANS A;  2VPR A;  2W4S A;  5GAH J;  1LE8 B;  3BR1 A;  1BN5 A;  2OZ6 A;  2HPM A;  2FQ4 A;  1AKH B;  1KON A;  1XGS A;  3DP7 A;  1ETO A;  5J47 A;  2DA2 A;  3PM1 A;  3MZY A;  3FIS A;  1ZQ3 P;  2EV0 A;  4OAY A;  1B9M A;  3FXM A;  1D3Y A;  3MKZ A;  1X3W B;  5D8L B;  2IRF G;  5CVJ A;  3SMD A;  3QU3 A;  3PNT A;  5JVT A;  5GAE J;  2DJN A;  2W48 A;  3TQN A;  1BJZ A;  1BI3 A;  2V79 A;  2HDW A;  1IRX A;  5B1B H;  4I02 A;  1V8M A;  3J7Y e;  3PFI A;  2ZC2 A;  4GYI A;  2P7C B;  5LGT A;  1D1A A;  1QZE A;  4UV8 A;  1FIA A;  1I9A A;  4S2Y A;  3LSG A;  4HF0 A;  1ZRE A;  1F36 A;  1OKR A;  2CW8 A;  2DU9 A;  2MD0 A;  1G9Q A;  3I71 A;  2WAD A;  3ASN H;  4ENJ A;  5E20 A;  1HOM A;  1R7J A;  2DAO A;  2R7U A;  4AIH A;  3X0Q A;  3WE2 A;  2W00 A;  1N77 A;  4HX8 A;  1X1C A;  4AUX A;  4Y15 A;  3JSO A;  3NRV A;  2CUJ A;  2EJR A;  3KEO A;  3HOV J;  3HRU A;  1ZAO A;  3BG3 A;  4BGD A;  2VON A;  2DOE A;  2OCC H;  3LSM A;  3HRS A;  3SXY A;  2CV0 A;  4ZDO A;  2FRH A;  4L9J A;  2QSH X;  4RAY A;  1UG2 A;  4B3X A;  4IRG A;  1K83 J;  3SEQ A;  5F0H A;  2QCO A;  1UAA A;  1QVJ A;  1IN5 A;  2HXI A;  5DYM A;  3IH2 A;  2HTS A;  3H36 A;  4HVY A;  4A12 A;  3KYC B;  1Y39 A;  2DT5 A;  1APL C;  4BQA A;  5IP9 J;  4K2E A;  4L9T A;  3C7J A;  3DLA A;  1T0F A;  1ZHF A;  3G4S I;  1PVF A;  3V42 A;  3E5Q A;  3W6K B;  4AIK A;  2VPL A;  1MP2 A;  2VJJ A;  4PSX A;  3I59 A;  3PNY A;  4BU2 A;  5HS9 A;  3F3X A;  3N77 A;  1RC9 A;  3GTM J;  3W6J B;  1VTN C;  2V6E A;  1IRF A;  4M3G A;  3DKY A;  3I54 A;  2TCT A;  1PUN A;  4QPO A;  3DLL F;  1WWX A;  3CCL I;  1PUF A;  4ZZL A;  2ICJ A;  3IUO A;  2GAU A;  1V55 H;  4A3E J;  2QQA A;  4ZDP A;  1FJL A;  1FTZ A;  2BXY A;  2EIK H;  2OV7 A;  5E17 F;  2R5Z B;  1REP C;  4PJJ A;  4V19 K;  2ZBK A;  3CDL A;  4KT5 C;  3TDZ C;  5BON A;  2K4J A;  5GAG J;  1MZB A;  3HZJ A;  5LEJ A;  2RQQ A;  4LD5 A;  3I4N J;  2GT2 A;  3CUQ C;  1RR7 A;  2VNP A;  4OWR B;  3GCM A;  4UNO A;  2X1E A;  1X2M A;  3COU A;  1Y1W J;  5GPA A;  2IW5 A;  5L3F A;  2KT0 A;  1T33 A;  2R5Y A;  3DFG A;  3IH4 A;  3L2C A;  2LH9 A;  1OCC H;  1ZH5 A;  2AO9 A;  3Q2S A;  1SFE A;  1PYV A;  1QQI A;  2UUZ A;  2XPU A;  5L3E A;  3HGY A;  2V6C A;  3K1M A;  1IW7 F;  3O8G A;  2L02 A;  2LLK A;  1AOY A;  3PUF A;  1STZ A;  4FIS A;  3HOW J;  4EMS A;  4HV6 A;  3GZ8 A;  1Z91 A;  5KCM A;  1VQM I;  1MND A;  2BVM A;  2Y0S N;  2HTJ A;  3HB9 A;  2LC2 A;  3JTG A;  4M9S A;  3VYT B;  2DSC A;  3TO9 A;  4I2O A;  3W6V A;  2C6Y A;  2EV5 A;  3CLO A;  4EJU A;  3CDI A;  4V14 A;  3OYG A;  3FXL A;  4LIV A;  3OOP A;  5DUI A;  2JSC A;  4I01 A;  3QSJ A;  2ZXJ A;  2EIL H;  3E5U A;  3ZGK A;  5DPK A;  4HNV A;  3ACA A;  4ESB A;  4XNF A;  4MPO A;  4GFB A;  3O3K A;  4OU0 A;  4UVC A;  5FFZ A;  2L3D A;  2E35 A;  1D0Z A;  4JZT A;  1N25 A;  2W85 A;  3PJR A;  1P7J A;  2V1X A;  4FHT A;  2K7L A;  5KVR A;  4J7H A;  2QM3 A;  1NQZ A;  4L9N A;  5EDN A;  4AIJ A;  2B0V A;  2WAQ N;  3FIW A;  1V8I A;  4IVN A;  4BAY A;  4ZYE A;  2HQ5 A;  4M9X A;  4YEL A;  1MNE A;  5ANW A;  2KDW A;  4CCK A;  2JWT A;  2YVO A;  3S15 J;  2ZKZ A;  4JP0 A;  5TGT A;  4Y17 A;  1SAX A;  2R5W A;  3C3W A;  3BC8 A;  2OZU A;  4LMY A;  3E7L A;  3E6M A;  2V4J C;  3CCE I;  3PSF A;  5LRS A;  3AAF A;  5IYD J;  1UZC A;  4P9F A;  4C2M J;  5FRM A;  3Q93 A;  2I5U A;  2FBH A;  3WTX C;  3IKT A;  1GXQ A;  4F52 A;  1WH7 A;  1O3T A;  1SU2 A;  3H0G J;  3H3U A;  1W7P D;  2PJR B;  2G7H A;  3SEZ A;  3FM3 A;  5E1X A;  3P9K A;  1Z67 A;  2STT A;  1X83 A;  3DKU A;  1Y8Q B;  2G9W A;  1HW2 A;  3F8F A;  2P6T A;  5CLS A;  4MGR A;  2L9S A;  1JHF A;  4PSW A;  4A69 C;  5E8G A;  2YX4 A;  3OYB A;  3ZQC A;  3DKX A;  2DPD A;  2DA6 A;  3WU0 A;  2AXL A;  4AD9 A;  3REO A;  5FLM J;  2RAE A;  5E1W A;  3RYP A;  2I8T A;  1S6L A;  3CUO A;  1FPQ A;  4KN4 X;  5C7T A;  3CTA A;  4XID A;  4LGW A;  4DYQ A;  2M4K A;  1DPU A;  2YUS A;  3N9U A;  1FBS A;  1DDN A;  2DOA A;  1KU7 A;  4MLO A;  2V1N A;  2LRE A;  5IW4 