2A6TA

Crystal structure of s.pombe mrna decapping enzyme dcp2p
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
245
structure length
230
Chain Sequence
MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFEISKIEWHNLMDLPTFKMKNKFYMVIPFLAPLKKWIKKRNIANNTTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein,hydrolase
molecule keywords SPAC19A8.12
publication title Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 63
structure length 230
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF05026 DCP2 Dcp2, box A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1050 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2a6tA01
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 2a6tA02
1SJYA 2O5WA 3FK9A 2PNYA 1VC9A 2YVOA 5DDGA 4MPOA 2FMLA 3O6ZA 3SONA 3FSPA 3EF5A 1U20A 1X51A 4NFXA 1V8YA 3I7UA 3O8SA 2VNPA 4ZG0A 2GB5A 5DEQA 1VCDA 3X0JA 5ANUA 1PVFA 4IJXA 5C7TA 2A8SA 2ICJA 4S2XA 4C9XA 1XSBA 1KT9A 1R67A 5IW5A 5ISYA 1VK6A 5IW4A 1MQWA 3MCFA 2CL3A 2AZWA 3R03A 4V14A 3MDIA 1PPXA 1Q54A 2KDVA 3ZR0A 4JZSA 1MQEA 1XSAA 1VIUA 2YYHA 3FFUA 5FSKA 3X0QA 2G73A 5CFJA 1MP2A 1Q27A 2DSBA 3A6TA 3BHOA 3F13A 2I8UA 1XSCA 2FKBA 2G74A 1V8WA 1NQZA 2I8TA 3I7VA 4KYXA 2VNQA 5FSMA 3SMDA 1VHGA 3EEUA 3N9UA 3X0IA 1VC8A 3ID9A 1G9QA 2RRKA 3GRNA 3WHWA 3KVHA 4HVYA 5GHJA 1HX3A 4K6EA 1K26A 5C7QA 5FSOA 3L85A 3X0OA 2QJOA 2ICKA 4NFWA 1KHZA 3MGMA 1SOIA 3ACAA 1VIQA 3H95A 5FSLA 1PUSA 4KTBA 1F3YA 3X0PA 5FSIA 1JRKA 1PUNA 2DSDA 3AC9A 3G0QA 5ANTA 1TUMA 2B0VA 1PUQA 1MK1A 2KDWA 3FCMA 1JKNA 3O69A 3Q4IA 1NFZA 2QKMB 2J8QA 3O52A 4HFQA 2B2KA 1PPVA 1V8IA 1VHZA 3O61A 5I8UA 1Q33A 2A8RA 1V8VA 5CFIA 2B06A 1RRSA 1V8SA 2A6TA 1V8MA 3DUPA 5FSNA 5LPGA 1K2EA 2QKLB 3I9XA 3N77A 4KG3A 5GHPA 5GHOA 3SHDA 1HZTA 3E57A 3GG6A 4JZUA 2Q9PA 1V8LA 4S2VA 2YVNA 3X0KA 4YPRA 3U53A 3P5TA 5ANWA 1I9AA 2QJTA 4S2YA 1GA7A 5C8LA 2O5FA 4DYWA 2XSQA 3BAPA 3BM4A 4S2WA 3ZR1A 2I6KA 3HYQA 1X83A 1V8TA 1X84A 2YVMA 3FJYA 3Q2SA 5GHIA 1QVJA 4C9WA 2DSCA 3A6VA 1RYAA 3GZ8A 1SZ3A 4ICKA 1MR2A 3RH7A 5ANVA 3EXQA 1V8NA 2GT2A 3Q91A 2A8PA 1PPWA 3A6SA 3Q1PA 3EESA 3GZ5A 2A8QA 3P6YA 2YVPA 5DD4A 3Q2TA 4N1TA 4KG4A 4JZTA 1IRYA 3Q93A 1OW2A 2DUKA 2FVVA 3GWYA 2PQVA 3F6AA 3A6UA 5ANSA 2A8TA 1G0SA 2DHOA 5GHMA 5GHQA 4ILQA 5HZXA 3J7Ye 3X0SA 1RRQA 3X0LA 1VRLA 2W4EA 3COUA 3X0RA 2GT4A 2R5WA 5DPKA 3X0NA 1MUTA 5GHNA 4YPHA 4N1UA 2O1CA 3OGAA 3X0MA 3GZ6A 3CNGA 3MDGA 1KTGA 1NFSA 3HHJA 5BS6A 5BONA 3DKUA 2JVBA 1NQYA 1V8UA 3QSJA 1V8RA 1SU2A 4JZVA 4YOQA
chains in the Genus database with same CATH superfamily
2O5WA 2NVXJ 1G3WA 2IVMA 2GA2A 2LLKA 3ABTA 1R23A 4KISA 2GBYA 3QOPA 4UV8A 4RB1A 4N4OB 1QPIA 4RLFA 5IT3A 3ECHA 3BR3A 2VKHA 2M4KA 1VI0A 4K2EA 5LGTA 4RMNA 2LG4A 3AG2H 4OMZA 5JVGF 2Z5UA 5DUKA 3ESWB 3R03A 5FFZA 1Q54A 3COAC 1OCOH 2M9HA 2HWVA 2FNAA 3DWLE 2HYJA 5JFRA 3GTQJ 2YYHA 1FBUA 2BY1A 5J47A 4ON0A 1ON1A 1WZ2A 5HLGA 1Z1DA 3I7VA 4G6TB 3BJAA 1DGRM 1O3QA 3PO3J 3S1MJ 3SMDA 1TQMA 4CYCB 1DP3A 2CH0A 2D1VA 5E20A 3A2KA 3WHWA 4Y4RA 5HLTA 3FXQA 2W82A 1BI3A 2W7NA 4PUSA 5IY5H 4UNOA 1SD4A 2LRDA 2HOEA 3TO7A 3L85A 3X0OA 1JKOC 4YEJA 1R5ID 4XBFA 4G7ZF 3E5XA 1STZA 2DT6A 5D4RA 4ABZA 1P4XA 2LTPA 2QLZA 3S3MA 4XKVA 2RGVA 1G3TA 1H9GA 4G8XA 1MIJA 3PIOF 2YU3A 4E7HA 3CDHA 3O69A 3Q4IA 2IGMA 4FISA 1E3HA 3S14J 1V8IA 1I50J 1ZK8A 1FPQA 4DBRA 3MQ0A 1LVKA 4IJAA 5F27A 2E19A 3DBHB 3BP8A 1LFBA 5F04A 5K1YA 2XRLA 3IAS2 4LG3A 1ZR2A 3JRBA 2ZXHA 2I6KA 2RNJA 2QQBA 3H0DA 3GMEA 4M6XA 2CW8A 2V9VA 2P6SA 2W84A 2H1KA 4DGWB 9ANTA 3A6SA 4JOMA 1JT6A 1MDMA 5D5VB 1B8IA 5FKOA 1TNSA 3Q2TA 3H92A 4ZYAA 4NQWA 5KVRA 1DU6A 4WF2A 2ZBKA 2LSOA 2VE8A 3X2QH 3GLXA 2B7EA 1HA8A 5K5QA 3BQZA 4D5CA 4ILQA 2KT0A 4PGHA 2KMUA 1BW5A 2CW0F 4XLNF 4HF0A 2DK8A 4BL0B 1SAUA 1RI7A 2M87A 4HG2A 4L9NA 5M5YJ 4JYKA 1R9TJ 2A61A 1KONA 2E1CA 4QPOA 4JZVA 4CUGA 4YOQA 3CCEI 1ZGJA 1LB2A 4J00A 2FMLA 3QU6A 4F3QA 2F5EA 4WXCA 3ZXSA 2HDDA 2L3DA 1FJLA 4Y52J 4OOIA 4DZJA 3GFIA 2VNPA 2W48A 4C2UA 3CDIA 2P6TA 2FA5A 4HZFA 2A8SA 5E79C 4F52A 5EZGA 2COBA 1JKPC 1T39A 1LVAA 1G3YA 2FJ1A 4CCNA 2LBFA 2NS8A 3LSMA 4MO7A 1VQ7I 1ZG1A 2R92J 3CC4I 4B48A 5LRSA 3FMSA 5FSKA 2ZFUA 1Y39A 5CFJA 3S32A 3L00A 4HSRA 1XSCA 1ETWA 2EWNA 2OPTA 1TT5B 1DGWY 1XDSA 3LSJA 4J01A 1G9QA 2CQQA 3OYAA 4A2UA 4DYCA 1S7AA 5F0HA 1TP4A 3AL0B 4RB0A 3DKXA 4HRIA 3N97A 1VQ6I 3F9KA 4M9XA 4LK0F 4M3GA 1VQ5I 1L0OC 2FUG2 3MKLA 2DI3A 2LF7A 1E2XA 3R61A 4M73A 1K78A 1KU7A 4KFCA 5ANTA 2QUFA 5DV5A 1H88C 1BR1A 3I58A 1VQLI 3R4KA 2L7MP 4AIJA 5FRMA 1RKTA 3HSEA 1YX3A 2EV6A 5M3MJ 1Q33A 2A8RA 5L3DA 1U78A 3VWBA 3I4NJ 1V8VA 3F8FA 4PJLA 3OL4A 1ACIA 4O6JA 5EYRA 3QOEA 3JAMK 4CYCA 2YVNA 3X0KA 1LJ9A 4EATA 2OZUA 3GTLJ 5TRDA 2L9RA 1YW8A 3FMQA 3H36A 2OC6A 1LQ1A 4S2WA 1USSA 2V1UA 4N9HA 3WE2A 1WJAA 4RGXA 3SZPA 3E0JB 1WJFA 1XMXA 3CCJI 2RQQA 2PJRB 2F6CA 4M6VA 2JA7J 4GFBA 1I6XA 1UHWA 2A8QA 1U9OA 4ZZLA 3L2CA 1R1VA 2QVOA 2XRNA 3FF5A 1ZHFA 4F93B 5F1JA 4OIQF 2WBMA 3G4SI 2ZSIB 2L7KA 1MBGA 1RPWA 3J7Ye 4LJZF 5E1WA 2K4BA 5GTIC 5LGUA 2AS5F 2R4GA 1H89C 3X0NA 2HVQA 4N1UA 2ELKA 1LKXA 4ETSA 2EZKA 2KDZA 3N4MA 3DF8A 5HNHA 3CUOA 5ICEA 4E7JA 3S2HJ 3ABUA 2ADUA 2D5VA 1NQYA 1FYKA 4YRVA 1YQAA 2HQAA 4HA8A 3OYGA 1FTTA 4AYBN 2A6HF 2G9WA 5C4XJ 1W1WE 2NAZA 4KMUX 4D1QA 5H6RA 1V5EA 2XVCA 5J8CA 4NUBA 3F8BA 3O8SA 4B09A 2K9SA 1J9IA 2YSRA 1EKEA 1ZLJA 2ACJA 3KEYA 2R7DA 4JX5A 1A31A 3KLNA 4IVNA 2DFFA 2DJNA 2E1OA 1VQ9I 4O3MA 1ZGAA 1VK6A 4UUSB 2M2EA 2EV0A 4C30A 1A6QA 1TC3C 1CGPA 2OUMA 4H0EA 2DSBA 5C44J 1JGGA 2X6YA 1RIOH 2P81A 1NQZA 3ISPA 1U3EM 3HPGA 1OMIA 2DQRA 1VC8A 2MLGA 2XV4S 1QU3A 4DQ2A 3PFIA 2DMUA 2M7AA 5AIQA 3O8HA 3CMYA 1GHCA 2LR8A 4ANJA 1TWGJ 2X6WA 2JMWA 4HF1A 2K3PA 2EH3A 3G73A 1IXCA 4F7ZA 4FTHA 3WTZA 1SOIA 4KDPA 2RQPA 2O7OA 4BXXJ 1PUSA 3K1PA 1LUJB 1YRNB 4RBOA 2AQEA 1I5ZA 1YX5A 1APLC 3PM1A 2KIQA 3ZMSA 4X6AJ 4MFDA 4A3GJ 3WTWC 5HS9A 3GTOJ 1G6NA 3DUPA 4A3MJ 3HDDA 4Y17A 1IN6A 4OU0A 5F6FA 2KP6A 1ODDA 3Q9VA 1KQ9A 1ULYA 3HKZN 3S3OA 4S2VA 5JLWA 2Z16A 1B4AA 3IWFA 2KZGA 4BEHB 2VOPA 3GLLA 4S2YA 3QYFA 2XSQA 4LIVA 4RGRA 4AUXA 3J7ZI 3CCVI 3S16J 1X4PA 3RIRA 3I4MJ 1IN8A 1RYAA 5L3BA 3GEZA 3KEOA 4PZJA 2E36A 2WA0A 4GYGA 6PAXA 5J4VA 1E3PA 5B3SH 3BZKA 1XTAA 4IO9F 1SFKA 3FISA 1L3LA 1P9QC 2ZC2A 1IRYA 1OW2A 3RQIA 3MEXA 1G59A 3H9JA 3NEUA 1BOAA 2OCEA 4M3DA 2ID3A 2CQNA 3X0LA 2EA2A 4CH7A 3W2AA 1GVDA 3C18A 2FX0A 1ZGWA 4HNVA 5DPKA 3K9TA 2F4MB 2R7XA 2JJ7A 4XLEA 2E7XA 1R5GA 3GTJJ 2IEKA 1I3AA 2MH9A 2QSFX 1IDZA 1BBYA 1IN7A 3BR2A 1C0WA 5FD5A 4GRIA 4XIDA 1RRSA 3HRUA 3G71I 4P1WA 5ED4A 4RAFA 3EUAA 3FIWA 3LA7A 2BOLA 4EGZA 1T0FA 2OTJI 1WI3A 3PQKA 1KZHA 4XL9A 1SVLA 1I1GA 2XF6A 2HGCA 2O6GE 4EJTA 3PSFA 2JPCA 1U2WA 2CJJA 3IH3A 3K2ZA 2CS3A 4B43A 1YW7A 3JRAA 2H8WA 1P4AA 3CTAA 4JX6A 3HG9A 4BQAA 3FXMA 3HOYJ 3F23A 1W5CC 5A2QZ 3A03A 2BYVE 1VIUA 4A12A 2K9LA 2HOTA 2L5QA 2TRTA 3F13A 3LFUA 2BBYA 3FXKA 1OISA 4D0PA 3IL2A 2IA2A 3KZYA 1RUNA 3EEUA 4FX0A 1IN5A 3GTKJ 1VQPI 2R0QC 2DJIA 3TKYA 3G3ZA 3LSHA 4UVAA 4A69C 3ZMTA 3HOTA 5C7QA 2FBHA 2M8EA 