A;  2FA5 A;  3U9G A;  3RYR A;  3RPQ A;  1Z21 A;  1TUM A;  1HX3 A;  1O3S A;  5ICE A;  1ZN2 A;  2E71 A;  5D5U B;  3ABT A;  2L4M A;  1V8L A;  3G1O A;  3K10 A;  5J3L A;  1B72 B;  3DPT A;  1B59 A;  1GVJ A;  2K9M A;  2P8T A;  2BGC A;  3C2G A;  3F8C A;  2IAI A;  2NS0 A;  3F6O A;  3P6Y A;  2M3A A;  4LG3 A;  3T8R A;  4EM2 A;  3TP3 A;  1B9N A;  3SJM A;  2GA1 A;  3ISP A;  3AC9 A;  2FVV A;  4ABZ A;  3RH7 A;  3BR0 A;  3IV5 A;  3ERM A;  2NVY J;  2OA4 A;  1DGW Y;  2QEN A;  3L2U A;  1SOI A;  1WZ2 A;  3RSN A;  5JHU A;  1R00 A;  3TGN A;  3NAR A;  4II3 A;  4MEX F;  4Q48 A;  2GLO A;  2ID3 A;  3BM4 A;  5E8I A;  2PEX A;  2DO7 A;  1DQU A;  2IEK A;  4A0Y A;  2HOS A;  1BR4 A;  1S7E A;  3OMY A;  4M6Y A;  4CH7 A;  3BR5 A;  3GTJ J;  1FYM A;  3CDH A;  1YJ9 I;  1LNW A;  4G6Q A;  2VI6 A;  4RGU A;  4GXO A;  3ERE D;  3TW6 A;  2D45 A;  1LDK B;  1GT0 C;  2RRE A;  5B66 C;  3F0C A;  4A5N A;  3MWM A;  4G7O F;  3K6G A;  3GTK J;  4E7Z A;  3COA C;  5GTH C;  3AL0 C;  3CF5 F;  1AU7 A;  2XAS A;  5IOZ A;  4CYC A;  3LAP A;  2Y0S A;  4WF2 A;  2ETH A;  3RI4 A;  3UR3 C;  4DGW B;  4DIQ A;  4QIW N;  1MW7 A;  1R22 A;  1HXD A;  3E3V A;  3L2R A;  1H0M A;  2M34 A;  3ZQG A;  2DK5 A;  4B09 A;  2Q0O A;  3EET A;  4PUS A;  2L9R A;  1MK1 A;  4ZTF A;  2X1D A;  3WTY C;  4RGX A;  3F22 A;  1U8R A;  3ZQ7 A;  4W1U A;  3GFI A;  5CFJ A;  2RQP A;  2A8R A;  1VQ9 I;  4YG2 F;  2BY2 A;  4DW6 A;  3C1D A;  2V26 A;  2FUG 2;  2NXN B;  3D0S A;  5DCF A;  5FKM A;  2DXI A;  2DUK A;  1D0X A;  2UV1 A;  4P5O A;  3HPG A;  1MSE C;  4U88 A;  4A0X A;  4EJV A;  4ZYH A;  2VQH A;  2WWY A;  3F8M A;  5DV5 A;  4B43 A;  4CXF A;  3GTQ J;  4E6K G;  1K6O A;  1FNN A;  2NVU B;  4FTH A;  5DS9 A;  2DA3 A;  3LMM A;  1Z0X A;  2Y30 A;  2W4E A;  1SMT A;  3SHD A;  2E7W A;  2WAQ A;  5D6F A;  4BUP A;  2IBD A;  1WJ5 A;  3FXK A;  3WTU C;  3BTI A;  3DBL B;  1FOX A;  1I6H J;  4GRI A;  2PBI A;  4S2V A;  4BYY A;  2E1C A;  2LDU A;  1ODD A;  3BCA A;  3K4M A;  1W36 D;  1BI0 A;  1BR1 A;  5IYB J;  3HSF A;  3CC4 I;  1PUS A;  2Z5U A;  3BT9 A;  1UMQ A;  2FEZ A;  3PQK A;  1T95 A;  2XF6 A;  3LA3 A;  4GGG A;  4M3D A;  3IAS 2;  4WXH A;  4Y33 A;  1G4D A;  2XGD A;  1LDJ A;  3JRD A;  3ZR1 A;  2NS8 A;  3X0N A;  4I09 A;  3QQA A;  4MTE A;  2PJP A;  2IS6 A;  4IEJ A;  1UCR A;  4F7Z A;  1JE8 A;  5F0C A;  1GV2 A;  2M1B A;  2M4G A;  2VBZ A;  5LHH A;  1MBK A;  5J1U A;  3V8K A;  2IVM A;  4ITV A;  2ME6 A;  3WHB A;  1CF7 B;  1XMX A;  2FBK A;  4II2 A;  3MFK A;  2H94 A;  2EFP A;  2QEX I;  1G3S A;  3V4G A;  3ZRG A;  1PP7 U;  4BXF A;  2JQ7 A;  4XLA A;  3KLO A;  1LEA A;  2X9D A;  2VKH A;  5EZH A;  1LDD A;  4IX7 A;  4KT6 A;  4XSZ F;  4A6D A;  3WHC A;  5A2Q K;  3TKY A;  1JKR C;  3TW7 A;  3N4M A;  5J1R A;  4CCN A;  4PGH A;  5L3C A;  3B6C A;  5L3B A;  5E3M A;  3LA7 A;  1SAU A;  2DFI A;  5C7Q A;  3MQ0 A;  5F04 A;  4M74 A;  4J7G A;  1FBQ A;  3C2H A;  1HKS A;  3LSI A;  2R7Z J;  2BOL A;  1YG2 A;  1GDT A;  4AYB N;  5BS6 A;  2DBB A;  3Q0V A;  4L18 B;  2V9K A;  1JUM A;  1HKT A;  3DPU A;  2QBY A;  4A93 J;  4E7L A;  4QPQ A;  1TBX A;  4DYR A;  5CVV A;  3KZI C;  1H9T A;  4IHW A;  2LKS A;  4NQW B;  1TQP A;  1BI1 A;  3RZO J;  3DF8 A;  1IC8 A;  1A31 A;  4ENN A;  2GT4 A;  4EJO A;  3MGM A;  2EBI A;  1ZR2 A;  1DU0 A;  5H6R A;  3BRO A;  2KDV A;  2F4M B;  4S0H B;  3K9T A;  3MZ8 A;  1CQT A;  2K85 A;  3RDI A;  1DP3 A;  3WHW A;  2HR3 A;  3BR2 A;  1LVA A;  2Y0M A;  4HV5 A;  3U21 A;  1HW1 A;  2JA6 J;  2F5V A;  4KMF A;  1FBU A;  3NEU A;  1J2X A;  3IWZ A;  4WK8 F;  3IH3 A;  3BZ6 A;  5KNL A;  1BIA A;  2LKP A;  2H1L A;  3MKL A;  4UB6 C;  2JTV A;  3JTH A;  4DQ2 A;  4RAG A;  2CV1 A;  2MBF A;  3HGG A;  4XLC A;  4ETS A;  5KAI C;  3PO3 J;  1WGX A;  3ESW B;  4I98 B;  4HDV A;  3BQY A;  3OR1 C;  5HVQ C;  2BW3 B;  2JA7 J;  1MH3 A;  3CF2 A;  2H8W A;  3U1K A;  2Y9Y A;  3RKW A;  2IT0 A;  2KIU A;  2O7O A;  2WAE A;  2IS1 A;  1SAN A;  3RPU A;  3J81 K;  3N97 A;  3BG7 A;  5DM6 F;  5HDN