3GWZA 1SFEA 5E8GA 5HLHA 3RI4A 4E4HA 3BPVA 3DEEA 2HOAA 4RA2A 5DM6F 2X48A 4RS8A 3K4NA 1FSEA 4NC8A 4DZPA 2IS2A 3SZTA 2JWTA 3LSRA 4A6EA 1OR7C 5EF6A 3WTSC 4UUSA 1PUQA 2Q0OA 3L2WA 3CCSI 3BTLA 1W4MA 1LPQA 1NFZA 2LH9A 4XNFA 1R5HA 3CC7I 1WI9A 2QKLB 4KG3A 1SEUA 3JSOA 3W6JB 3M8JA 2RREA 4AU7A 3P5TA 2O3FA 3WODF 2LKPA 1Z6TA 2GOXB 5IYBJ 5B66C 1PDNC 2M3AA 1ONVA 1X83A 3Q2SA 3MKZA 3CCYA 3SXYA 4ZDLA 3KP2A 3Q91A 2HPIA 1YRNA 2EFNA 2R7RA 2VQLA 1VQOI 3LOCA 4HF2A 4A0XA 2NVYJ 1RZ4A 2HKXA 2GWRA 4E7SA 1X58A 1VTNC 5HOOA 3A6UA 2M34A 1V4RA 4PJNA 2VOOA 4L0ZB 3NARA 4ZJZA 2GT4A 5HODA 2EFQA 5CVIA 5CYVA 4NNJA 5ICCA 1YG2A 4AIKA 1I6HJ 2K85A 4HQMA 3TO6A 3H3VK 1IUFA 3OYJA 1X1DA 1HSTA 2KJCA 1S7OA 4CZZA 2DN0A 3PL8A 3G6EI 1NK3P 2JRMA 1TQPA 2V1DA 1OCCH 4CCKA 1W5SA 1IXSB 4XKCA 3WGHA 2HEOA 2H8RA 4OIPF 2KHMA 1YW9A 2K9QA 2NOGA 3K1MA 3VOEA 5M3FJ 3KYDB 3SONA 4AD9A 1LEAA 2QQ9A 3E7LA 2CUFA 5ILSA 1PJRA 1V5FA 4XR6A 1D8JA 1AA7A 4HLYA 3I7UA 3OL3A 3NQOA 4N9IA 1R71A 1VCDA 3E1SA 4Y13A 1MNMC 4IJXA 1RC9A 1UFMA 3QPLA 4IZZA 3DTKA 3DBLB 3LA3A 1JXSA 1ZRDA 4WXHA 1BJZA 4N0BA 5ISYA 3I53A 1MD0A 3K4BA 4B3XA 1PYVA 4RAGA 4XRSG 4ITVA 1Y6IA 3CLOA 5FRNA 2M0MA 2W00A 4NDLA 5CVJA 4AWXB 2H1LA 3JTHA 1MMAA 2P5LC 1Z9CA 2FKBA 2HQ5A 3K4JA 2E1NA 4OWRB 4WK8F 1P7IA 2B63J 1VHGA 5DCFA 3N9UA 2HDCA 1LE8B 4O5VA 4EEFG 3N05A 4EM1A 4UVBA 2XHKA 2BXYA 3U2RA 3LWFA 1Z3YA 4K6EA 4OAYA 3TP0A 2XF5A 1GXQA 3DPTA 2XAUA 3FHNA 2DDBA 2WY7Q 4IEJA 2ZCWA 1MSEC 3J80Z 2O03A 4Y7NJ 5FSIA 4HYEA 2WB1A 5FLXZ 3Q0WA 1IAWA 1RRJA 3ZMVA 1RESA 1S72I 4IRGA 3JRHA 2G7HA 5K7ZA 1T95A 1G2HA 2ID6A 3I9XA 2FXAA 3BPXA 3TL4X 3JSPA 2GZWA 2Q9PA 1JUSA 4E6KG 1IRZA 4EMSA 2V1NA 2VN2A 3HUGB 2BVMA 5ANWA 1GA7A 5C8LA 4OINF 4MTEA 2W24A 3KPHA 3I71A 2ME0A 3WHBA 2WWYA 1UB9A 2YVMA 3FJYA 2AHQA 3R6SA 2L02A 1SFUA 1Y1VJ 4E7LA 4Z6YA 5FJ8J 3SEZA 4QIWN 3KETA 3RH7A 1MW7A 4KN7X 1XDUA 2HKOA 2VKDA 4HV5A 3ROUA 2CV2A 2A5YB 2MA3A 1Z3XA 3ZR8X 1BN5A 3OYIA 5D8LB 3M8FA 2FVVA 4CDGA 1D1BA 1IDYA 2EFWA 2OF7A 3FWEA 3BY6A 2QWWA 1QBJA 3SEQA 4OIRF 5BPDA 3BG5A 2ZXWH 2VXDA 2WADA 4P96A 3HRTA 2MFZA 5ICFA 4XLHA 1XG1A 3X0MA 4QSHA 3I5UA 2HR3A 4MFEA 3C3WA 3Q0VA 2X51A 1Z67A 1S9HA 3TO9A 1NFSA 3QQAA 5BONA 1IRFA 1QGPA 1EH6A 5C4JJ 1A36A 2DT7B 3LSKA 2DDAA 3RTRA 3JRIA 2QZ8A 3LQQA 4I0BA 2JA8J 2JUCA 5DDGA 1MBEA 3PNVA 4BDZA 2DOAA 1QO0D 2CUZA 1J7KA 2RDPA 3HOZJ 1R4MB 5F0CA 1E0EA 5ANUA 4DOZA 3PNTA 5HDGA 5J1RA 3OS1A 2IA0A 5D6EA 2XKOA 3KFWX 1QPMA 1V3FA 2KZVA 1R67A 3GTGJ 5FD6A 4MHGA 4JZSA 1S29A 4A0YA 2H94A 1BIAA 2ZJQF 2IRFG 5M5WJ 2IBDA 2QQAA 5CKTA 3BHOA 2WAEA 3GBGA 3BG6A 2V26A 4RM2A 4KYXA 2LKSA 3BR1A 2FD5A 2NXNB 2HS5A 2RRKA 3BQYA 3KVHA 1HX3A 2NVQJ 3SHFA 1I27A 3KP6A 4YIFA 3HOXJ 2VASA 2HTJA 3S17J 4CZCA 3S3NA 4NFWA 3JTGA 4DBQA 5D5XB 2QA4I 1HOMA 5E17F 3H95A 1VQKI 5DD8A 4BAYA 3J7YJ 3TP3A 1XD7A 4KTBA 4YFNF 1O3SA 1JTXA 1GXPA 1YLFA 2K9MA 2CUJA 2W85A 2CMPA 4ZYGA 3FBIB 3IH4A 2EV5A 4LB6B 4XRSA 5FLVA 2UUZA 3OYKA 4IQJA 3BR6A 2VI6A 1I39A 3WG9A 1PPVA 3O61A 4BNCA 3K69A 3PO2J 1LEBA 1BOBA 1V8SA 1R6RA 1DUXC 1WJEA 5GHPA 3BG9A 2PN6A 3T1BA 1QVUA 1UHSA 2EZIA 4LMYA 1LE8A 1FP1D 4DYQA 5IP7J 1AWCA 3MN2A 1W7PB 3G1LA 4M6YA 3AG3H 4JX4A 3A0HC 3HBLA 1W36D 2L9NA 3ZR1A 1NTCA 1EH8A 3LAPA 4UXNA 2V9PA 4L5IA 3BCAA 3K6GA 5GHIA 3OIPA 4RDUA 3IC7A 3A6VA 3BWGA 1JKRC 3KEQA 1EH7A 2HXIA 1N75A 2KJBA 4BQOA 1FOWA 4A3FJ 3HB9A 5BOXA 3M3YJ 2A3SA 1PPWA 2OD5A 3IV5A 1Y8RB 2JVGA 4V19K 4XN0A 2YVPA 2L7ZA 5IYDJ 2Y75A 5M5XJ 4GYIA 3CCUI 1XMKA 4IHXA 3DBRB 3PNYA 2ME6A 4XKWA 3FXRA 2BEOA 4PJMA 1XMAA 3JRGA 2VC1A 2O9LA 4OIOF 3BDDA 3HUGA 4HBLA 3SZGA 2EPFA 2DA5A 3MCZA 1IW7F 3SDBA 1FY7A 5GP9A 3RYRA 3P5JA 2HDWA 4GXOA 5B5EC 2Q8KA 1K79A 5KCMA 3H1CA 3U1KA 2IT0A 3K7AJ 2BXZA 1T56A 2O8XA 3DU6A 3GZNB 1F1ZA 2X9DA 5EDNA 3TOBA 3CMMA 1U20A 4NFXA 3HOSA 1ZYRF 2X1CA 1Z91A 1WFXA 1VNDA 3AKZA 5C7TA 3SQNA 1HF0A 4LD5A 2XIGA 5L3GA 4BY7J 2LMDA 3NWTA 1FC3A 2VL8A 4PCQA 4BQQA 1J0RA 4IHTA 2DPUA 4A3LJ 1HDPA 2RAEA 3FK7A 3PQJA 2FNPA 2F48A 2IS4A 1MZBA 2PJPA 3T8TA 4BUPA 3S2DJ 4KIBA 1YITI 1JKQC 2RVCA 1Z6RA 3S2WA 4HVYA 1ON2A 3KIOA 5FSOA 1QA6A 2F5CA 4BH9A 1MJBA 3RKQA 2UXXA 3ML6A 2KIUA 1GUUA 1K6YA 1X1AA 5BMZA 1FP2A 3BZCA 3MGMA 2EQRA 4XLAA 3UR3C 1VQ4I 2DLLA 3J81K 1FWZA 2R7TA 4UUTA 3F0CA 4KICA 4P9FA 1V55H 4A3KJ 2DSDA 1O3RA 3AC9A 5LFAA 4F55A 1ETYA 1P92A 2Y0MA 4PJ0C 4EM2A 4FASD 2VBWA 4BJ5C 3GO5A 1ZQ3P 1ZELA 2DYRH 2LNBA 3P7NA 2J8QA 4QLCU 1VHZA 2IGKA 3GFMA 5CJ9A 2DOEA 5FO5A 3WTUC 3HRSA 2BY3A 3H9GA 4G94A 3ZN0A 3AL0C 4IX7A 4RGUA 3U53A 2R5YB 4YIRX 2QQ8A 2OJED 5E1XA 1QRYA 1FMWA 4L5JA 1QZZA 5JHFA 3E97A 4C9WA 4B1RA 2TCTA 1H8AC 2WV1A 4RM3A 1WJDA 1UMQA 3QPHA 1JHFA 1ETQA 1IUYA 1TBXA 2RV8A 3CO6C 1VQNI 5J4YA 3A01B 1P2FA 1FMVA 2EJRA 2BVLA 3W6VA 4G6DA 2VODA 2Y2ZA 3TOAA 2PMZN 3FXLA 1W0TA 1IJWC 2QSHX 1IC8A 2GAUA 3E5QA 3GX4X 1D5VA 3DKWA 4MGRA 2VJJA 2MD5A 1UG2A 1ZREA 2M4GA 4M72A 2P0WA 3RJPA 3PJRA 1FYLA 2GXGA 5GHNA 2O1CA 2R7SA 5GADJ 2MSYA 1D5YA 3HHJA 1CF7B 2V1XA 5EGOB 4XOPA 4HX8A 1TT0A 3HHHA 5J1UA 1QQIA 1T0FC 3VODA 2CG4A 1WJBA 1WQ2A 3K10A 3RPUD 1K6OA 2RKHA 1MJ9A 3QP5A 4D9JA 1X51A 4KT6A 3VDXA 1JHHA 2LF8A 2DA4A 2VQGA 2XAJA 4HLXA 4XICA 1JUMA 2CSOA 3WG7H 4C9XA 2FBIA 4NB5A 1XSBA 2F5FA 5IW4A 2GOMA 1MJAA 2AZWA 3MDIA 1HQCA 3ZR0A 1H9TA 1S7EA 4CYDA 1HKTA 3QWLA 3FFUA 4IRIA 3MZ8A 4DW6A 3FM3A 3EUHA 1ZAOA 2I8UA 1QVTA 1KYZA 3LFKA 4LGWA 1XGSA 2X0LA 1J75A 3BT9A 2KIMA 5DCMB 3L2RA 1XGOA 3JAMZ 5EG0B 4TV7A 1SANA 4HNTA 5LEKA 2NVTJ 3V8KA 2QBYB 4OMYA 3LAJA 2M5WA 2OQRA 3ABLH 5HDNA 1FIAA 3O8GA 4I0AA 3GVAA 3Q5FA 1VIQA 2ZB9A 1F9NA 5J3LA 1W0UA 3X0PA 4UB8C 3G0QA 2PX9A 3M07A 1B72B 2VC0A 5CVRA 3W3CA 3J7AO 2KRHA 2XB5A 3FZVA 2EB7A 2Z3YA 1EV7A 1YIOA 2OU2A 5HNFA 1Z77A 3EYYA 4ZDPA 4FHTA 2IW5A 1HZTA 3WHCA 2HFHA 5F08A 2R7VA 1XGMA 5CVVA 1ZR4A 1D1CA 3ABMH 1LDKB 1WJ5A 4YELA 2G7UA 2F4OB 3H0GJ 1A6IA 1V8TA 2N8GA 4EQQA 2JA2A 1BR2A 2L4AA 3ZGKA 3BJ6A 3HGGA 3CCLI 1U5TB 4LIUA 3V42A 3F8NA 4JBAA 2E2JJ 4LITA 1OYYA 1IRGA 2PMUA 4KG4A 3D5LA 1WSUA 1ZARA 4BXUA 3OYEA 5ANSA 1FZPB 3A0BC 4AIDA 2ZJ2A 2R7FA 2W4EA 4RAZA 3V8JA 4BYYA 2DA7A 1KGSA 1BI0A 2HQRA 3JRCA 1BI2A 3I64A 2IGNA 2UWMA 2R5YA 4E70A 1VQ8I 3LNQA 1YS7A 3DEWA 2Z99A 4XSZF 2LFBA 4CO8A 5K7FA 1QZYA 2UV1A 2Y9YA 4HX7A 1SVMA 1R22A 1TTYA 1S8NA 1SJYA 2I5UA 1ZH5A 1VC9A 2PNYA 3KLOA 4UHTA 5B1BH 3O6ZA 3JW4A 4U0WA 1VZ0A 3IKVA 3A01A 2X1DA 1MSFC 1YFHA 2X6XA 5KAFC 2HYFA 1MH4A 2Y31A 2PI0A 1BL0A 5IT9K 5E8IA 1Z21A 4OAZA 5LHGA 1IGNA 5DM7F 2BZTA 1W7PD 1MQWA 2E35A 4KIFA 1DPUA 1W5TA 1SFXA 2QENA 2R7OA 3BTCA 5IPAA 1XSAA 1F5TA 2R93J 2R7ZJ 1Z7UA 3OR1C 2LY2A 2PJRA 2A68F 4BHBA 2CU7A 4V2GA 4BE1A 2DMQA 5D5WB 1K83J 1M1EB 2DW4A 3R0AA 3BTJA 4XMYA 4ZYHA 3ZQ7A 5IP9J 3CF5F 4U87A 3TDUC 1REPC 4PDKA 1BR4A 4KJZA 2CQXA 2Y0SA 4IF4A 4XKBA 4RGSA 4AVZA 3GFJA 1SFOJ 4PK4A 5GPCA 1DU0A 1R4NB 3LMMA 3ZMDA 1XSVA 2OAZA 1JKNA 4HFQA 4C2MJ 4Q47A 2MH2A 3ZQQA 2W25A 4MNUA 1V8MA 5LHHA 3V4GA 2VLAA 2MC4A 3I0TA 2IXSA 1V8LA 2JVHA 5DCMA 4DYRA 1K4SA 3C2HA 1NK2P 3OS2A 2D1HA 3A02A 2LKXA 3QU3A 5EG0A 2JSPA 3IKTA 1B9MA 2ZXJA 3BM4A 1XSXA 2DFHA 2QBYA 3HYQA 1O7FA 5GTHC 1J5YA 3WGIA 3GZ8A 2XB0X 2Z33A 1GV2A 2XPVA 4XRMA 4FQGA 2GXAA 4D7MA 3I56I 1MNDA 2VJ5A 1F36A 4LG0B 1POGA 5JHUA 2B9SA 3GWYA 2GXBA 4X0GA 2VQHA 3P9KA 4XN3A 3H3ZA 5KAIC 4BJTA 5KNLA 2JT1A 4S05A 2KIFA 2ZMEB 1EJ9A 1LNWA 5EZHA 4JZTA 4I6ZA 4QTRA 1V5GA 2DO7A 1MUTA 3KP5A 5E3NA 5TJJA 3U21A 2MYSA 1G4DA 1YIJI 4YFXF 4YG2F 1B1BA 1GVJA 3HM5A 3ZQCA 1K4TA 2STTA 1V8UA 1MR2A 2ZJRF 2XPWA 4II2A 4FE7A 2ESNA 5CQGA 1FT9A 3KP4A 5IOZA 1U5TA 2KISA 3EF5A 1T33A 1PUFB 3VFZA 2DFIA 1HW2A 3OYHA 2COMA 1AHDP 2OCCH 1D3YA 3I55I 2C6YA 4ZTFA 4WWCA 2P8TA 3K4LA 2FOKA 2KRCA 1KT9A 3I3LA 1Z0XA 2EIKH 2O8KA 4BEHA 3JRDA 2E60A 2MABA 3CUQB 2VBZA 3O6BB 4FCYA 1SD7A 3OSFA 2VXZA 4MEYF 4YIIA 3A1YA 2DODA 4F91B 2M1BA 1Y0NA 1MMDA 2VPRA 4C2TA 2EA4A 2PBIA 3MMYB 1TW2A 1SMYF 4E7ZA 2I8TA 1PP8F 5K5OA 3AAFA 3KZIC 5J40A 4ENKA 5K7HA 4KIGA 2CV1A 2K40A 1AOYA 1K26A 3OWTA 1XGNA 1R1TA 5DUIA 2VONA 2VKVA 4KUMA 3HPHA 2R7QA 3HGYA 4B8XA 2QJOA 3BG3A 3E5UA 4HEA2 1B9NA 4LLGF 3VEPA 3ZQHA 2CQKA 1JRKA 1PUNA 3GF2A 3OY9A 3ZN1A 4BACA 2B0VA 2ETHA 1IV8A 1ZG3A 3CZ6A 3H5RA 5I8UA 2ZNYA 4S0HB 1H0MA 2V6EA 3FM5A 2M45A 3HZJA 1WWXA 3VYRB 4UY8I 1K2EA 3DPLC 2Y69H 2K3FA 3E57A 3GG6A 2PMHA 3OS0A 1IZ1A 3ERED 2XAQA 4M3FA 5E3OA 1PP7U 2DQLA 1WKMA 3BZ6A 2AXTC 1D0ZA 4A93J 2WC2A 5JLXA 5BQTA 3RYPA 1MBFA 1R49A 1DQUA 1SAXA 2DSCA 5FKNA 2F5DA 1X4OA 2FQ4A 1KYWA 4DJAA 1BA5A 2H6BA 2A8PA 2BHYA 1JTYA 4I01A 4IPAA 5LHIA 2H09A 2NS0A 3KP7A 5HS7A 2E1MB 3QPTA 5TISC 5D8KB 1X1PA 3F21A 1G0SA 3I59B 2R5ZB 3FKJA 1T98A 2FQ3A 3L2UA 1VRLA 2IS6A 3X0RA 4MEXF 3NAUA 4ENMA 1SMTA 4M3EA 2KRFA 1S6LA 2DA3A 1QHGA 4B47A 1XSDA 2DPDA 1KTGA 3ZOBA 3WTTC 4R1HA 3IRQA 2XAHA 4CGZA 2YS9A 3QSJA 5ANVA 1WGXA 4EM0B 4G7HF 4EJWA 3OYBA 2M30A 4L18B 3CD6I 2A6EF 2OQGA 2FF4A 2L4MA 2V7FA 4J7HA 2BW3B 3LSTA 2UZKA 4LG0A 4ZG0A 4FT8A 1MGTA 2XAGA 2XROA 5DEQA 2Z9OA 2DT5A 4D7NA 4BE0A 2DK5A 1U8RA 1T2KA 3HEFA 2ZMEA 4IKFA 2EIJH 3LA2A 4BGDA 1OFCX 5FKLA 5FKKA 2L0KA 1PPXA 3TBIA 4V14A 2XKPA 3QAHA 2RC4A 1MDMB 1IO2A 3D0SA 3HC7A 1RNLA 4MIMA 4ESBA 3SJMA 3OIQA 1O7LA 4G9YA 3A6TA 2VKEA 3C2GA 1A04A 4I98B 3W6KB 3DP7A 2CFXA 2EBIA 4LOCA 4R8HA 1HCRA 3S15J 3K2AA 1HC8A 1LDDA 3GXOA 1D0YA 5ERIA 3CJQB 1Z7LA 1FX7A 3CCMI 3H35A 5HLIA 4C3JJ 4JP0A 3MAJA 1J2XA 2IA1A 2H6CA 3P9CA 4UB6C 2ISZA 5LEJA 1OYWA 2BV6A 4A3IJ 1XCVA 2MC3A 5L3CA 4XK4A 2A05A 2F2EA 1N25A 1V54H 3CUQA 1ZRFA 4BHPA 2ZKZA 4GGGA 3RQ4A 2XSJC 3RPQA 2EINH 4CCLA 4MTDA 1DP7P 2CZRA 5D5UB 1UHMA 4NC7A 1U0JA 2A6TA 4IQ4A 1FOXA 2XPUA 5GHOA 2IS1A 4RAYA 1LDJA 5ILVA 4JZUA 4I02A 4L9TA 2JA5J 1TZLA 1YJWI 2LBFB 2YX7A 3B6CA 2L2OA 3H9QA 4NBQA 4WXDA 3ASNH 3QPSA 3L2VA 2O5FA 3ZRGA 2FMYA 1QZEA 1FNNA 2VE9A 2EFOA 1WPKA 2VT3A 2JQ7A 5J6XA 1Y56A 1TWAJ 3GYHX 2LP0A 2A69F 3OYCA 2E2HJ 2M8GX 3AFHA 4HAMA 2B0LA 2JK3A 1YI2I 2E2IJ 3P9IA 1Z05A 3CMAI 3J7AY 3Q93A 2DFEA 2DTZA 3F6VA 1WHUA 3B73A 2XF7A 5L3EA 1K78B 4E7KA 1CQTA 2PLYA 1WRJA 2LVSA 3MVPA 4GCVA 4MLOA 4DNCA 1LFPA 5L3FA 3COUA 2VIXA 2QGUA 1JT0A 2UXNA 1HW1A 5D6FA 4LLNA 3B6AA 3QYEA 4IHWA 3HSRA 3G1OA 3BR5A 2LOOA 3ASOH 4KN4X 2QSGX 3O2PE 5LGNA 2YVOA 3H5AA 4RLQA 2KQRA 3U9GA 3RPUA 2Y9ZA 1K7AA 2VQCA 3PFYA 3MKYB 5FKMA 3HOUJ 4Q5SF 3CQZJ 5IP6A 3BG7A 4QPQA 2OA4A 5J1YA 4G12A 3DQVC 5CLSA 5EEAA 1QHHD 3CC2I 2HVSA 3I59A 2R5ZA 1MBJA 1UG0A 5ICGA 4KYWA 4EVIA 1JUPA 3EUHC 2Z1DA 1KU2A 4ZYEA 4A6DA 3EYIA 3HTUA 1JGSA 5CQEA 4IHSA 1TWCJ 3X0QA 4L9VA 1I1SA 5BNGA 4KITB 3I4PA 3VSKA 1ZTRA 2KDOA 3FKIJ 1V8WA 2BY2A 4UVCA 2DBBA 4KA4A 3X0IA 2EILH 5JI6A 2DA6A 3ID9A 3ZMUA 4PFOA 2K9NA 1T8IA 4ZTJA 5H6QA 1ETVA 3RCOA 3HRMA 5D4SA 2BW3A 3UKGA 4BBSJ 2WAQA 2DAOA 4ENJA 4CCMA 3B02A 2FU4A 1OYIA 4A5MA 2RNGA 4CCJA 3FMRA 4HDUA 4Y15A 4U7BA 1HDDC 3KP3A 1MNEA 3F3XA 1Y0UA 2QF7A 2DA2A 2CQ7A 3DTIA 2E5NA 2B2KA 1ETKA 2K5CA 1RETA 3FK6A 3OV8A 1NG6A 3BCBA 3SHDA 1X1CA 2HI3A 5AIPA 3G2BA 3E6DA 3K4CA 3HL2A 2FBKA 3S93A 4L9JA 3EQLF 3CMEI 1WCMJ 2XSDC 3DU5A 1MKMA 1E17A 3RKWA 4I7HA 3D5RC 4ZYDA 3CO7C 3HXLA 5BPIA 3RKYA 4ICKA 1USTA 1FYMA 2CUEA 1KU9A 2ECCA 2IGOA 2BGCA 4KMFA 3QODA 5JVTA 2VBXA 3GZ5A 2DU9A 1SVOA 4P5OA 1BM9A 4YFKF 1A5JA 2IAIA 3ERMA 2PQVA 2ZJPF 2NOJB 2P5KA 3L2QA 2A8TA 4H4KC 3S8PA 2DHOA 1XN7A 1RRQA 4BJ6C 2HPMA 2KPMA 4XLPF 2LC2A 1P7JA 2IPQX 2EFPA 3DLAA 4EJUA 3CLQA 2LREA 1WJCA 4XSXF 1OCPA 4EGYA 2O0YA 3F6OA 4A3EJ 3BTIA 2QCOA 3V7CA 5FROA 1D8KA 2DXIA 2QM3A 2OV7A 4MPOA 3TW6A 1JE8A 1TL8A 3ULQB 3U1DA 5KK1A 1LFUP 1QNTA 3ZQIA 2GB5A 2L01A 3X0JA 3BJOA 1XB4A 2DYSH 2OZ6A 2D45A 3C2BA 5IW5A 1U6GA 2CL3A 4C9YA 3J81Z 1DPRA 3KYCB 1FOKA 1AKHB 1W7PA 3R0JA 1VF9A 5GAGJ 2VJIA 3E6CC 4HOBA 3T8RA 2WV0A 3TW7A 1SC7A 3M9AA 1N77A 1FLIA 1YO5C 2XDVA 2ZO4A 1J59A 3IAM2 2D2WA 4M9SA 4W1UA 3Q9SA 1Q1HA 5H20A 1BC7C 3PSIA 3Q3SA 2GIZA 2JUGA 2I10A 3BLYA 3L09A 5EJCA 1WVRA 2KLOA 4GDFA 4M3BA 1HKQA 1YS6A 2X85A 2XGXA 3EUKL 2ICKA 1VFCA 4L0YB 1B59A 5FSLA 2L9SA 1RUOA 1EA3A 1UAAA 3WTVC 4A5NA 1TUMA 1OKRA 2VUMJ 3OYLA 2KDWA 3G1MA 2PEXA 3IWZA 2EZHA 4BDYA 3DV8A 3HSFA 2CRGA 4W97A 5HS8A 1BJAA 1OLTA 3ZQGA 4I09A 4ZC3A 3BROA 2X6OA 2WAFA 1JJ6C 2XC7A 2NRAC 2K02A 2LDUA 1X1BA 1HKSA 3L9FA 2GA1A 3IHUA 3BOQA 1TNTA 4QWQA 4EJVA 3GTMJ 2JN6A 3K1NA 5F64A 4HX4A 2FE3A 1V8NA 1P4WA 3VPRA 1P6RA 1T6SA 3W2WA 3Q1PA 2ISYA 3S1NJ 3K70D 1AU7A 1R7JA 3LL7A 2Y0SN 4EJOA 1X3WB 4Y3OA 3TGNA 5GAEJ 4L5EA 2NS7A 2Z2SB 5HZXA 2PFBA 4XLCA 3SDGA 3CJTB 3W2VA 3FX3A 2V9KA 1OCTC 2MG4A 1S5LC 3DTEA 1K61A 2M7BA 4LLLA 2VJ4A 1WH7A 2HXOA 3IP4B 4KT5C 3EPZA 3DKUA 1SD6A 4U0YA 2JRTA 1U5TC 3CCRI 2YPRA 1V8RA 5ILUA 4Q48A 1EF4A 4RB2C 3TEDA 3WU1B 3F22A 3SFIA 2YUSA 1HW5A 2XASA 3I54A 5E1ZB 2P4WA 3HTSB 5E3MA 3MZHA 4S04A 1N78A 4LB5A 4FETA 1UZCA 2V6CA 3CP8A 5KHDA 4IOCF 4U88A 2PMZA 3ZQLA 2F5VA 5E3LA 5FLMJ 1UJ8A 2H27A 1GT0C 4II3A 3HHGA 3CDLA 4PJJA 2KDVA 2JSCA 4IHVA 5EEGA 1MQEA 2Y30A 2G73A 1T38A 1MP2A 4CXFA 3VSLA 5K5RA 3V7RA 5FSMA 2BY0A 3V8LA 2FEZA 2VNQA 1Y8QB 4WCGA 3HJEA 4BXFA 2A07F 3GRNA 2YR2A 1SD5A 4IOAF 3M7GA 3DKYA 4D5FA 2J5PA 2XAFA 4M71A 3OYMA 4ZH4F 3D5SC 4I99C 1IN4A 4FX4A 5A2QK 2A5WA 4CICA 3FDYA 4N4NB 3LSPA 1NHAA 4B3AA 4BU2A 1AKHA 5CPRB 3M1EA 4NC6A 3T0YA 2QKMB 4PSXA 5F0FA 4G7OF 2XUBA 3MWMA 1CF7A 1GDTA 5EGOA 3M4OJ 1U9NA 2FOWA 4XRFA 3JREA 4A3DJ 5B1AH 2ICWG 5FSNA 1TLHB 1GV5A 1I3QJ 2GQQA 1O57A 2P7VB 4Q4ZF 1OJLA 2OTLI 3CJRB 1FTZA 4YPRA 2HZDA 3OYNA 1W36C 2PG4A 4AYBA 2VPLA 4C3IJ 1FEXA 1BI1A 4BE2A 1HBXG 3ZPLA 3M8EA 1D1AA 3HYIA 1BC8C 3PUBA 4XLFA 4NHJA 1R1UA 1IG7A 2IP2A 4J7GA 2E34A 3F72A 3WU2C 1T08B 3V7SA 2DA1A 1SZ3A 3HIFA 3LQRA 1GLNA 1R36A 2GIVA 4PGGA 3OOUA 3RZDJ 3IH2A 4IHYA 4UUVA 1KU3A 2KL4A 4IXAA 5E18F 1ZLKA 2KKOA 1TQIA 1X2MA 2R3SA 4EV0A 2DUKA 1BIBA 2KFDA 4X1EA 3E6BA 1XS9A 3FBNB 5JR3A 5GHQA 5IT9Z 1YOVB 2ZSHB 3H3UA 2AQFA 1FOYA 3GTPJ 4U7DA 1PVEA 3JCUC 3PIPF 3L1PA 5LLQA 2ECBA 1TW3A 4Z2YA 3GZ6A 3CNGA 3TQNA 3EETA 3FXJA 2HU9A 3QP6A 3L7WA 4AC0A 2DMNA 3ZMZA 4HPQA 3QYBA 5LD2C 1IXRC 1JJ8C 3IUOA 1R58A 1ORKA 2MW8A 3RKXA 1B72A 5HDKA 3FSPA 4UV9A 1NG7A 3KE2A 3WGGA 4A3BJ 2JZYA 1V8YA 3NRVA 2ZMEC 2WY8Q 5EEHA 5GAHJ 2HTSA 2XGDA 1PVFA 3ELKA 