A;  1Q27 A;  1FIP A;  2L7M P;  3I58 A;  2B06 A;  4EM0 B;  1RET A;  2Q2E B;  1SD5 A;  2FBI A;  2KL4 A;  2QQ8 A;  2RN7 A;  2ISY A;  5KAF C;  1K78 B;  3MCZ A;  2NOJ B;  3VYU B;  3OL3 A;  1HCR A;  2ZFW A;  4OIN F;  5IPA A;  3BJO A;  1N78 A;  1HZT A;  2IPQ X;  3M07 A;  3DU6 A;  1HF0 A;  3PIO F;  2XIG A;  5IT9 K;  1T0F C;  3M7G A;  2BY1 A;  5FRO A;  3V8J A;  4XLP F;  3OIO A;  2EZH A;  4MO7 A;  2JK3 A;  3OYN A;  1EF4 A;  2YS9 A;  4P55 A;  3EES A;  3BHO A;  4ZJZ A;  3FSP A;  2YSR A;  3ZMD A;  2EFW A;  1ITY A;  2DSD A;  2PMZ N;  5LD2 C;  5BQT A;  2H8R A;  1LB2 A;  4KIG A;  2KJC A;  4LB6 B;  4GDF A;  2JA8 J;  3M1C A;  4UHT A;  2EIM H;  1TL8 A;  5LBQ A;  3GBG A;  1TT0 A;  2DQR A;  5EGO B;  1O57 A;  2CWE A;  4DYW A;  3SYT A;  3ZR8 X;  1DUX C;  1A5J A;  4DOZ A;  2ZXW H;  5JVG F;  2N8G A;  3CCY A;  3MVP A;  3OR2 C;  3AL0 B;  2EZK A;  3ZMU A;  2LNB A;  3HUG A;  3GYH X;  4IOC F;  1Y0N A;  5CVU A;  4YFK F;  4CYD A;  2HYF A;  3FFU A;  2YU9 J;  4JZV A;  5FKO A;  4A3C J;  2DHO A;  4BXX J;  4P9U A;  4PJN A;  3E57 A;  1Q1H A;  2NVQ J;  5HDK A;  3HL2 A;  2WTE A;  1B8I B;  2EZI A;  3IHU A;  5FB2 A;  2Y31 A;  1IXR C;  2ACJ A;  4UXN A;  1CGP A;  1HC8 A;  2ZJR F;  1VC8 A;  2K27 A;  5GTI C;  2A68 F;  1Y0U A;  2VXD A;  2DA5 A;  2DMU A;  2HPI A;  2CZR A;  3A2K A;  4JX5 A;  4HFQ A;  3DU5 A;  4A3B J;  2O03 A;  2JN6 A;  1SMY F;  3HKZ N;  4LG0 A;  1F1Z A;  1LFU P;  1P4A A;  1WFX A;  2HQR A;  2JVH A;  3QP5 A;  2H27 A;  3BG5 A;  3A01 B;  1E0E A;  3H9G A;  2XF5 A;  2CL3 A;  3HTU A;  5EEH A;  1OPC A;  4JYK A;  1HSJ A;  1T38 A;  1YI2 I;  4AYB A;  4WWC A;  1G3W A;  3QWL A;  3K4L A;  3S32 A;  1ON1 A;  2J5O A;  3BPV A;  4A3D J;  1VZ0 A;  5HLI A;  3GX4 X;  3HYQ A;  2L7F P;  2ESH A;  4NC7 A;  3SFI A;  5LEK A;  1O4X A;  2R7S A;  1LUJ B;  2HQN A;  5L3G A;  2X6Y A;  1IN6 A;  2XSD C;  2WV0 A;  3MAJ A;  2ZXI A;  3CO7 C;  5HLH A;  3FJY A;  4LJZ F;  3R03 A;  2HS5 A;  3F8B A;  5CJ9 A;  1A6I A;  4G94 A;  4UUS B;  3VOE A;  3RZD J;  2HVS A;  4M3B A;  4PJM A;  5LPG A;  2HZD A;  2BZT A;  2JZY A;  4L9V A;  2PX9 A;  5KK1 A;  5ANV A;  5CFI A;  3W3C A;  1YIO A;  1P2F A;  2BHY A;  2E2H J;  1MDM A;  2VKV A;  1XDS A;  3M8J A;  3CJT B;  2X51 A;  2ZFU A;  3DBH B;  1E3H A;  4XLH A;  1O3Q A;  5M3F J;  1WVR A;  3CJN A;  1YTY A;  4BXU A;  1K61 A;  3VSL A;  3FKJ A;  3GLX A;  2CFO A;  1R6R A;  3RKY A;  2B2K A;  1RKT A;  2A5Y B;  3KIO A;  1HLV A;  4YEJ A;  2RRK A;  2A8Q A;  2JA5 J;  4N4O B;  5GHJ A;  2VKE A;  4DYC A;  1ZLK A;  2CG4 A;  4ENK A;  5ILV A;  3OYM A;  3W2W A;  5M3M J;  2Y2Z A;  1V8U A;  1XN7 A;  2H6C A;  1E17 A;  4D1Q A;  3DPL C;  2M2E A;  2HOA A;  4J19 A;  4Y13 A;  1NFZ A;  2YYH A;  2V1D A;  2LMD A;  3OYD A;  3M1E A;  1ZK8 A;  3OSF A;  3S2D J;  1IRG A;  2LOO A;  4KYX A;  4XKV A;  2KIF A;  3CCU I;  2IS4 A;  3F9K A;  4M6V A;  5IYC J;  4C2U A;  2HDC A;  1OCZ H;  6PAX A;  1NTC A;  5E3N A;  5J8C A;  1V3F A;  2Y69 H;  3K70 D;  5GAD J;  1MR2 A;  1S3J A;  5C3E J;  1S9H A;  1FOW A;  2NAZ A;  3CMM A;  1QRY A;  1OYI A;  3HHG A;  2ZO4 A;  2AS5 F;  4DZP A;  2PMZ A;  2CUE A;  3GWZ A;  3FMS A;  1USS A;  1G0S A;  2HOT A;  1XSV A;  1QPM A;  2PQ8 A;  2NS7 A;  2FD5 A;  2GBY A;  3QOE A;  2DN0 A;  5J1Y A;  2VC1 A;  4EGZ A;  4IRI A;  2AZW A;  2G73 A;  5D5X B;  4C9X A;  1NH3 A;  1GHC A;  4C3I J;  5FKL A;  3WE3 A;  4M72 A;  1H8A C;  1AHD P;  4A3L J;  3GWY A;  4EVI A;  2MW8 A;  1S72 I;  1U0J A;  3FMQ A;  1MNM C;  5JLW A;  1R23 A;  3JRC A;  2PMU A;  1T08 B;  1B1B A;  2OPT A;  4F91 B;  3AFH A;  5ED4 A;  1KQ0 A;  4PCQ A;  1X3Z B;  3HOU J;  4IXA A;  3JR9 A;  2BXZ A;  5DUK A;  4L5J A;  2EA4 A;  1DGR M;  4CSW A;  2XPW A;  5AIP A;  4XLN F;  1Z3Y A;  4XRM A;  1VQP I;  2LSO A;  3H92 A;  4RDU A;  1IAW A;  3O6Z A;  1ZKG A;  1R5H A;  1QPI A;  2PI0 A;  3K0L A;  5TIS C;  4KG4 A;  4LK1 F;  3V7C A;  4CA0 A;  1TW3 A;  2D1V A;  5D4S A;  2PLY A;  2EFO A;  3KP3 A;  1EH7 A;  1OCO H;  3LAJ A;  1X19 A;  1WCM J;  3ZQH A;  1HKQ A;  4AU7 A;  2KIQ A;  1IXC A;  3VFZ A;  2B9S A;  2BBY A;  3MEX A;  2CFX A;  4EEF G;  4Q5S F;  2AHQ A;  1BW5 A;  2X6O A;  3FHZ A;  2VBW A;  5HLT A;  9ANT A;  2HI3 A;  5C8L A;  4G12 A;  1RRQ A;  1R1V A;  1PUF B;  3BOQ A;  1LKX A;  4RB1 A;  1QU3 A;  3DWL E;  3OWT A;  1IN4 A;  1P9Q C;  3FHN A;  4A3J J;  1WHU A;  4OOI A;  1SFU A;  1P92 A;  2COB A;  3C2B A;  3DKW A;  4M3F A;  3GG6 A;  4IHX A;  1OLT A;  5CYV A;  2DDB A;  3H9Q A;  1J59 A;  1XMA A;  2XAQ A;  2OBP A;  4HF2 A;  3M3Y J;  1IRZ A;  5ILU A;  1VK6 A;  3RQI A;  4EQQ A;  3M8F A;  3SON A;  1WI9 A;  5FLX K;  1XB4 A;  4ZTJ A;  3K2A A;  1W0T A;  1BC7 C;  1JKN A;  4GYG A;  2R5Y B;  1O7F A;  4BH9 A;  1J9I A;  3CC7 I;  2WV1 A;  4XKB A;  4CUG A;  4BQO A;  3L2Q A;  1VFC A;  4DBQ A;  2NOG A;  3WTZ A;  1D0Y A;  2M8E A;  2QZ8 A;  3A6S A;  2LF8 A;  1Z1D A;  3X0L A;  4IKF A;  2K9L A;  2W82 A;  4PZJ A;  1K2E A;  4IHY A;  1BC8 C;  3AG4 H;  4HQE A;  2K4B A;  1KQ8 A;  5EJC A;  1JKO C;  2Q1Z B;  4MFE A;  3X0S A;  5C4J J;  3CES A;  2VE8 A;  1MGT A;  4PFP A;  3GZN B;  3CMY A;  1T98 A;  2R93 J;  4RB3 C;  2F4I A;  1R36 A;  3DCF A;  1QNT A;  3BJA A;  4S04 A;  5D8K B;  1MSF C;  3HDD A;  3DUP A;  4G9Y A;  2XB5 A;  2KRF A;  2XGX A;  4WCG A;  4CGZ A;  1A35 A;  2ZNZ A;  1ETQ A;  1NHA A;  2WY7 Q;  1XSB A;  3ONQ A;  2VQG A;  2Q8K A;  2V9V A;  5DCM B;  5EZG A;  1H88 C;  2CQ7 A;  3X2Q H;  2LRD A;  5F27 A;  4BY1 J;  3I4M J;  3G1L A;  2F5C A;  3BZC A;  2IGM A;  3KYL A;  1OJL A;  1YS6 A;  4RLQ A;  1VQ6 I;  2QKM B;  4EM1 A;  3S17 J;  4OIR F;  3K70 C;  2X6W A;  3SQN A;  1R67 A;  2LY2 A;  2OCE A;  2MH2 A;  3CCR I;  2ZJ2 A;  4P1W A;  1TWH J;  2HYJ A;  2MLG A;  5E1Z B;  3KX2 A;  5EF6 A;  4U7B A;  2GOX B;  2HKO A;  3QOP A;  1PDN C;  3EYI A;  2D5V A;  2QJT A;  2F4O B;  1V4R A;  3RTR A;  4EAT A;  5FD6 A;  3HEF A;  3IKV A;  1LPQ A;  4NDL A;  4BHC A;  3VWB A;  1V54 H;  2X48 A;  2I6K A;  3F6A A;  1XSX A;  3H35 A;  5FSL A;  2QVO A;  3L85 A;  3DBR B;  2XGC A;  2DA7 A;  3L9F A;  2FMY A;  2M7B A;  1JTX A;  1A36 A;  3OYE A;  2VB6 A;  4XKW A;  5CVI A;  5B1A H;  3QU6 A;  3CCS I;  1JUS A;  3I53 A;  1XSC A;  1YYV A;  3BAP A;  1U3E M;  3DEW A;  1TWF J;  2OQR A;  3LQQ A;  4RGS A;  1UHW A;  4ZG0 A;  2OQG A;  2NNN A;  1IV6 A;  2P7V B;  1XMK A;  2COM A;  4B44 A;  4JZS A;  1LFP A;  1ZGW A;  2VQC A;  1BJA A;  5ICC A;  3LNQ A;  4Z2Y A;  2O5R A;  1XD7 A;  1TTY A;  1VND A;  1H9G A;  2ADU A;  5J4V A;  2DT6 A;  1GUU A;  3AG1 H;  1I3Q J;  5JLX A;  3P5J A;  2UWM A;  2KJB A;  4OMY A;  2V9P A;  4CZZ A;  2IGO A;  5E3O A;  1K7A A;  3SHF A;  3F8N A;  3KEQ A;  4IHT A;  1YQA A;  2R7X A;  1WJA A;  4FET A;  1X1D A;  3T1B A;  2HWV A;  3EEU A;  2ESN A;  4PDK A;  2E36 A;  5L3D A;  4D9J A;  1SFK A;  3OV8 A;  5J4Y A;  2ECB A;  1U5T A;  4RGR A;  4O3M A;  1JJ8 C;  3H3Z A;  1YOV B;  1R49 A;  3I7U A;  4A3I J;  1T8I A;  2FOK A;  2LR8 A;  4HAM A;  3A4C A;  4IOA F;  1GA7 A;  1FSE A;  4CCO A;  1JGS A;  2KMU A;  4CHU A;  4HX7 A;  2BYV E;  3K4N A;  5F6F A;  1OW2 A;  1OYY A;  4KTB A;  4XOP A;  5M5X J;  2CH0 A;  1UG0 A;  4FT8 A;  1IF1 A;  2VUM J;  5IW5 A;  3HXL A;  5DEQ A;  3ZN1 A;  1MQE A;  3ID9 A;  1L0O C;  2YPR A;  3GFL A;  4NC6 A;  2O5F A;  3I4P A;  3LWF A;  1BOB A;  1X84 A;  2VKD A;  3D1N I;  2EFQ A;  3BY6 A;  3K7A J;  4CIC A;  3A6V A;  2O8X A;  1KU2 A;  3A6T A;  4YOQ A;  2YVM A;  3ZQF A;  1R5G A;  1V5E A;  3L00 A;  2ZME A;  4OIO F;  3O61 A;  1DU6 A;  5C4X J;  4BEH A;  3O8S A;  4RMN A;  2P4W A;  1QHG A;  5J8F A;  3ULQ B;  2OAZ A;  3TL4 X;  3R61 A;  2DA4 A;  3OGA A;  3SZG A;  5K5Q A;  1YIT I;  3X0R A;  4MHG A;  3HSR A;  1JT0 A;  2PFB A;  4M9Z A;  2HZT A;  4HPQ A;  1ZG3 A;  4Y3O A;  4CYC B;  5D6E A;  1ZR4 A;  4RB0 A;  3WOD F;  4NFX A;  1RR8 C;  5LGU A;  1X2N A;  2MAB A;  3M4O J;  1SC7 A;  2DCE A;  4FE4 A;  4FE7 A;  4NHJ A;  2XVC A;  3CUQ B;  2QJO A;  5LRR A;  4HEA 2;  1ENH A;  4F92 B;  2L5Q A;  2L7Z A;  1TT5 B;  3FCM