3GW2A 4PSWA 4S2XA 4XONA 1DDNA 2WB1N 2W4SA 1E3OC 3FHZA 3UNGC 3HKZA 1IV6A 2L9VA 2BE5F 2CYYA 2ELJA 1ENHA 4BS9A 2CV0A 3I9V2 2IJLA 1O4XA 3RDIA 2MD0A 2ELHA 1RKWA 3O3KA 1IRXA 1Q27A 2F4IA 4AVPA 2ESHA 1S3JA 1MMSA 4HDVA 4E7IA 3DEUA 1TWHJ 4CHUA 4MQ9F 3CJNA 3K4KA 3VYSB 4HSTA 1RR8C 3HOWJ 4BHCA 4A3JJ 4I2OA 1MBKA 4LK1F 2BHZA 4CA0A 5C3EJ 1J09A 1F4KA 1FIPA 3R60A 1Y1WJ 1FSHA 1MMGA 2Q1ZB 3GCMA 1OQYA 1HLVA 1TWFJ 1KHZA 4M74A 2NNNA 3TMOA 4V2FA 3CUQC 3VB2A 4AIHA 2JA6J 1ITYA 1F3YA 3DCFA 2LY9A 3DXJF 4XM3A 3KCCA 2XGCA 3FCMA 4IRHA 1XPXA 3TDZC 4RB3C 1A35A 2VBYA 3D1NI 2QYOA 3HOVJ 2YU9J 2DCEA 2CGPA 1KQ0A 2K4JA 2X4HA 2Y48A 1ZG5A 2I8DA 3NWSA 5LPGA 2Q2EB 1X3ZB 4P55A 1G8XA 1HXDA 3S1QJ 1IF1A 3OYFA 3PUFA 3OMYA 2AXLA 3DPUA 5DTDA 2QJTA 2HOSA 4DYWA 4JQFA 3BAPA 4CCOA 1YYVA 2EK5A 4U0VA 3J80K 3OR2C 1X84A 3SYTA 3LSGA 3K4MA 1B6AA 5J8FA 1WH5A 3EXQA 2GT2A 5FLXK 2EZLA 3CESA 2E71A 2HNHA 2DOFA 4FE4A 2VB6A 3SFZA 5DD4A 1MMNA 2JPBA 4B44A 4HW0A 1PUEE 3BC8A 1ETOA 4J19A 5GHMA 3AG4H 3JR9A 4HV6A 3REOA 1ZKGA 4ENNA 4BKXA 2R5WA 1X3UA 4BQNA 3OGAA 5FGMA 4ZZDA 1XX5A 3MDGA 1G3SA 2DMPA 4HNUA 4PFPA 3ZP5A 2V79A 1JI8A 4A0ZA 2DMTA 2V4JC 3FK9A 2PQ8A 1U8BA 3GFLA 5IYCJ 1YE9A 2E1MC 2WTEA 4C3HJ 2EIMH 3MFKA 2MBFA 3OSGA 2CO5A 1KA8A 4ESJA 2R7WA 2HVRA 2RN7A 4B4CA 2ZNZA 5LRRA 2ICJA 4ZDOA 1FBSA 3JRFA 3K0LA 3AG1H 2CW7A 3MCFA 2AO9A 3KX2A 4LFUA 5CVUA 4XQFA 4IL6C 1UELB 5F1RA 3WTYC 2OBPA 3F8CA 1D0XA 3ABKH 2ZXIA 3KZZA 4G6QA 3WU0A 2MLKA 2L54A 5FFXA 2GM4A 5AONA 3BR0A 2G74A 3CCQI 5TGTA 2VT2A 3H5NA 2M0CA 3GUDA 4JK1X 3CF2A 4AM3A 1RR7A 3S1RJ 5GHJA 1YJNI 2W57A 1OPCA 2J5OA 5HVQC 4ESFA 1XCBA 5DS9A 4F92B 2NYXA 5FB2A 4R79A 3ACAA 2LD5A 3MKWB 3FXUA 3RZOJ 2O61A 2K86A 2K7LA 2YX4A 4BBRJ 1HSJA 2QEXI 1OCRH 3EDPA 2R7UA 1OCZH 1B8IB 2K27A 1MK1A 1MBHA 1O3TA 2G0EA 2JTVA 3OOPA 3M1CA 4NQWB 3RSNA 1UCRA 3K70C 1OR7A 2HZTA 4CSWA 1F43A 3O52A 3ZCOA 5CFIA 3F8MA 2DTRA 2B06A 3ONQA 2X1EA 3DLLF 3IRRA 3N77A 1KQ8A 5GPAA 1X19A 3CP2A 3QRFF 2HYGD 2GLOA 2LK2A 1X2NA 1PUFA 4WX9A 1I9AA 1FBQA 4XORA 4Y33A 3KYLA 2W1OA 1YHQI 3DFGA 4A3CJ 2XGEA 2ZFWA 3ECOA 1ETXA 2TDXA 5DYMA 2CFOA 1YTYA 1QVJA 1ZN2A 3C7JA 4I76A 3ZQFA 5IOYA 3WE3A 3FXOA 3VYUB 3EESA 3E3VA 3OIOA 3A4CA 2LY1A 3P6YA 4MQVA 2HQNA 2MGQA 2WAQN 4N1TA 3T5XA 3VYTB 4XOTA 4HQEA 3F6AA 2L7FP 1ZRCA 5LBQA 2E5ZA 3LSIA 4GO1A 2E7WA 1MH3A 2Q2EA 3X0SA 2LYCA 3WTXC 1Q1VA 2FSWA 3MZYA 2FRHA 2P7CB 1XC5A 4BY1J 3C1DA 4P9UA 4KNYA 1YJ9I 3Q0UA 3MD2A 1VQMI 2CWEA 2O5RA 4YPHA 5H2FC 2NNYA 4M9ZA 4DIQA 2STWA 1ERDA 4ASNA 1BW6A 5BS6A 2P5VA 1R00A 2JVBA 3OYDA 1SU2A 1NH3A 2NVUB 3E6MA
chains in the Genus database with same CATH topology
1SJYA 2DXIA 2KHMA 2O5WA 2PNYA 1VC9A 2OV7A 4MPOA 3O6ZA 3SONA 1VZ0A 4KISA 1PJRA 2X1DA 1V5FA 2X6XA 4XR6A 4N4OB 1AA7A 3I7UA 4RLFA 3OL3A 2GB5A 1VCDA 3X0JA 2VKHA 3E1SA 1Z21A 2M4KA 4OAZA 4IZZA 4IJXA 3DTKA 4RMNA 2LG4A 5IW5A 5ISYA 1MQWA 2CL3A 4C9YA 3K4BA 4B3XA 3R03A 1PYVA 2R7OA 1Q54A 4ITVA 1Y6IA 5FRNA 2M0MA 3DWLE 1XSAA 2W00A 2YYHA 2VJIA 1MMAA 1N77A 3OR1C 2LY2A 2FKBA 3I7VA 2XDVA 4G6TB 3K4JA 1DGRM 4OWRB 2PJRA 3IAM2 3SMDA 1VHGA 1DP3A 2CH0A 3N9UA 3N05A 3PSIA 3A2KA 4BE1A 3WHWA 4Y4RA 5HLTA 2JUGA 1Z3YA 2W82A 2W7NA 3BLYA 4OAYA 4PUSA 4K6EA 2LRDA 2KLOA 2XF5A 4XMYA 3L85A 3X0OA 3DPTA 4YEJA 2X85A 2XAUA 3EUKL 3FHNA 4U87A 2ICKA 1BR4A 2WY7Q 4KJZA 4XKBA 2Y0SA 2DT6A 5FSLA 2L9SA 4AVZA 1EA3A 5FSIA 3S3MA 1UAAA 3O52A 4PK4A 4XKVA 1TUMA 3OYLA 3LMMA 2KDWA 2WB1A 1JKNA 4E7HA 3O69A 3Q4IA 4HFQA 2IGMA 1V8IA 3ZQQA 4BDYA 4DBRA 1LVKA 1V8MA 1T95A 3I9XA 2VLAA 2MC4A 1OLTA 3TL4X 2Q9PA 4ZC3A 2IXSA 4E6KG 2JVHA 3IAS2 4LG3A 1NFZA 1V8LA 3C2HA 2V1NA 3HUGB 2WAFA 2BVMA 3OS2A 5ANWA 1GA7A 2JSPA 2XC7A 5C8LA 1X1BA 3BM4A 2ZXHA 2I6KA 3HYQA 2YVMA 3FJYA 3H0DA 2CW8A 4E7LA 3SEZA 3GZ8A 4DGWB 3RH7A 1MW7A 1V8NA 3W2WA 3A6SA 4JOMA 3Q1PA 1MNDA 2VJ5A 2VKDA 2CV2A 3Q2TA 1Z3XA 3ZR8X 3OYIA 4ZYAA 3K70D 3LL7A 2FVVA 3GWYA 4X0GA 1D1BA 2VQHA 4XN3A 4Y3OA 4BJTA 5KNLA 1HA8A 2Z2SB 5HZXA 3SEQA 4ILQA 2VXDA 2WADA 2KMUA 4XLCA 1V5GA 3W2VA 2MFZA 1MUTA 4XLHA 2V9KA 3X0MA 3U21A 2MYSA 4BL0B 1SAUA 3DTEA 2X51A 2M7BA 1S9HA 4HG2A 2VJ4A 3IP4B 1NFSA 3EPZA 5BONA 3DKUA 1KONA 1V8UA 4QPOA 1MR2A 2DT7B 1V8RA 3LSKA 4CUGA 4JZVA 4YOQA 3RTRA 4II2A 5CQGA 4J00A 5DDGA 4F3QA 3PNVA 4BDZA 2FMLA 2DOAA 3EF5A 3ZXSA 2CUZA 2VNPA 3OYHA 1N78A 1E0EA 4C2UA 5ANUA 4FETA 4DOZA 3PNTA 3CP8A 5KHDA 4ZTFA 4F52A 3OS1A 2PMZA 2A8SA 2F5VA 3K4LA 2KRCA 2KZVA 1KT9A 4CCNA 3I3LA 1R67A 2LBFA 3LSMA 4BEHA 2E60A 2MABA 4II3A 2KDVA 4PJJA 4JZSA 2VXZA 4B48A 1MQEA 5FSKA 2ZFUA 2G73A 3A1YA 5CFJA 1MP2A 4F91B 5CKTA 3BHOA 1MMDA 2WAEA 3GBGA 3S32A 3MMYB 3BG6A 3VSLA 2V26A 4HSRA 4RM2A 4E7ZA 1XSCA 2I8TA 4KYXA 5FSMA 2VNQA 1DGWY 4BXFA 4J01A 1G9QA 2RRKA 3GRNA 3OYAA 3KVHA 2CV1A 1HX3A 1K26A 3OWTA 3AL0B 3DKYA 2VASA 3DKXA 4HRIA 3HPHA 2R7QA 4CZCA 3OYMA 3S3NA 3F9KA 2QJOA 4NFWA 4HEA2 3D5SC 4DBQA 2FUG2 3H95A 4KTBA 1JRKA 1PUNA 2K9MA 2A5WA 2CUJA 3OY9A 4BACA 2CMPA 2B0VA 3FBIB 1BR1A 5ANTA 3FDYA 4N4NB 2UUZA 4BU2A 3CZ6A 3H5RA 5CPRB 3OYKA 4IQJA 2QKMB 5FRMA 4PSXA 1YX3A 1PPVA 5I8UA 3O61A 1Q33A 2A8RA 1V8VA 2V6EA 1BOBA 3VWBA 1V8SA 1R6RA 5FSNA 3VYRB 1K2EA 1WJEA 3DPLC 5GHPA 4PJLA 3GG6A 3OL4A 3E57A 3QOEA 3OS0A 3CJRB 2YVNA 3X0KA 4YPRA 4EATA 2HZDA 3OYNA 1W36C 4AYBA 2VPLA 1D0ZA 4BE2A 2OC6A 1W36D 4S2WA 1D1AA 2L9NA 3ZR1A 3PUBA 4XLFA 3BCAA 3K6GA 4J7GA 1DQUA 1WJAA 5GHIA 3E0JB 1WJFA 3OIPA 2DSCA 1X4OA 3A6VA 1SZ3A 2RQQA 2PJRB 4DJAA 2F6CA 1N75A 4BQOA 1GLNA 1PPWA 2A8PA 2A8QA 2JVGA 3OOUA 4XN0A 2YVPA 4JZTA 2KL4A 2DUKA 2E1MB 4F93B 3PNYA 2WBMA 2ZSIB 2L7KA 4XKWA 1G0SA 3FBNB 4PJMA 5GHQA 3J7Ye 3FKJA 3L2UA 2ZSHB 1VRLA 2AQFA 2IS6A 3X0RA 2R4GA 3X0NA 2HVQA 4N1UA 1LKXA 1QHGA 3GZ6A 3SZGA 3CNGA 4B47A 3SDBA 5HNHA 1KTGA 4E7JA 2HU9A 2HDWA 1NQYA 4HPQA 3QSJA 5KCMA 4YRVA 5ANVA 3QYBA 5LD2C 3OYBA 4C2TA 2HQAA 3DU6A 3IUOA 3OYGA 3FSPA 1NG7A 2V7FA 4J7HA 3CMMA 4D1QA 1V5EA 1U20A 2BW3B 4NFXA 4NUBA 1V8YA 3O8SA 3HOSA 4ZG0A 2X1CA 2WY8Q 5DEQA 1PVFA 1WFXA 3KEYA 3AKZA 4PSWA 4BE0A 5C7TA 4S2XA 4XONA 2W4SA 4IKFA 1VK6A 3UNGC 4BGDA 4V14A 1PPXA 3HKZA 3TBIA 2ELJA 4C30A 4BS9A 3NWTA 2VL8A 4BQQA 3I9V2 3HC7A 2CV0A 2OUMA 2MD0A 3OIQA 1IRXA 1Q27A 2DSBA 2F4IA 3A6TA 3C2GA 2X6YA 1NQZA 4E7IA 2IS4A 3HPGA 1VC8A 4BUPA 1QU3A 3K4KA 3VYSB 4HSTA 4HVYA 2M7AA 5FSOA 1D0YA 4CA0A 4ANJA 1J09A 2X6WA 3CJQB 1Z7LA 1MMGA 2K3PA 3H35A 2Q1ZB 1K6YA 1X1AA 1KHZA 3TMOA 3MGMA 1SOIA 4XLAA 3UR3C 1PUSA 1F3YA 2R7TA 2DSDA 3AC9A 2AQEA 4XM3A 5LFAA 1YX5A 4F55A 3FCMA 4FASD 4BJ5C 3RQ4A 2XSJC 1ZELA 4CCLA 2CZRA 2J8QA 1VHZA 2IGKA 2DCEA 4NC7A 1U0JA 2A6TA 4IQ4A 3DUPA 2I8DA 3NWSA 5GHOA 2Q2EB 5LPGA 2IS1A 2KP6A 3H9GA 4JZUA 3AL0C 1G8XA 4IX7A 1TZLA 3S3OA 4S2VA 2LBFB 2L2OA 2Z16A 3H9QA 4BEHB 3U53A 3OYFA 3OMYA 3DPUA 3L2VA 3QYFA 2QJTA 4S2YA 2O5FA 4DYWA 4JQFA 2XSQA 3BAPA 3ZRGA 4LIVA 4CCOA 1FMWA 1X84A 3OR2C 3SYTA 1X4PA 5JHFA 1Y56A 4C9WA 3LSGA 3K4MA 1RYAA 4RM3A 1WJDA 3EXQA 3OYCA 2GT2A 2WA0A 3AFHA 3CESA 2HNHA 2VB6A 1FMVA 1SFKA 1P9QC 2BVLA 5DD4A 1MMNA 3J7AY 4B44A 1IRYA 3Q93A 1OW2A 1G59A 3H9JA 3BC8A 5GHMA 2XF7A 4E7KA 