A;  3U1D A;  4RBO A;  2A6T A;  2VBY A;  1Q1V A;  4ON0 A;  1BR2 A;  1UB9 A;  2EK5 A;  4YPH A;  1TLH B;  4FAS D;  1V8S A;  1I3A A;  1NG7 A;  1IO2 A;  2HOE A;  3WTV C;  1QZY A;  1TW2 A;  3K1N A;  3KPH A;  1E2X A;  1POG A;  2A3S A;  2E7X A;  3V8L A;  1XSD A;  1FX7 A;  1HST A;  1U20 A;  1K6Y A;  5GHQ A;  2OUM A;  2GB5 A;  3D5R C;  4LOC A;  1RNL A;  1V5G A;  1X1P A;  2R7V A;  2RKH A;  5D4R A;  3CCQ I;  2VOO A;  2A61 A;  3T0Y A;  4D7M A;  1F9N A;  4G8X A;  1V5F A;  3H5A A;  1IJW C;  1ULY A;  3BR6 A;  2AQF A;  3FXU A;  4XOT A;  1XCV A;  1HDP A;  2PG4 A;  2W25 A;  3A6U A;  2M30 A;  3EYY A;  2ID6 A;  4N4N B;  3ZP5 A;  4G7H F;  5IY5 H;  2Z2S B;  3JAM K;  2UXX A;  1FOY A;  1G8X A;  1HDD C;  3JRE A;  3FXR A;  4LFU A;  4A6E A;  2XSJ C;  3CCV I;  3O52 A;  1S5L C;  2G7U A;  1MJB A;  3SFZ A;  3CC2 I;  2CGP A;  1UST A;  2BHZ A;  1W0U A;  3BJ6 A;  2Z9O A;  5F64 A;  3ZQI A;  5HLG A;  5ANT A;  3L7W A;  3BCB A;  1QVT A;  3A1Y A;  1ZGA A;  2XAF A;  2F5E A;  3R0A A;  1D8K A;  2HYG D;  4DJA A;  3FBN B;  4ZYD A;  1MH4 A;  3D5L A;  2VOP A;  2QGU A;  2XRO A;  1PP8 F;  4L5I A;  4O5V A;  1VRL A;  2DTR A;  1XC5 A;  3A03 A;  4N0B A;  3OYJ A;  2FU4 A;  4KIB A;  4YIF A;  4YRV A;  3E6D A;  5CKT A;  1YRN A;  2FNP A;  3H9J A;  1VQK I;  1BI2 A;  4HBL A;  1ETW A;  3PQJ A;  4MEY F;  2X6X A;  2M0M A;  2GZW A;  3QYB A;  2F6C A;  2WAF A;  5HS7 A;  2GA2 A;  1ZRC A;  5GHI A;  5EG0 B;  2HEO A;  1AA7 A;  4I76 A;  1K79 A;  2DTZ A;  4FX0 A;  1VQ7 I;  1QGP A;  4W97 A;  1IV8 A;  4ICK A;  2ME0 A;  3Q2T A;  1I1G A;  2WA0 A;  3BQZ A;  3K1P A;  2E1O A;  4B8X A;  2HDD A;  3IAM 2;  1J7K A;  1JHH A;  2KRH A;  3J80 K;  2QBY B;  3GTL J;  3S16 J;  1MMG A;  5FD5 A;  2GWR A;  1U8B A;  5H2F C;  5CQE A;  2DMQ A;  1FYL A;  4HG2 A;  2R7O A;  2ELK A;  3MN2 A;  5D5V B;  1YFH A;  2P5L C;  2B63 J;  3KET A;  1ZAR A;  4XR6 A;  3GTP J;  2MSY A;  3A02 A;  3WU2 C;  2MD5 A;  2LK2 A;  1O7L A;  3EQL F;  2HVQ A;  3S3O A;  5B5E C;  5AON A;  4HZF A;  3FKI J;  2E2J J;  3QYF A;  4RAZ A;  3HC7 A;  5GHN A;  1JXS A;  1SD7 A;  3HOX J;  2MA3 A;  3R4K A;  2PN6 A;  2DK8 A;  3BZK A;  4Y4R A;  5ILS A;  4IRH A;  3CLQ A;  3QPH A;  1QBJ A;  4XSX F;  5FKK A;  1ZGJ A;  3C18 A;  3ZOB A;  2XAG A;  2XPV A;  1VIU A;  3FK7 A;  3H95 A;  3HRM A;  4OAZ A;  2Z3Y A;  4KDP A;  2K9N A;  1LQ1 A;  4XN3 A;  3PFY A;  2JVB A;  1IZ1 A;  4X1E A;  4S05 A;  4BE1 A;  1OMI A;  5HNH A;  3G0Q A;  2BY3 A;  1Y6I A;  5H20 A;  1OQY A;  2XRL A;  1VIQ A;  2RNJ A;  3Q0W A;  2R7R A;  3CO6 C;  1KHZ A;  3OYK A;  3JRG A;  2GXB A;  3KCC A;  4PJ0 C;  3ROU A;  3J7Z I;  4UVB A;  5DD4 A;  2MH9 A;  3CMA I;  2DYR H;  1T6S A;  4FQG A;  5HDG A;  1L3L A;  1KT9 A;  5GHM A;  3I64 A;  4ASN A;  2DJI A;  1YW7 A;  1LJ9 A;  2BVL A;  3DXJ F;  3HYI A;  4IQ4 A;  4HDU A;  4JOM A;  2IA1 A;  3LL7 A;  5E79 C;  4X0G A;  3ABL H;  3QRF F;  1MBJ A;  4R79 A;  1MJ9 A;  3PIP F;  4OIQ F;  5ISY A;  4WXD A;  2HKX A;  2L4A A;  4I6Z A;  2W24 A;  3QYE A;  4QSH A;  5FO5 A;  2YU3 A;  1YIJ I;  3CP8 A;  2CQK A;  1WJD A;  1X4P A;  2I8D A;  3ECO A;  5CPR B;  1JKP C;  4MFD A;  1K26 A;  4B48 A;  1NG6 A;  2CQQ A;  1Z7L A;  1OR7 A;  2EV6 A;  2HU9 A;  3GZ6 A;  2R7T A;  4C3J J;  3HUG B;  1OIS A;  3WU1 B;  1FMW A;  4UV9 A;  3ABK H;  3X0I A;  3OY9 A;  4AVZ A;  2JPC A;  1KGS A;  2LBF A;  4XK4 A;  2MLK A;  2O0Y A;  4BKX A;  3E0J B;  1RZ4 A;  3Q1P A;  3HM5 A;  3BWG A;  3Q9S A;  2ECC A;  2G0E A;  4H0E A;  2VIX A;  1D1C A;  4S2W A;  1MBH A;  3KE2 A;  3E6B A;  2NNY A;  2XRN A;  2WBM A;  1OCP A;  3CNG A;  3KVH A;  4XRS G;  2M45 A;  3HIF A;  1FC3 A;  2VJ5 A;  4L5E A;  4JK1 X;  1ON2 A;  5K5R A;  2ICW G;  3L2V A;  2A8P A;  2VL8 A;  3FK9 A;  3HHH A;  5A2Q Z;  4XKC A;  1KYZ A;  3IRR A;  3H3V K;  4LG0 B;  1R71 A;  1W7P A;  3JRB A;  2E5Z A;  3PNV A;  1IXS B;  2QSF X;  3IC7 A;  4OIP F;  4BE2 A;  1PJR A;  4RB2 C;  1V8N A;  4XLE A;  2UZK A;  3MZH A;  2IS2 A;  5JHF A;  4KA4 A;  4XLF A;  5DD8 