2VJJA 3X0LA 2M4GA 4CH7A 2P0WA 4MLOA 3PJRA 1LFPA 3W2AA 2R5WA 3COUA 2VIXA 5DPKA 5GHNA 4BQNA 2R7XA 2O1CA 3OGAA 4XLEA 2R7SA 3MDGA 3HHJA 3QYEA 4HNUA 4PFPA 4XOPA 1TT0A 2LOOA 4GRIA 1JI8A 1RRSA 2V4JC 1T0FC 3FK9A 4P1WA 2YVOA 1WJBA 3H5AA 3K10A 3RPUD 4RLQA 2KQRA 1YE9A 2E1MC 3EUAA 2BOLA 4D9JA 1X51A 2VQCA 3PFYA 4KT6A 3MKYB 3VDXA 4XL9A 2VQGA 2XF6A 3BG7A 4QPQA 2R7WA 2HVRA 3PSFA 3DQVC 2ICJA 4C9XA 1QHHD 4ZDOA 2HVSA 1XSBA 1UG0A 2CS3A 5IW4A 2GOMA 4B43A 2CW7A 3MCFA 3KX2A 2AZWA 3MDIA 3EUHC 2Z1DA 3HG9A 4XQFA 1UELB 3ZR0A 1D0XA 5CQEA 2ZXIA 1VIUA 3FFUA 3X0QA 2K9LA 2L5QA 3F13A 3LFUA 4KITB 3VSKA 2I8UA 2KDOA 2G74A 1V8WA 5TGTA 3H5NA 3EEUA 3X0IA 3CF2A 3ID9A 2DJIA 4PFOA 3LSHA 3L2RA 4ZTJA 5GHJA 4HNTA 3HOTA 5C7QA 3RCOA 5HVQC 2BW3A 4F92B 2WAQA 4E4HA 3DEEA 4CCMA 4R79A 3ACAA 1VIQA 3MKWB 3K4NA 4NC8A 3X0PA 2RNGA 2IS2A 4CCJA 1OR7C 3G0QA 2R7UA 1PUQA 1MK1A 3L2WA 4U7BA 1MNEA 3W3CA 3DTIA 3M1CA 2E5NA 2KRHA 4NQWB 3RSNA 4CSWA 3K70C 2LH9A 2K5CA 3ZCOA 4XNFA 2B2KA 5CFIA 2B06A 3ONQA 5HNFA 1NG6A 2QKLB 2X1EA 4ZDPA 3BCBA 3N77A 4KG3A 3SHDA 1X1CA 1X19A 3CP2A 3G2BA 1HZTA 3K4CA 3HL2A 3M8JA 2RREA 2R7VA 4AU7A 3P5TA 3S93A 1D1CA 1I9AA 4XORA 1LDKB 1WJ5A 4Y33A 4YELA 3KYLA 2W1OA 3DU5A 2GOXB 1X83A 2M3AA 1V8TA 3Q2SA 2CFOA 2JA2A 1BR2A 3D5RC 1QVJA 3HXLA 3ZGKA 4ICKA 3MKZA 4ZDLA 3VYUB 3Q91A 2IGOA 4LIUA 3QODA 3V42A 2HPIA 2R7RA 3EESA 2VQLA 3GZ5A 3A4CA 4LITA 2LY1A 4P5OA 3P6YA 4N1TA 4KG4A 3VYTB 3D5LA 4XOTA 4E7SA 2PQVA 5HOOA 3F6AA 3A6UA 3OYEA 2NOJB 3L2QA 2A8TA 5ANSA 2E5ZA 3LSIA 4H4KC 3S8PA 2DHOA 4PJNA 1RRQA 4BJ6C 2LYCA 2HPMA 3X0SA 4ZJZA 2KPMA 2W4EA 2LC2A 2GT4A 3MD2A 4NNJA 2O5RA 4YPHA 4DIQA 3DLAA 3OYJA 2IGNA 2LREA 1X1DA 2UWMA 1ERDA 1WJCA 5BS6A 3PL8A 2JVBA 3OYDA 2UV1A 1SU2A 4CCKA 5FROA 4XKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJY A;  2O5W A;  3FK9 A;  2PNY A;  1VC9 A;  2YVO A;  5DDG A;  4MPO A;  2FML A;  3O6Z A;  3SON A;  3FSP A;  3EF5 A;  1U20 A;  1X51 A;  4NFX A;  1V8Y A;  3I7U A;  3O8S A;  2VNP A;  4ZG0 A;  2GB5 A;  5DEQ A;  1VCD A;  3X0J A;  5ANU A;  1PVF A;  4IJX A;  5C7T A;  2A8S A;  2ICJ A;  4S2X A;  4C9X A;  1XSB A;  1KT9 A;  1R67 A;  5IW5 A;  5ISY A;  1VK6 A;  5IW4 A;  1MQW A;  3MCF A;  2CL3 A;  2AZW A;  3R03 A;  4V14 A;  3MDI A;  1PPX A;  1Q54 A;  2KDV A;  3ZR0 A;  4JZS A;  1MQE A;  1XSA A;  1VIU A;  2YYH A;  3FFU A;  5FSK A;  3X0Q A;  2G73 A;  5CFJ A;  1MP2 A;  1Q27 A;  2DSB A;  3A6T A;  3BHO A;  3F13 A;  2I8U A;  1XSC A;  2FKB A;  2G74 A;  1V8W A;  1NQZ A;  2I8T A;  3I7V A;  4KYX A;  2VNQ A;  5FSM A;  3SMD A;  1VHG A;  3EEU A;  3N9U A;  3X0I A;  1VC8 A;  3ID9 A;  1G9Q A;  2RRK A;  3GRN A;  3WHW A;  3KVH A;  4HVY A;  5GHJ A;  1HX3 A;  4K6E A;  1K26 A;  5C7Q A;  5FSO A;  3L85 A;  3X0O A;  2QJO A;  2ICK A;  4NFW A;  1KHZ A;  3MGM A;  1SOI A;  3ACA A;  1VIQ A;  3H95 A;  5FSL A;  1PUS A;  4KTB A;  1F3Y A;  3X0P A;  5FSI A;  1JRK A;  1PUN A;  2DSD A;  3AC9 A;  3G0Q A;  5ANT A;  1TUM A;  2B0V A;  1PUQ A;  1MK1 A;  2KDW A;  3FCM A;  1JKN A;  3O69 A;  3Q4I A;  1NFZ A;  2QKM B;  2J8Q A;  3O52 A;  4HFQ A;  2B2K A;  1PPV A;  1V8I A;  1VHZ A;  3O61 A;  5I8U A;  1Q33 A;  2A8R A;  1V8V A;  5CFI A;  2B06 A;  1RRS A;  1V8S A;  2A6T A;  1V8M A;  3DUP A;  5FSN A;  5LPG A;  1K2E A;  2QKL B;  3I9X A;  3N77 A;  4KG3 A;  5GHP A;  5GHO A;  3SHD A;  1HZT A;  3E57 A;  3GG6 A;  4JZU A;  2Q9P A;  1V8L A;  4S2V A;  2YVN A;  3X0K A;  4YPR A;  3U53 A;  3P5T A;  5ANW A;  1I9A A;  2QJT A;  4S2Y A;  1GA7 A;  5C8L A;  2O5F A;  4DYW A;  2XSQ A;  3BAP A;  3BM4 A;  4S2W A;  3ZR1 A;  2I6K A;  3HYQ A;  1X83 A;  1V8T A;  1X84 A;  2YVM A;  3FJY A;  3Q2S A;  5GHI A;  1QVJ A;  4C9W A;  2DSC A;  3A6V A;  1RYA A;  3GZ8 A;  1SZ3 A;  4ICK A;  1MR2 A;  3RH7 A;  5ANV A;  3EXQ A;  1V8N A;  2GT2 A;  3Q91 A;  2A8P A;  1PPW A;  3A6S A;  3Q1P A;  3EES A;  3GZ5 A;  2A8Q A;  3P6Y A;  2YVP A;  5DD4 A;  3Q2T A;  4N1T A;  4KG4 A;  4JZT A;  1IRY A;  3Q93 A;  1OW2 A;  2DUK A;  2FVV A;  3GWY A;  2PQV A;  3F6A A;  3A6U A;  5ANS A;  2A8T A;  1G0S A;  2DHO A;  5GHM A;  5GHQ A;  4ILQ A;  5HZX A;  3J7Y e;  3X0S A;  1RRQ A;  3X0L A;  1VRL A;  2W4E A;  3COU A;  3X0R A;  2GT4 A;  2R5W A;  5DPK A;  3X0N A;  1MUT A;  5GHN A;  4YPH A;  4N1U A;  2O1C A;  3OGA A;  3X0M A;  3GZ6 A;  3CNG A;  3MDG A;  1KTG A;  1NFS A;  3HHJ A;  5BS6 A;  5BON A;  3DKU A;  2JVB A;  1NQY A;  1V8U A;  3QSJ A;  1V8R A;  1SU2 A;  4JZV A;  4YOQ A; 
#chains in the Genus database with same CATH topology
 2O5W A;  2NVX J;  1G3W A;  2IVM A;  2GA2 A;  2LLK A;  3ABT A;  1R23 A;  4KIS A;  2GBY A;  3QOP A;  4UV8 A;  4RB1 A;  4N4O B;  1QPI A;  4RLF A;  5IT3 A;  3ECH A;  3BR3 A;  2VKH A;  2M4K A;  1VI0 A;  4K2E A;  5LGT A;  4RMN A;  2LG4 A;  3AG2 H;  4OMZ A;  5JVG F;  2Z5U A;  5DUK A;  3ESW B;  3R03 A;  5FFZ A;  1Q54 A;  3COA C;  1OCO H;  2M9H A;  2HWV A;  2FNA A;  3DWL E;  2HYJ A;  5JFR A;  3GTQ J;  2YYH A;  1FBU A;  2BY1 A;  5J47 A;  4ON0 A;  1ON1 A;  1WZ2 A;  5HLG A;  1Z1D A;  3I7V A;  4G6T B;  3BJA A;  1DGR M;  1O3Q A;  3PO3 J;  3S1M J;  3SMD A;  1TQM A;  4CYC B;  1DP3 A;  2CH0 A;  2D1V A;  5E20 A;  3A2K A;  3WHW A;  4Y4R A;  5HLT A;  3FXQ A;  2W82 A;  1BI3 A;  2W7N A;  4PUS A;  5IY5 H;  4UNO A;  1SD4 A;  2LRD A;  2HOE A;  3TO7 A;  3L85 A;  3X0O A;  1JKO C;  4YEJ A;  1R5I D;  4XBF A;  4G7Z F;  3E5X A;  1STZ A;  2DT6 A;  5D4R A;  4ABZ A;  1P4X A;  2LTP A;  2QLZ A;  3S3M A;  4XKV A;  2RGV A;  1G3T A;  1H9G A;  4G8X A;  1MIJ A;  3PIO F;  2YU3 A;  4E7H A;  3CDH A;  3O69 A;  3Q4I A;  2IGM A;  4FIS A;  1E3H A;  3S14 J;  1V8I A;  1I50 J;  1ZK8 A;  1FPQ A;  4DBR A;  3MQ0 A;  1LVK A;  4IJA A;  5F27 A;  2E19 A;  3DBH B;  3BP8 A;  1LFB A;  5F04 A;  5K1Y A;  2XRL A;  3IAS 2;  4LG3 A;  1ZR2 A;  3JRB A;  2ZXH A;  2I6K A;  2RNJ A;  2QQB A;  3H0D A;  3GME A;  4M6X A;  2CW8 A;  2V9V A;  2P6S A;  2W84 A;  2H1K A;  4DGW B;  9ANT A;  3A6S A;  4JOM A;  1JT6 A;  1MDM A;  5D5V B;  1B8I A;  5FKO A;  1TNS A;  3Q2T A;  3H92 A;  4ZYA A;  4NQW A;  5KVR A;  1DU6 A;  4WF2 A;  2ZBK A;  2LSO A;  2VE8 A;  3X2Q H;  3GLX A;  2B7E A;  1HA8 A;  5K5Q A;  3BQZ A;  4D5C A;  4ILQ A;  2KT0 A;  4PGH A;  2KMU A;  1BW5 A;  2CW0 F;  4XLN F;  4HF0 A;  2DK8 A;  4BL0 B;  1SAU A;  1RI7 A;  2M87 A;  4HG2 A;  4L9N A;  5M5Y J;  4JYK A;  1R9T J;  2A61 A;  1KON A;  2E1C A;  4QPO A;  4JZV A;  4CUG A;  4YOQ A;  3CCE I;  1ZGJ A;  1LB2 A;  4J00 A;  2FML A;  3QU6 A;  4F3Q A;  2F5E A;  4WXC A;  3ZXS A;  2HDD A;  2L3D A;  1FJL A;  4Y52 J;  4OOI A;  4DZJ A;  3GFI A;  2VNP A;  2W48 A;  4C2U A;  3CDI A;  2P6T A;  2FA5 A;  4HZF A;  2A8S A;  5E79 C;  4F52 A;  5EZG A;  2COB A;  1JKP C;  1T39 A;  1LVA A;  1G3Y A;  2FJ1 A;  4CCN A;  2LBF A;  2NS8 A;  3LSM A;  4MO7 A;  1VQ7 I;  1ZG1 A;  2R92 J;  3CC4 I;  4B48 A;  5LRS A;  3FMS A;  5FSK A;  2ZFU A;  1Y39 A;  5CFJ A;  3S32 A;  3L00 A;  4HSR A;  1XSC A;  1ETW A;  2EWN A;  2OPT A;  1TT5 B;  1DGW Y;  1XDS A;  3LSJ A;  4J01 A;  1G9Q A;  2CQQ A;  3OYA A;  4A2U A;  4DYC A;  1S7A A;  5F0H A;  1TP4 A;  3AL0 B;  4RB0 A;  3DKX A;  4HRI A;  3N97 A;  1VQ6 I;  3F9K A;  4M9X A;  4LK0 F;  4M3G A;  1VQ5 I;  1L0O C;  2FUG 2;  3MKL A;  2DI3 A;  2LF7 A;  1E2X A;  3R61 A;  4M73 A;  1K78 A;  1KU7 A;  4KFC A;  5ANT A;  2QUF A;  5DV5 A;  1H88 C;  1BR1 A;  3I58 A;  1VQL I;  3R4K A;  2L7M P;  4AIJ A;  5FRM A;  1RKT A;  3HSE A;  1YX3 A;  2EV6 A;  5M3M J;  1Q33 A;  2A8R A;  5L3D A;  1U78 A;  3VWB A;  3I4N J;  1V8V A;  3F8F A;  4PJL A;  3OL4 A;  1ACI A;  4O6J A;  5EYR A;  3QOE A;  3JAM K;  4CYC A;  2YVN A;  3X0K A;  1LJ9 A;  4EAT A;  2OZU A;  3GTL J;  5TRD A;  2L9R A;  1YW8 A;  3FMQ A;  3H36 A;  2OC6 A;  1LQ1 A;  4S2W A;  1USS A;  2V1U A;  4N9H A;  3WE2 A;  1WJA A;  4RGX A;  3SZP A;  3E0J B;  1WJF A;  1XMX A;  3CCJ I;  2RQQ A;  2PJR B;  2F6C A;  4M6V A;  2JA7 J;  4GFB A;  1I6X A;  1UHW A;  2A8Q A;  1U9O A;  4ZZL A;  3L2C A;  1R1V A;  2QVO A;  2XRN A;  3FF5 A;  1ZHF A;  4F93 B;  5F1J A;  4OIQ F;  2WBM A;  3G4S I;  2ZSI B;  2L7K A;  1MBG A;  1RPW A;  3J7Y e;  4LJZ F;  5E1W A;  2K4B A;  5GTI C;  5LGU A;  2AS5 F;  2R4G A;  1H89 C;  3X0N A;  2HVQ A;  4N1U A;  2ELK A;  1LKX A;  4ETS A;  2EZK A;  2KDZ A;  3N4M A;  3DF8 A;  5HNH A;  3CUO A;  5ICE A;  4E7J A;  3S2H J;  3ABU A;  2ADU A;  2D5V A;  1NQY A;  1FYK A;  4YRV A;  1YQA A;  2HQA A;  4HA8 A;  3OYG A;  1FTT A;  4AYB N;  2A6H F;  2G9W A;  5C4X J;  1W1W E;  2NAZ A;  4KMU X;  4D1Q A;  5H6R A;  1V5E A;  2XVC A;  5J8C A;  4NUB A;  3F8B A;  3O8S A;  4B09 A;  2K9S A;  1J9I A;  2YSR A;  1EKE A;  1ZLJ A;  2ACJ A;  3KEY A;  2R7D A;  4JX5 A;  1A31 A;  3KLN A;  4IVN A;  2DFF A;  2DJN A;  2E1O A;  1VQ9 I;  4O3M A;  1ZGA A;  1VK6 A;  4UUS B;  2M2E A;  2EV0 A;  4C30 A;  1A6Q A;  1TC3 C;  1CGP A;  2OUM A;  4H0E A;  2DSB A;  5C44 J;  1JGG A;  2X6Y A;  1RIO H;  2P81 A;  1NQZ A;  3ISP A;  1U3E M;  3HPG A;  1OMI A;  2DQR A;  1VC8 A;  2MLG A;  2XV4 S;  1QU3 A;  4DQ2 A;  3PFI A;  2DMU A;  2M7A A;  5AIQ A;  3O8H A;  3CMY A;  1GHC A;  2LR8 A;  4ANJ A;  1TWG J;  2X6W A;  2JMW A;  4HF1 A;  2K3P A;  2EH3 A;  3G73 A;  1IXC A;  4F7Z A;  4FTH A;  3WTZ A;  1SOI A;  4KDP A;  2RQP A;  2O7O A;  4BXX J;  1PUS A;  3K1P A;  1LUJ B;  1YRN B;  4RBO A;  2AQE A;  1I5Z A;  1YX5 A;  1APL C;  3PM1 A;  2KIQ A;  3ZMS A;  4X6A J;  4MFD A;  4A3G J;  3WTW C;  5HS9 A;  3GTO J;  1G6N A;  3DUP A;  4A3M J;  3HDD A;  4Y17 A;  1IN6 A;  4OU0 A;  5F6F A;  2KP6 A;  1ODD A;  3Q9V A;  1KQ9 A;  1ULY A;  3HKZ N;  3S3O A;  4S2V A;  5JLW A;  2Z16 A;  1B4A A;  3IWF A;  2KZG A;  4BEH B;  2VOP A;  3GLL A;  4S2Y A;  3QYF A;  2XSQ A;  4LIV A;  4RGR A;  4AUX A;  3J7Z I;  3CCV I;  3S16 J;  1X4P A;  3RIR A;  3I4M J;  1IN8 A;  1RYA A;  5L3B A;  3GEZ A;  3KEO A;  4PZJ A;  2E36 A;  2WA0 A;  4GYG A;  6PAX A;  5J4V A;  1E3P A;  5B3S H;  3BZK A;  1XTA A;  4IO9 F;  1SFK A;  3FIS A;  1L3L A;  1P9Q C;  2ZC2 A;  1IRY A;  1OW2 A;  3RQI A;  3MEX A;  1G59 A;  3H9J A;  3NEU A;  1BOA A;  2OCE A;  4M3D A;  2ID3 A;  2CQN A;  3X0L A;  2EA2 A;  4CH7 A;  3W2A A;  1GVD A;  3C18 A;  2FX0 A;  1ZGW A;  4HNV A;  5DPK A;  3K9T A;  2F4M B;  2R7X A;  2JJ7 A;  4XLE A;  2E7X A;  1R5G A;  3GTJ J;  2IEK A;  1I3A A;  2MH9 A;  2QSF X;  1IDZ A;  1BBY A;  1IN7 A;  3BR2 A;  1C0W A;  5FD5 A;  4GRI A;  4XID A;  1RRS A;  3HRU A;  3G71 I;  4P1W A;  5ED4 A;  4RAF A;  3EUA A;  3FIW A;  3LA7 A;  2BOL A;  4EGZ A;  1T0F A;  2OTJ I;  1WI3 A;  3PQK A;  1KZH A;  4XL9 A;  1SVL A;  1I1G A;  2XF6 A;  2HGC A;  2O6G E;  4EJT A;  3PSF A;  2JPC A;  1U2W A;  2CJJ A;  3IH3 A;  3K2Z A;  2CS3 A;  4B43 A;  1YW7 A;  3JRA A;  2H8W A;  1P4A A;  3CTA A;  4JX6 A;  3HG9 A;  4BQA A;  3FXM A;  3HOY J;  3F23 A;  1W5C C;  5A2Q Z;  3A03 A;  2BYV E;  1VIU A;  4A12 A;  2K9L A;  2HOT A;  2L5Q A;  2TRT A;  3F13 A;  3LFU A;  2BBY A;  3FXK A;  1OIS A;  4D0P A;  3IL2 A;  2IA2 A;  3KZY A;  1RUN A;  3EEU A;  4FX0 A;  1IN5 A;  3GTK J;  1VQP I;  2R0Q C;  2DJI A;  3TKY A;  3G3Z A;  3LSH A;  4UVA A;  4A69 C;  3ZMT A;  3HOT A;  5C7Q A;  2FBH A;  2M8E A;  3GWZ A;  1SFE A;  5E8G A;  5HLH A;  3RI4 A;  4E4H A;  3BPV A;  3DEE A;  2HOA A;  4RA2 A;  5DM6 F;  2X48 A;  4RS8 A;  3K4N A;  1FSE A;  4NC8 A;  4DZP A;  2IS2 A;  3SZT A;  2JWT A;  3LSR A;  4A6E A;  1OR7 C;  5EF6 A;  3WTS C;  4UUS A;  1PUQ A;  2Q0O A;  3L2W A;  3CCS I;  3BTL A;  1W4M A;  1LPQ A;  1NFZ A;  2LH9 A;  4XNF A;  1R5H A;  3CC7 I;  1WI9 A;  2QKL B;  4KG3 A;  1SEU A;  3JSO A;  3W6J B;  3M8J A;  2RRE A;  4AU7 A;  3P5T A;  2O3F A;  3WOD F;  2LKP A;  1Z6T A;  2GOX B;  5IYB J;  5B66 C;  1PDN C;  2M3A A;  1ONV A;  1X83 A;  3Q2S A;  3MKZ A;  3CCY A;  3SXY A;  4ZDL A;  3KP2 A;  3Q91 A;  2HPI A;  1YRN A;  2EFN A;  2R7R A;  2VQL A;  1VQO I;  3LOC A;  4HF2 A;  4A0X A;  2NVY J;  1RZ4 A;  2HKX A;  2GWR A;  4E7S A;  1X58 A;  1VTN C;  5HOO A;  3A6U A;  2M34 A;  1V4R A;  4PJN A;  2VOO A;  4L0Z B;  3NAR A;  4ZJZ A;  2GT4 A;  5HOD A;  2EFQ A;  5CVI A;  5CYV A;  4NNJ A;  5ICC A;  1YG2 A;  4AIK A;  1I6H J;  2K85 A;  4HQM A;  3TO6 A;  3H3V K;  1IUF A;  3OYJ A;  1X1D A;  1HST A;  2KJC A;  1S7O A;  4CZZ A;  2DN0 A;  3PL8 A;  3G6E I;  1NK3 P;  2JRM A;  1TQP A;  2V1D A;  1OCC H;  4CCK A;  1W5S A;  1IXS B;  4XKC A;  3WGH A;  2HEO A;  2H8R A;  4OIP F;  2KHM A;  1YW9 A;  2K9Q A;  2NOG A;  3K1M A;  3VOE A;  5M3F J;  3KYD B;  3SON A;  4AD9 A;  1LEA A;  2QQ9 A;  3E7L A;  2CUF A;  5ILS A;  1PJR A;  1V5F A;  4XR6 A;  1D8J A;  1AA7 A;  4HLY A;  3I7U A;  3OL3 A;  3NQO A;  4N9I A;  1R71 A;  1VCD A;  3E1S A;  4Y13 A;  1MNM C;  4IJX A;  1RC9 A;  1UFM A;  3QPL A;  4IZZ A;  3DTK A;  3DBL B;  3LA3 A;  1JXS A;  1ZRD A;  4WXH A;  1BJZ A;  4N0B A;  5ISY A;  3I53 A;  1MD0 A;  3K4B A;  4B3X A;  1PYV A;  4RAG A;  4XRS G;  4ITV A;  1Y6I A;  3CLO A;  5FRN A;  2M0M A;  2W00 A;  4NDL A;  5CVJ A;  4AWX B;  2H1L A;  3JTH A;  1MMA A;  2P5L C;  1Z9C A;  2FKB A;  2HQ5 A;  3K4J A;  2E1N A;  4OWR B;  4WK8 F;  1P7I A;  2B63 J;  1VHG A;  5DCF A;  3N9U A;  2HDC A;  1LE8 B;  4O5V A;  4EEF G;  3N05 A;  4EM1 A;  4UVB A;  2XHK A;  2BXY A;  3U2R A;  3LWF A;  1Z3Y A;  4K6E A;  4OAY A;  3TP0 A;  2XF5 A;  1GXQ A;  3DPT A;  2XAU A;  3FHN A;  2DDB A;  2WY7 Q;  4IEJ A;  2ZCW A;  1MSE C;  3J80 Z;  2O03 A;  4Y7N J;  5FSI A;  4HYE A;  2WB1 A;  5FLX Z;  3Q0W A;  1IAW A;  1RRJ A;  3ZMV A;  1RES A;  1S72 I;  4IRG A;  3JRH A;  2G7H A;  5K7Z A;  1T95 A;  1G2H A;  2ID6 A;  3I9X A;  2FXA A;  3BPX A;  3TL4 X;  3JSP A;  2GZW A;  2Q9P A;  1JUS A;  4E6K G;  1IRZ A;  4EMS A;  2V1N A;  2VN2 A;  3HUG B;  2BVM A;  5ANW A;  1GA7 A;  5C8L A;  4OIN F;  4MTE A;  2W24 A;  3KPH A;  3I71 A;  2ME0 A;  3WHB A;  2WWY A;  1UB9 A;  2YVM A;  3FJY A;  2AHQ A;  3R6S A;  2L02 A;  1SFU A;  1Y1V J;  4E7L A;  4Z6Y A;  5FJ8 J;  3SEZ A;  4QIW N;  3KET A;  3RH7 A;  1MW7 A;  4KN7 X;  1XDU A;  2HKO A;  2VKD A;  4HV5 A;  3ROU A;  