A;  1JI8 A;  2XHK A;  3SZP A;  2FOW A;  3Q0U A;  2CRG A;  4MTD A;  1W4M A;  3OYF A;  3ZN0 A;  2KIS A;  1AWC A;  2A5W A;  4G6D A;  1P7I A;  2MYS A;  3HBL A;  1LE8 A;  2JUC A;  1FTT A;  1VI0 A;  4HA8 A;  3I9X A;  2ZCW A;  3I56 I;  4B3A A;  1AKH A;  1EH6 A;  1TNT A;  1FYK A;  1MBF A;  3G3Z A;  4XOR A;  2KHM A;  1WSU A;  2FX0 A;  4XL9 A;  4R1H A;  1FWZ A;  2EWN A;  2IA2 A;  3QPL A;  5HOD A;  1WH5 A;  3UKG A;  1X51 A;  3WTT C;  1Z3X A;  2QSG X;  3K4J A;  4I7H A;  4PFO A;  1PUQ A;  2HNH A;  3MMY B;  2E2I J;  1S29 A;  1RRS A;  2CUZ A;  1Y8R B;  1MIJ A;  2RC4 A;  4U87 A;  1WPK A;  5H6Q A;  3CD6 I;  1ZRD A;  3MCF A;  2DMT A;  1MDM B;  4I0B A;  2EIJ H;  4LLN A;  3E97 A;  2CJJ A;  4V2G A;  2CQX A;  2DSB A;  3F23 A;  1Y1V J;  4ZDL A;  3K69 A;  2XGE A;  4E7S A;  1UFM A;  4BNC A;  2I10 A;  1DPR A;  1IG7 A;  4HNT A;  5F08 A;  2CS3 A;  2KDZ A;  1VQO I;  4CCJ A;  1XTA A;  3P9I A;  1G59 A;  4P96 A;  4B1R A;  4N1U A;  4BBS J;  3OIQ A;  2M7A A;  2XB0 X;  2DOF A;  2K86 A;  3EPZ A;  4BQN A;  2JPB A;  4ANJ A;  4CDG A;  1VHG A;  3OSG A;  4ENM A;  2HQA A;  1X1B A;  3J81 Z;  3FZV A;  3WTW C;  4ZH4 F;  2R4G A;  3S1M J;  4XN0 A;  1UHS A;  3VPR A;  5J6X A;  1PVE A;  4KIC A;  2K3F A;  2Y9Z A;  5J40 A;  4CO8 A;  4ESF A;  2FML A;  2Z16 A;  1K4S A;  3EUK L;  2K9S A;  1RIO H;  1J0R A;  1F4K A;  3VB2 A;  4YII A;  2M8G X;  1NK2 P;  5AIQ A;  3HOS A;  2GXG A;  3ABU A;  1MBG A;  3GZ5 A;  4BHB A;  3S93 A;  3G1M A;  2VXZ A;  2MGQ A;  3J7A Y;  5IT9 Z;  2YX7 A;  4NNJ A;  5FGM A;  3WG9 A;  1MD0 A;  2IGK A;  4IPA A;  1XGM A;  3TO7 A;  3GO5 A;  4H4K C;  2ELJ A;  2XV4 S;  4E7J A;  1JGG A;  4IHS A;  1U5T C;  2JRT A;  2A07 F;  3OS2 A;  3GFJ A;  4UVA A;  2LTP A;  2R92 J;  4F3Q A;  2CW7 A;  5IP7 J;  3E1S A;  2W57 A;  2VC0 A;  3GME A;  3ZMZ A;  3HTS B;  2DDA A;  2M9H A;  5F1J A;  1Z9C A;  1MMA A;  4JX4 A;  5FFX A;  3KLN A;  2A69 F;  2O1C A;  3KP6 A;  2CYY A;  4Y52 J;  2XC7 A;  2P0W A;  4A5M A;  2F2E A;  3VYS B;  5K1Y A;  2QLZ A;  2XSQ A;  1OCR H;  1WKM A;  3HKZ A;  3R0J A;  3VOD A;  5FLV A;  2R5Z A;  2QKL B;  3SDG A;  1BM9 A;  4N9I A;  2FSW A;  4AM3 A;  3RCO A;  2ZME C;  3I59 B;  4AWX B;  3LSP A;  2E1M C;  4J00 A;  3S3M A;  2OTJ I;  5LHI A;  2MFZ A;  4M3E A;  5GP9 A;  2A6H F;  4C2T A;  5FSK A;  5FSM A;  3HG9 A;  3S2H J;  4HST A;  3RPU D;  3GEZ A;  3L09 A;  3BP8 A;  2XAH A;  4IO9 F;  4N9H A;  3TOB A;  3AKZ A;  3BTJ A;  1D5Y A;  1GLN A;  4RA2 A;  1YW9 A;  1R1T A;  2X1C A;  5ICG A;  3H0D A;  4X6A J;  4ZYG A;  3H1C A;  2E60 A;  4DBR A;  3GF2 A;  3GLL A;  5LGN A;  1VQ5 I;  2ZJP F;  1B4A A;  2P81 A;  2RV8 A;  2L0K A;  1TNS A;  4Y7N J;  2L7K A;  4JQF A;  4L0Z B;  3FWE A;  3B6A A;  1QVU A;  2CSO A; 
#chains in the Genus database with same CATH homology
 5KHD A;  3EUA A;  4KTB A;  4XOP A;  2KDV A;  2CH0 A;  1UG0 A;  3OYL A;  3P5T A;  4XMY A;  3WHW A;  1DP3 A;  5IW5 A;  3HXL A;  5DEQ A;  4K6E A;  1MQE A;  3ID9 A;  2W1O A;  2XDV A;  3U21 A;  2AQE A;  3CZ6 A;  2O5F A;  4E7H A;  2X85 A;  2F5V A;  1BOB A;  1ERD A;  1X84 A;  2VKD A;  3K4C A;  3D5S C;  1SZ3 A;  3A6V A;  1F3Y A;  3A6T A;  4YOQ A;  5KNL A;  4LIU A;  2YVM A;  1TZL A;  1NQY A;  2FKB A;  1V5E A;  3O61 A;  2XF7 A;  4PJL A;  4CCM A;  2CV1 A;  4XLC A;  4BEH A;  1EA3 A;  3EUH C;  5I8U A;  3O8S A;  3OR1 C;  4RMN A;  5HVQ C;  1QHG A;  2BW3 B;  2ZSH B;  3TL4 X;  2KZV A;  5ANS A;  3CF2 A;  2W4S A;  3H5N A;  3LSK A;  3OGA A;  3X0J A;  3LSH A;  3SZG A;  2HPM A;  1FMV A;  3X0R A;  2WAE A;  2IS1 A;  1KON A;  2VLA A;  3BG7 A;  1Q27 A;  4HPQ A;  2B06 A;  4Y3O A;  2Q2E B;  4OAY A;  4NFX A;  3W2A A;  2KL4 A;  3BLY A;  3MKZ A;  3SMD A;  3PNT A;  2NOJ B;  3VYU B;  2MAB A;  3OL3 A;  2DCE A;  1WJB A;  2HDW A;  1IRX A;  1N78 A;  1HZT A;  3U53 A;  3DU6 A;  3J7Y e;  1V8M A;  2QJO A;  3LFU A;  1T0F C;  4HEA 2;  5FRO A;  3DQV C;  4F92 B;  2L5Q A;  1D1A A;  3FCM A;  4YPH A;  2A6T A;  3QOD A;  3OYN A;  3TMO A;  1BR2 A;  1I9A A;  