2CV2 A;  2A5Y B;  2MA3 A;  1Z3X A;  3ZR8 X;  1BN5 A;  3OYI A;  5D8L B;  3M8F A;  2FVV A;  4CDG A;  1D1B A;  1IDY A;  2EFW A;  2OF7 A;  3FWE A;  3BY6 A;  2QWW A;  1QBJ A;  3SEQ A;  4OIR F;  5BPD A;  3BG5 A;  2ZXW H;  2VXD A;  2WAD A;  4P96 A;  3HRT A;  2MFZ A;  5ICF A;  4XLH A;  1XG1 A;  3X0M A;  4QSH A;  3I5U A;  2HR3 A;  4MFE A;  3C3W A;  3Q0V A;  2X51 A;  1Z67 A;  1S9H A;  3TO9 A;  1NFS A;  3QQA A;  5BON A;  1IRF A;  1QGP A;  1EH6 A;  5C4J J;  1A36 A;  2DT7 B;  3LSK A;  2DDA A;  3RTR A;  3JRI A;  2QZ8 A;  3LQQ A;  4I0B A;  2JA8 J;  2JUC A;  5DDG A;  1MBE A;  3PNV A;  4BDZ A;  2DOA A;  1QO0 D;  2CUZ A;  1J7K A;  2RDP A;  3HOZ J;  1R4M B;  5F0C A;  1E0E A;  5ANU A;  4DOZ A;  3PNT A;  5HDG A;  5J1R A;  3OS1 A;  2IA0 A;  5D6E A;  2XKO A;  3KFW X;  1QPM A;  1V3F A;  2KZV A;  1R67 A;  3GTG J;  5FD6 A;  4MHG A;  4JZS A;  1S29 A;  4A0Y A;  2H94 A;  1BIA A;  2ZJQ F;  2IRF G;  5M5W J;  2IBD A;  2QQA A;  5CKT A;  3BHO A;  2WAE A;  3GBG A;  3BG6 A;  2V26 A;  4RM2 A;  4KYX A;  2LKS A;  3BR1 A;  2FD5 A;  2NXN B;  2HS5 A;  2RRK A;  3BQY A;  3KVH A;  1HX3 A;  2NVQ J;  3SHF A;  1I27 A;  3KP6 A;  4YIF A;  3HOX J;  2VAS A;  2HTJ A;  3S17 J;  4CZC A;  3S3N A;  4NFW A;  3JTG A;  4DBQ A;  5D5X B;  2QA4 I;  1HOM A;  5E17 F;  3H95 A;  1VQK I;  5DD8 A;  4BAY A;  3J7Y J;  3TP3 A;  1XD7 A;  4KTB A;  4YFN F;  1O3S A;  1JTX A;  1GXP A;  1YLF A;  2K9M A;  2CUJ A;  2W85 A;  2CMP A;  4ZYG A;  3FBI B;  3IH4 A;  2EV5 A;  4LB6 B;  4XRS A;  5FLV A;  2UUZ A;  3OYK A;  4IQJ A;  3BR6 A;  2VI6 A;  1I39 A;  3WG9 A;  1PPV A;  3O61 A;  4BNC A;  3K69 A;  3PO2 J;  1LEB A;  1BOB A;  1V8S A;  1R6R A;  1DUX C;  1WJE A;  5GHP A;  3BG9 A;  2PN6 A;  3T1B A;  1QVU A;  1UHS A;  2EZI A;  4LMY A;  1LE8 A;  1FP1 D;  4DYQ A;  5IP7 J;  1AWC A;  3MN2 A;  1W7P B;  3G1L A;  4M6Y A;  3AG3 H;  4JX4 A;  3A0H C;  3HBL A;  1W36 D;  2L9N A;  3ZR1 A;  1NTC A;  1EH8 A;  3LAP A;  4UXN A;  2V9P A;  4L5I A;  3BCA A;  3K6G A;  5GHI A;  3OIP A;  4RDU A;  3IC7 A;  3A6V A;  3BWG A;  1JKR C;  3KEQ A;  1EH7 A;  2HXI A;  1N75 A;  2KJB A;  4BQO A;  1FOW A;  4A3F J;  3HB9 A;  5BOX A;  3M3Y J;  2A3S A;  1PPW A;  2OD5 A;  3IV5 A;  1Y8R B;  2JVG A;  4V19 K;  4XN0 A;  2YVP A;  2L7Z A;  5IYD J;  2Y75 A;  5M5X J;  4GYI A;  3CCU I;  1XMK A;  4IHX A;  3DBR B;  3PNY A;  2ME6 A;  4XKW A;  3FXR A;  2BEO A;  4PJM A;  1XMA A;  3JRG A;  2VC1 A;  2O9L A;  4OIO F;  3BDD A;  3HUG A;  4HBL A;  3SZG A;  2EPF A;  2DA5 A;  3MCZ A;  1IW7 F;  3SDB A;  1FY7 A;  5GP9 A;  3RYR A;  3P5J A;  2HDW A;  4GXO A;  5B5E C;  2Q8K A;  1K79 A;  5KCM A;  3H1C A;  3U1K A;  2IT0 A;  3K7A J;  2BXZ A;  1T56 A;  2O8X A;  3DU6 A;  3GZN B;  1F1Z A;  2X9D A;  5EDN A;  3TOB A;  3CMM A;  1U20 A;  4NFX A;  3HOS A;  1ZYR F;  2X1C A;  1Z91 A;  1WFX A;  1VND A;  3AKZ A;  5C7T A;  3SQN A;  1HF0 A;  4LD5 A;  2XIG A;  5L3G A;  4BY7 J;  2LMD A;  3NWT A;  1FC3 A;  2VL8 A;  4PCQ A;  4BQQ A;  1J0R A;  4IHT A;  2DPU A;  4A3L J;  1HDP A;  2RAE A;  3FK7 A;  3PQJ A;  2FNP A;  2F48 A;  2IS4 A;  1MZB A;  2PJP A;  3T8T A;  4BUP A;  3S2D J;  4KIB A;  1YIT I;  1JKQ C;  2RVC A;  1Z6R A;  3S2W A;  4HVY A;  1ON2 A;  3KIO A;  5FSO A;  1QA6 A;  2F5C A;  4BH9 A;  1MJB A;  3RKQ A;  2UXX A;  3ML6 A;  2KIU A;  1GUU A;  1K6Y A;  1X1A A;  5BMZ A;  1FP2 A;  3BZC A;  3MGM A;  2EQR A;  4XLA A;  3UR3 C;  1VQ4 I;  2DLL A;  3J81 K;  1FWZ A;  2R7T A;  4UUT A;  3F0C A;  4KIC A;  4P9F A;  1V55 H;  4A3K J;  2DSD A;  1O3R A;  3AC9 A;  5LFA A;  4F55 A;  1ETY A;  1P92 A;  2Y0M A;  4PJ0 C;  4EM2 A;  4FAS D;  2VBW A;  4BJ5 C;  3GO5 A;  1ZQ3 P;  1ZEL A;  2DYR H;  2LNB A;  3P7N A;  2J8Q A;  4QLC U;  1VHZ A;  2IGK A;  3GFM A;  5CJ9 A;  2DOE A;  5FO5 A;  3WTU C;  3HRS A;  2BY3 A;  3H9G A;  4G94 A;  3ZN0 A;  3AL0 C;  4IX7 A;  4RGU A;  3U53 A;  2R5Y B;  4YIR X;  2QQ8 A;  2OJE D;  5E1X A;  1QRY A;  1FMW A;  4L5J A;  1QZZ A;  5JHF A;  3E97 A;  4C9W A;  4B1R A;  2TCT A;  1H8A C;  2WV1 A;  4RM3 A;  1WJD A;  1UMQ A;  3QPH A;  1JHF A;  1ETQ A;  1IUY A;  1TBX A;  2RV8 A;  3CO6 C;  1VQN I;  5J4Y A;  3A01 B;  1P2F A;  1FMV A;  2EJR A;  2BVL A;  3W6V A;  4G6D A;  2VOD A;  2Y2Z A;  3TOA A;  2PMZ N;  3FXL A;  1W0T A;  1IJW C;  2QSH X;  1IC8 A;  2GAU A;  3E5Q A;  3GX4 X;  1D5V A;  3DKW A;  4MGR A;  2VJJ A;  2MD5 A;  1UG2 A;  1ZRE A;  2M4G A;  4M72 A;  2P0W A;  3RJP A;  3PJR A;  1FYL A;  2GXG A;  5GHN A;  2O1C A;  2R7S A;  5GAD J;  2MSY A;  1D5Y A;  3HHJ A;  1CF7 B;  2V1X A;  5EGO B;  4XOP A;  4HX8 A;  1TT0 A;  3HHH A;  5J1U A;  1QQI A;  1T0F C;  3VOD A;  2CG4 A;  1WJB A;  1WQ2 A;  3K10 A;  3RPU D;  1K6O A;  2RKH A;  1MJ9 A;  3QP5 A;  4D9J A;  1X51 A;  4KT6 A;  3VDX A;  1JHH A;  2LF8 A;  2DA4 A;  2VQG A;  2XAJ A;  4HLX A;  4XIC A;  1JUM A;  2CSO A;  3WG7 H;  4C9X A;  2FBI A;  4NB5 A;  1XSB A;  2F5F A;  5IW4 A;  2GOM A;  1MJA A;  2AZW A;  3MDI A;  1HQC A;  3ZR0 A;  1H9T A;  1S7E A;  4CYD A;  1HKT A;  3QWL A;  3FFU A;  4IRI A;  3MZ8 A;  4DW6 A;  3FM3 A;  3EUH A;  1ZAO A;  2I8U A;  1QVT A;  1KYZ A;  3LFK A;  4LGW A;  1XGS A;  2X0L A;  1J75 A;  3BT9 A;  2KIM A;  5DCM B;  3L2R A;  1XGO A;  3JAM Z;  5EG0 B;  4TV7 A;  1SAN A;  4HNT A;  5LEK A;  2NVT J;  3V8K A;  2QBY B;  4OMY A;  3LAJ A;  2M5W A;  2OQR A;  3ABL H;  5HDN A;  1FIA A;  3O8G A;  4I0A A;  3GVA A;  3Q5F A;  1VIQ A;  2ZB9 A;  1F9N A;  5J3L A;  1W0U A;  3X0P A;  4UB8 C;  3G0Q A;  2PX9 A;  3M07 A;  1B72 B;  2VC0 A;  5CVR A;  3W3C A;  3J7A O;  2KRH A;  2XB5 A;  3FZV A;  2EB7 A;  2Z3Y A;  1EV7 A;  1YIO A;  2OU2 A;  5HNF A;  1Z77 A;  3EYY A;  4ZDP A;  4FHT A;  2IW5 A;  1HZT A;  3WHC A;  2HFH A;  5F08 A;  2R7V A;  1XGM A;  5CVV A;  1ZR4 A;  1D1C A;  3ABM H;  1LDK B;  1WJ5 A;  4YEL A;  2G7U A;  2F4O B;  3H0G J;  1A6I A;  1V8T A;  2N8G A;  4EQQ A;  2JA2 A;  1BR2 A;  2L4A A;  3ZGK A;  3BJ6 A;  3HGG A;  3CCL I;  1U5T B;  4LIU A;  3V42 A;  3F8N A;  4JBA A;  2E2J J;  4LIT A;  1OYY A;  1IRG A;  2PMU A;  4KG4 A;  3D5L A;  1WSU A;  1ZAR A;  4BXU A;  3OYE A;  5ANS A;  1FZP B;  3A0B C;  4AID A;  2ZJ2 A;  2R7F A;  2W4E A;  4RAZ A;  3V8J A;  4BYY A;  2DA7 A;  1KGS A;  1BI0 A;  2HQR A;  3JRC A;  1BI2 A;  3I64 A;  2IGN A;  2UWM A;  2R5Y A;  4E70 A;  1VQ8 I;  3LNQ A;  1YS7 A;  3DEW A;  2Z99 A;  4XSZ F;  2LFB A;  4CO8 A;  5K7F A;  1QZY A;  2UV1 A;  2Y9Y A;  4HX7 A;  1SVM A;  1R22 A;  1TTY A;  1S8N A;  1SJY A;  2I5U A;  1ZH5 A;  1VC9 A;  2PNY A;  3KLO A;  4UHT A;  5B1B H;  3O6Z A;  3JW4 A;  4U0W A;  1VZ0 A;  3IKV A;  3A01 A;  2X1D A;  1MSF C;  1YFH A;  2X6X A;  5KAF C;  2HYF A;  1MH4 A;  2Y31 A;  2PI0 A;  1BL0 A;  5IT9 K;  5E8I A;  1Z21 A;  4OAZ A;  5LHG A;  1IGN A;  5DM7 F;  2BZT A;  1W7P D;  1MQW A;  2E35 A;  4KIF A;  1DPU A;  1W5T A;  1SFX A;  2QEN A;  2R7O A;  3BTC A;  5IPA A;  1XSA A;  1F5T A;  2R93 J;  2R7Z J;  1Z7U A;  3OR1 C;  2LY2 A;  2PJR A;  2A68 F;  4BHB A;  2CU7 A;  4V2G A;  4BE1 