4S2Y A;  2K5C A;  3LSG A;  3SDB A;  4FAS D;  1V8S A;  1NG7 A;  3BHO A;  4ZJZ A;  3EES A;  1X4O A;  2CW8 A;  3DTE A;  3FSP A;  2MD0 A;  3RQ4 A;  2PJR A;  1G9Q A;  1VCD A;  2WAD A;  1U20 A;  1K6Y A;  2R7U A;  5GHQ A;  2OUM A;  2DSD A;  3D5R C;  2GB5 A;  5LD2 C;  3X0Q A;  1V5G A;  2W00 A;  1N77 A;  4KIS A;  1X1C A;  2R7V A;  3M1C A;  2CUJ A;  3GBG A;  2KQR A;  1TT0 A;  2R7W A;  4BGD A;  1V5F A;  3H5A A;  4BDZ A;  4KG3 A;  4DYW A;  3SYT A;  2KRC A;  3ZR8 X;  2AQF A;  3LSM A;  4XOT A;  3ZR0 A;  4DOZ A;  2CV0 A;  4ZDO A;  3OR2 C;  3A6U A;  4B3X A;  4S2X A;  3AL0 B;  3SEQ A;  4N4N B;  2Z2S B;  2VNQ A;  1G8X A;  1UAA A;  1QVJ A;  4HVY A;  2XSJ C;  1VC9 A;  4C30 A;  3FFU A;  3O52 A;  4JZV A;  4JZU A;  4F55 A;  2DHO A;  4PJN A;  3E57 A;  3Q4I A;  3HL2 A;  5ANT A;  2V7F A;  3DLA A;  1PVF A;  3V42 A;  1MP2 A;  3BCB A;  2VPL A;  1V8V A;  3A1Y A;  2VJJ A;  4IQJ A;  4PSX A;  3PNY A;  2XAU A;  4BU2 A;  1VC8 A;  2O5W A;  5CQG A;  4DJA A;  3FBN B;  4KIT B;  3N77 A;  2VXD A;  3D5L A;  3OYH A;  5FSI A;  2HPI A;  2CZR A;  5GHO A;  1VRL A;  2VQL A;  3A2K A;  2V6E A;  3OYJ A;  4HFQ A;  3DKY A;  3DU5 A;  2JSP A;  2LY1 A;  3ZQQ A;  4YRV A;  3MKY B;  4QPO A;  1PUN A;  2R7Q A;  3S8P A;  5CKT A;  1WFX A;  5FSO A;  2ICJ A;  2JVH A;  1E0E A;  1Q54 A;  3IUO A;  3H9G A;  3H9J A;  2ICK A;  2XF5 A;  1D1B A;  3PL8 A;  2CL3 A;  5GHP A;  4ZDP A;  3OYI A;  2X6X A;  2M0M A;  4AYB A;  2OV7 A;  2F6C A;  2WAF A;  3QYB A;  5GHI A;  3K4L A;  3S32 A;  4C9Y A;  1AA7 A;  3IP4 B;  3DTI A;  4PJJ A;  1VZ0 A;  3HYQ A;  2RNG A;  5BON A;  4NC7 A;  3HHJ A;  4ICK A;  2RQQ A;  1IRY A;  2GT2 A;  2R7S A;  2VNP A;  4OWR B;  3Q2T A;  2WA0 A;  2X6Y A;  2X1E A;  3COU A;  4LIT A;  1X1A A;  2ZXI A;  3IAM 2;  3FJY A;  3K4B A;  2KRH A;  4PK4 A;  1MMG A;  2LH9 A;  2HVS A;  1PPW A;  4PJM A;  5LPG A;  5CQE A;  2HZD A;  1MMN A;  3Q2S A;  1PYV A;  2UUZ A;  4HG2 A;  2R7O A;  2DT7 B;  3F13 A;  5ANV A;  3G2B A;  5CFI A;  3W3C A;  3NWT A;  3BG6 A;  4BE0 A;  3M8J A;  3L2W A;  3EXQ A;  3HPH A;  3GZ8 A;  2X51 A;  5KCM A;  2ZFU A;  1MND A;  4XR6 A;  2BVM A;  4XLH A;  3I7V A;  3OS0 A;  3VSL A;  2LC2 A;  3FKJ A;  3VDX A;  2CFO A;  1R6R A;  2B2K A;  3VYT B;  2HVQ A;  5LFA A;  4YEJ A;  2RRK A;  2A8Q A;  3S3O A;  2DSC A;  4BJ6 C;  4N4O B;  5GHJ A;  2Z1D A;  4V14 A;  3QYF A;  3OYG A;  2E1M B;  4LIV A;  3HC7 A;  3OYM A;  3W2W A;  4BL0 B;  5GHN A;  4BEH B;  3QSJ A;  1V8U A;  4Y4R A;  4F93 B;  3ZGK A;  4D1Q A;  5DPK A;  1V8Y A;  3DPL C;  3ACA A;  3ZCO A;  1NFZ A;  2YYH A;  4XNF A;  2CMP A;  4XON A;  4MPO A;  2G74 A;  2OC6 A;  1VIU A;  3H95 A;  3DTK A;  4IJX A;  3CP2 A;  4OAZ A;  3OYD A;  1D0Z A;  4JZT A;  3PJR A;  4XN3 A;  3PFY A;  1QHH D;  2JVB A;  2LOO A;  4J7H A;  1OR7 C;  4XKV A;  4KYX A;  2IS4 A;  3F9K A;  1NQZ A;  4BE1 A;  4C2U A;  4XQF A;  1WJE A;  2B0V A;  5HNH A;  1V8I A;  3G0Q A;  2WY8 Q;  4J01 A;  1Y6I A;  1VIQ A;  4YEL A;  3K70 D;  2R7R A;  1MNE A;  1MR2 A;  5ANW A;  2KDW A;  4CCK A;  1KHZ A;  2YVO A;  1S9H A;  3OYK A;  1HA8 A;  5TGT A;  2R5W A;  3CMM A;  2K3P A;  5DD4 A;  3OIP A;  3BC8 A;  2PMZ A;  2V4J C;  3S3N A;  1KT9 A;  5GHM A;  3PSF A;  1G0S A;  2DJI A;  5FRM A;  4BS9 A;  3Q93 A;  2BVL A;  2VJ4 A;  4F52 A;  1SU2 A;  4IQ4 A;  4NC8 A;  1WJC A;  3QOE A;  2LG4 A;  3LL7 A;  4JOM A;  2PJR B;  2AZW A;  2G73 A;  3SEZ A;  4X0G A;  5DDG A;  4C9X A;  4RM3 A;  4R79 A;  1X83 A;  3DKU A;  5ISY A;  3GWY A;  3W2V A;  1KTG A;  3CJQ B;  3QYE A;  1U0J A;  3DEE A;  2L9S A;  1MUT A;  2YVP A;  3CP8 A;  2KP6 A;  1WJD A;  1X4P A;  2E5N A;  2I8D A;  3AFH A;  4PSW A;  5CPR B;  4F91 B;  3OYB A;  3DKX A;  1YE9 A;  4BQQ A;  3ZXS A;  3VSK A;  1K26 A;  4B48 A;  1NG6 A;  1Z7L A;  2HU9 A;  2I8T A;  3GZ6 A;  3MD2 A;  2R7T A;  5C7T A;  1DGR M;  4CSW A;  3HUG B;  3CJR B;  2PQV A;  2YVN A;  1FMW A;  2M4K A;  3I9V 2;  3X0I A;  1Z3Y A;  3OY9 A;  4AVZ A;  3O6Z A;  3N9U A;  2LBF A;  2DOA A;  4XM3 A;  3FBI B;  4MLO A;  4E7I A;  2V1N A;  3E0J B;  4KG4 A;  2LRE A;  4CA0 A;  3Q1P A;  5IW4 A;  1TUM A;  1Z21 A;  3X0P A;  1HX3 A;  2VIX A;  1D1C A;  4S2W A;  2Q9P A;  2WBM A;  1X19 A;  1V8L A;  3CNG A;  3KVH A;  3K10 A;  3OYC A;  4AU7 A;  3DPT A;  3H5R A;  2A8T A;  2K9M A;  1VHZ A;  3C2G A;  2VJ5 A;  2MC4 A;  4N1T A;  2A8S A;  3P6Y A;  3L2V A;  4G6T B;  2M3A A;  3OOU A;  4LG3 A;  2A8P A;  2VL8 A;  5HNF A;  3FK9 A;  5HLT A;  5C8L A;  4XKC A;  2FVV A;  3AC9 A;  3RH7 A;  1RYA A;  1RRQ A;  2E5Z A;  3PNV A;  1DGW Y;  1LKX A;  3L2U A;  1QU3 A;  3OYA A;  2LYC A;  3DWL E;  3OWT A;  1SOI A;  1P9Q C;  3RSN A;  1PJR A;  3FHN A;  3K4K A;  4BE2 A;  1V8N A;  4II3 A;  4XLE A;  2IS2 A;  5JHF A;  3GRN A;  4XLF A;  3BM4 A;  1DQU A;  3TBI A;  3GG6 A;  1JI8 A;  1OLT A;  1BR4 A;  5FRN A;  3OMY A;  3H9Q A;  3MDI A;  4CH7 A;  4BDY A;  4KJZ A;  3OYF A;  2A5W A;  2BW3 A;  4CZC A;  3UNG C;  1VK6 A;  2MYS A;  3SON A;  3OL4 A;  1LDK B;  2RRE A;  3I9X A;  4ZTJ A;  1JKN A;  2GOM A;  2J8Q A;  3K6G A;  4E7Z A;  4XOR A;  2KHM A;  2JVG A;  3AL0 C;  4XKB A;  4XL9 A;  4BQO A;  4CUG A;  2W7N A;  3L2Q A;  2PNY A;  1UEL B;  2ZSI B;  4DBQ A;  1XSA A;  2Y0S A;  1Y56 A;  2ZXH A;  3UR3 C;  2WB1 A;  1X51 A;  1D0Y A;  1Z3X A;  3K4J A;  4DGW B;  3A6S A;  4PFO A;  1PUQ A;  4DIQ A;  3X0L A;  1MW7 A;  4IKF A;  2K9L A;  2HNH A;  3MMY B;  3L2R A;  1RRS A;  2CUZ A;  2W82 A;  1K2E A;  4E7K A;  4U87 A;  3MCF A;  4PUS A;  1MK1 A;  4ZTF A;  2DSB A;  2X1D A;  4ZYA A;  1PPV A;  2Q1Z B;  3X0S A;  4ZDL A;  4C9W A;  3CES A;  4E7S A;  5CFJ A;  3Q91 A;  1J09 A;  4PFP A;  3MDG A;  4BJ5 C;  2A8R A;  4HNT A;  3VYR B;  2CS3 A;  2F4I A;  3DUP A;  4HSR A;  2VJI A;  2V26 A;  2FUG 2;  4CCJ A;  2DXI A;  2DUK A;  1G59 A;  4BJT A;  1SJY A;  1D0X A;  2UV1 A;  4P5O A;  3HPG A;  1XSB A;  2WY7 Q;  3R03 A;  3OIQ A;  3ONQ A;  2VQH A;  2VQG A;  4N1U A;  2M7A A;  4B43 A;  3X0M A;  4E6K G;  3EPZ A;  4BQN A;  4ANJ A;  1VHG A;  2LRD A;  3KEY A;  4RM2 A;  3N05 A;  4ILQ A;  2HQA A;  3LMM A;  1X1B A;  2IGM A;  2W4E A;  2R4G A;  2VAS A;  3KYL A;  4HRI A;  4XN0 A;  5HOO A;  3SHD A;  2KDO A;  2WAQ A;  4RLQ A;  2QKM B;  4BAC A;  4BUP A;  3K70 C;  1WJ5 A;  2X6W A;  1R67 A;  2LY2 A;  2FML A;  4GRI A;  2Z16 A;  4S2V A;  4NFW A;  3EUK L;  4YPR A;  4P1W A;  3K4M A;  2KLO A;  3BCA A;  1W36 D;  3OS1 A;  1YX5 A;  1V8W A;  4NUB A;  1BR1 A;  3HOS A;  2L9N A;  4IZZ A;  1V8T A;  3GZ5 A;  3S93 A;  3KX2 A;  1PUS A;  3HOT A;  2KPM A;  2VXZ A;  3EF5 A;  3J7A Y;  1T95 A;  2XF6 A;  4Y33 A;  4NNJ A;  2GOX B;  3IAS 2;  2IGN A;  4U7B A;  1W36 C;  2QJT A;  2IGK A;  3RTR A;  4EAT A;  3O69 A;  3ZR1 A;  3X0N A;  1WJF A;  4H4K C;  2ELJ A;  4E7J A;  3VWB A;  3PUB A;  4CCL A;  2I6K A;  3F6A A;  3H35 A;  5FSL A;  3OS2 A;  2IS6 A;  3L85 A;  4RLF A;  2CW7 A;  4F3Q A;  3E1S A;  1LVK A;  2M4G A;  1MQW A;  2M7B A;  3OYE A;  2VB6 A;  4XKW A;  1MMA A;  4B47 A;  4ITV A;  4E4H A;  1XSC A;  4II2 A;  2O1C A;  3BAP A;  2IXS A;  4HNU A;  3ZRG A;  4BXF A;  4ZG0 A;  4XLA A;  2XC7 A;  2P0W A;  2VKH A;  2HVR A;  3VYS B;  3MKW B;  1NFS A;  3X0O A;  2XSQ A;  4B44 A;  4IX7 A;  4KT6 A;  1V8R A;  4JZS A;  1LFP A;  1Q33 A;  3HKZ A;  2VQC A;  5FSN A;  2QKL B;  3NWS A;  1ZEL A;  1PPX A;  3RCO A;  4CCN A;  2E1M C;  1YX3 A;  2O5R A;  3FDY A;  4J00 A;  1SAU A;  3S3M A;  5C7Q A;  5HZX A;  2MFZ A;  2DT6 A;  4J7G A;  3C2H A;  4C2T A;  5FSK A;  3LSI A;  5FSM A;  3HG9 A;  2UWM A;  4ZC3 A;  4HST A;  3RPU D;  2IGO A;  2BOL A;  2R7X A;  1WJA A;  4FET A;  1X1D A;  5BS6 A;  3EEU A;  2LBF B;  2V9K A;  3AKZ A;  4D9J A;  1SFK A;  1GLN A;  3DPU A;  2I8U A;  4E7L A;  4QPQ A;  5ANU A;  2X1C A;  3H0D A;  2JUG A;  1N75 A;  2JA2 A;  2E60 A;  4DBR A;  3I7U A;  2L2O A;  4NQW B;  3I3L A;  3PSI A;  1JRK A;  3A4C A;  2L7K A;  1MMD A;  4JQF A;  4CCO A;  1GA7 A;  2KMU A;  2GT4 A;  3MGM A;  3K4N A;  3X0K A;  2CV2 A;  1OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...