A;  2DMQ A;  5D5W B;  1K83 J;  1M1E B;  2DW4 A;  3R0A A;  3BTJ A;  4XMY A;  4ZYH A;  3ZQ7 A;  5IP9 J;  3CF5 F;  4U87 A;  3TDU C;  1REP C;  4PDK A;  1BR4 A;  4KJZ A;  2CQX A;  2Y0S A;  4IF4 A;  4XKB A;  4RGS A;  4AVZ A;  3GFJ A;  1SFO J;  4PK4 A;  5GPC A;  1DU0 A;  1R4N B;  3LMM A;  3ZMD A;  1XSV A;  2OAZ A;  1JKN A;  4HFQ A;  4C2M J;  4Q47 A;  2MH2 A;  3ZQQ A;  2W25 A;  4MNU A;  1V8M A;  5LHH A;  3V4G A;  2VLA A;  2MC4 A;  3I0T A;  2IXS A;  1V8L A;  2JVH A;  5DCM A;  4DYR A;  1K4S A;  3C2H A;  1NK2 P;  3OS2 A;  2D1H A;  3A02 A;  2LKX A;  3QU3 A;  5EG0 A;  2JSP A;  3IKT A;  1B9M A;  2ZXJ A;  3BM4 A;  1XSX A;  2DFH A;  2QBY A;  3HYQ A;  1O7F A;  5GTH C;  1J5Y A;  3WGI A;  3GZ8 A;  2XB0 X;  2Z33 A;  1GV2 A;  2XPV A;  4XRM A;  4FQG A;  2GXA A;  4D7M A;  3I56 I;  1MND A;  2VJ5 A;  1F36 A;  4LG0 B;  1POG A;  5JHU A;  2B9S A;  3GWY A;  2GXB A;  4X0G A;  2VQH A;  3P9K A;  4XN3 A;  3H3Z A;  5KAI C;  4BJT A;  5KNL A;  2JT1 A;  4S05 A;  2KIF A;  2ZME B;  1EJ9 A;  1LNW A;  5EZH A;  4JZT A;  4I6Z A;  4QTR A;  1V5G A;  2DO7 A;  1MUT A;  3KP5 A;  5E3N A;  5TJJ A;  3U21 A;  2MYS A;  1G4D A;  1YIJ I;  4YFX F;  4YG2 F;  1B1B A;  1GVJ A;  3HM5 A;  3ZQC A;  1K4T A;  2STT A;  1V8U A;  1MR2 A;  2ZJR F;  2XPW A;  4II2 A;  4FE7 A;  2ESN A;  5CQG A;  1FT9 A;  3KP4 A;  5IOZ A;  1U5T A;  2KIS A;  3EF5 A;  1T33 A;  1PUF B;  3VFZ A;  2DFI A;  1HW2 A;  3OYH A;  2COM A;  1AHD P;  2OCC H;  1D3Y A;  3I55 I;  2C6Y A;  4ZTF A;  4WWC A;  2P8T A;  3K4L A;  2FOK A;  2KRC A;  1KT9 A;  3I3L A;  1Z0X A;  2EIK H;  2O8K A;  4BEH A;  3JRD A;  2E60 A;  2MAB A;  3CUQ B;  2VBZ A;  3O6B B;  4FCY A;  1SD7 A;  3OSF A;  2VXZ A;  4MEY F;  4YII A;  3A1Y A;  2DOD A;  4F91 B;  2M1B A;  1Y0N A;  1MMD A;  2VPR A;  4C2T A;  2EA4 A;  2PBI A;  3MMY B;  1TW2 A;  1SMY F;  4E7Z A;  2I8T A;  1PP8 F;  5K5O A;  3AAF A;  3KZI C;  5J40 A;  4ENK A;  5K7H A;  4KIG A;  2CV1 A;  2K40 A;  1AOY A;  1K26 A;  3OWT A;  1XGN A;  1R1T A;  5DUI A;  2VON A;  2VKV A;  4KUM A;  3HPH A;  2R7Q A;  3HGY A;  4B8X A;  2QJO A;  3BG3 A;  3E5U A;  4HEA 2;  1B9N A;  4LLG F;  3VEP A;  3ZQH A;  2CQK A;  1JRK A;  1PUN A;  3GF2 A;  3OY9 A;  3ZN1 A;  4BAC A;  2B0V A;  2ETH A;  1IV8 A;  1ZG3 A;  3CZ6 A;  3H5R A;  5I8U A;  2ZNY A;  4S0H B;  1H0M A;  2V6E A;  3FM5 A;  2M45 A;  3HZJ A;  1WWX A;  3VYR B;  4UY8 I;  1K2E A;  3DPL C;  2Y69 H;  2K3F A;  3E57 A;  3GG6 A;  2PMH A;  3OS0 A;  1IZ1 A;  3ERE D;  2XAQ A;  4M3F A;  5E3O A;  1PP7 U;  2DQL A;  1WKM A;  3BZ6 A;  2AXT C;  1D0Z A;  4A93 J;  2WC2 A;  5JLX A;  5BQT A;  3RYP A;  1MBF A;  1R49 A;  1DQU A;  1SAX A;  2DSC A;  5FKN A;  2F5D A;  1X4O A;  2FQ4 A;  1KYW A;  4DJA A;  1BA5 A;  2H6B A;  2A8P A;  2BHY A;  1JTY A;  4I01 A;  4IPA A;  5LHI A;  2H09 A;  2NS0 A;  3KP7 A;  5HS7 A;  2E1M B;  3QPT A;  5TIS C;  5D8K B;  1X1P A;  3F21 A;  1G0S A;  3I59 B;  2R5Z B;  3FKJ A;  1T98 A;  2FQ3 A;  3L2U A;  1VRL A;  2IS6 A;  3X0R A;  4MEX F;  3NAU A;  4ENM A;  1SMT A;  4M3E A;  2KRF A;  1S6L A;  2DA3 A;  1QHG A;  4B47 A;  1XSD A;  2DPD A;  1KTG A;  3ZOB A;  3WTT C;  4R1H A;  3IRQ A;  2XAH A;  4CGZ A;  2YS9 A;  3QSJ A;  5ANV A;  1WGX A;  4EM0 B;  4G7H F;  4EJW A;  3OYB A;  2M30 A;  4L18 B;  3CD6 I;  2A6E F;  2OQG A;  2FF4 A;  2L4M A;  2V7F A;  4J7H A;  2BW3 B;  3LST A;  2UZK A;  4LG0 A;  4ZG0 A;  4FT8 A;  1MGT A;  2XAG A;  2XRO A;  5DEQ A;  2Z9O A;  2DT5 A;  4D7N A;  4BE0 A;  2DK5 A;  1U8R A;  1T2K A;  3HEF A;  2ZME A;  4IKF A;  2EIJ H;  3LA2 A;  4BGD A;  1OFC X;  5FKL A;  5FKK A;  2L0K A;  1PPX A;  3TBI A;  4V14 A;  2XKP A;  3QAH A;  2RC4 A;  1MDM B;  1IO2 A;  3D0S A;  3HC7 A;  1RNL A;  4MIM A;  4ESB A;  3SJM A;  3OIQ A;  1O7L A;  4G9Y A;  3A6T A;  2VKE A;  3C2G A;  1A04 A;  4I98 B;  3W6K B;  3DP7 A;  2CFX A;  2EBI A;  4LOC A;  4R8H A;  1HCR A;  3S15 J;  3K2A A;  1HC8 A;  1LDD A;  3GXO A;  1D0Y A;  5ERI A;  3CJQ B;  1Z7L A;  1FX7 A;  3CCM I;  3H35 A;  5HLI A;  4C3J J;  4JP0 A;  3MAJ A;  1J2X A;  2IA1 A;  2H6C A;  3P9C A;  4UB6 C;  2ISZ A;  5LEJ A;  1OYW A;  2BV6 A;  4A3I J;  1XCV A;  2MC3 A;  5L3C A;  4XK4 A;  2A05 A;  2F2E A;  1N25 A;  1V54 H;  3CUQ A;  1ZRF A;  4BHP A;  2ZKZ A;  4GGG A;  3RQ4 A;  2XSJ C;  3RPQ A;  2EIN H;  4CCL A;  4MTD A;  1DP7 P;  2CZR A;  5D5U B;  1UHM A;  4NC7 A;  1U0J A;  2A6T A;  4IQ4 A;  1FOX A;  2XPU A;  5GHO A;  2IS1 A;  4RAY A;  1LDJ A;  5ILV A;  4JZU A;  4I02 A;  4L9T A;  2JA5 J;  1TZL A;  1YJW I;  2LBF B;  2YX7 A;  3B6C A;  2L2O A;  3H9Q A;  4NBQ A;  4WXD A;  3ASN H;  3QPS A;  3L2V A;  2O5F A;  3ZRG A;  2FMY A;  1QZE A;  1FNN A;  2VE9 A;  2EFO A;  1WPK A;  2VT3 A;  2JQ7 A;  5J6X A;  1Y56 A;  1TWA J;  3GYH X;  2LP0 A;  2A69 F;  3OYC A;  2E2H J;  2M8G X;  3AFH A;  4HAM A;  2B0L A;  2JK3 A;  1YI2 I;  2E2I J;  3P9I A;  1Z05 A;  3CMA I;  3J7A Y;  3Q93 A;  2DFE A;  2DTZ A;  3F6V A;  1WHU A;  3B73 A;  2XF7 A;  5L3E A;  1K78 B;  4E7K A;  1CQT A;  2PLY A;  1WRJ A;  2LVS A;  3MVP A;  4GCV A;  4MLO A;  4DNC A;  1LFP A;  5L3F A;  3COU A;  2VIX A;  2QGU A;  1JT0 A;  2UXN A;  1HW1 A;  5D6F A;  4LLN A;  3B6A A;  3QYE A;  4IHW A;  3HSR A;  3G1O A;  3BR5 A;  2LOO A;  3ASO H;  4KN4 X;  2QSG X;  3O2P E;  5LGN A;  2YVO A;  3H5A A;  4RLQ A;  2KQR A;  3U9G A;  3RPU A;  2Y9Z A;  1K7A A;  2VQC A;  3PFY A;  3MKY B;  5FKM A;  3HOU J;  4Q5S F;  3CQZ J;  5IP6 A;  3BG7 A;  4QPQ A;  2OA4 A;  5J1Y A;  4G12 A;  3DQV C;  5CLS A;  5EEA A;  1QHH D;  3CC2 I;  2HVS A;  3I59 A;  2R5Z A;  1MBJ A;  1UG0 A;  5ICG A;  4KYW A;  4EVI A;  1JUP A;  3EUH C;  2Z1D A;  1KU2 A;  4ZYE A;  4A6D A;  3EYI A;  3HTU A;  1JGS A;  5CQE A;  4IHS A;  1TWC J;  3X0Q A;  4L9V A;  1I1S A;  5BNG A;  4KIT B;  3I4P A;  3VSK A;  1ZTR A;  2KDO A;  3FKI J;  1V8W A;  2BY2 A;  4UVC A;  2DBB A;  4KA4 A;  3X0I A;  2EIL H;  5JI6 A;  2DA6 A;  3ID9 A;  3ZMU A;  4PFO A;  2K9N A;  1T8I A;  4ZTJ A;  5H6Q A;  1ETV A;  3RCO A;  3HRM A;  5D4S A;  2BW3 A;  3UKG A;  4BBS J;  2WAQ A;  2DAO A;  4ENJ A;  4CCM A;  3B02 A;  2FU4 A;  1OYI A;  4A5M A;  2RNG A;  4CCJ A;  3FMR A;  4HDU A;  4Y15 A;  4U7B A;  1HDD C;  3KP3 A;  1MNE A;  3F3X A;  1Y0U A;  2QF7 A;  2DA2 A;  2CQ7 A;  3DTI A;  2E5N A;  2B2K A;  1ETK A;  2K5C A;  1RET A;  3FK6 A;  3OV8 A;  1NG6 A;  3BCB A;  3SHD A;  1X1C A;  2HI3 A;  5AIP A;  3G2B A;  3E6D A;  3K4C A;  3HL2 A;  2FBK A;  3S93 A;  4L9J A;  3EQL F;  3CME I;  1WCM J;  2XSD C;  3DU5 A;  1MKM A;  1E17 A;  3RKW A;  4I7H A;  3D5R C;  4ZYD A;  3CO7 C;  3HXL A;  5BPI A;  3RKY A;  4ICK A;  1UST A;  1FYM A;  2CUE A;  1KU9 A;  2ECC A;  2IGO A;  2BGC A;  4KMF A;  3QOD A;  5JVT A;  2VBX A;  3GZ5 A;  2DU9 A;  1SVO A;  4P5O A;  1BM9 A;  4YFK F;  1A5J A;  2IAI A;  3ERM A;  2PQV A;  2ZJP F;  2NOJ B;  2P5K A;  3L2Q A;  2A8T A;  4H4K C;  3S8P A;  2DHO A;  1XN7 A;  1RRQ A;  4BJ6 C;  2HPM A;  2KPM A;  4XLP F;  2LC2 A;  1P7J A;  2IPQ X;  2EFP A;  3DLA A;  4EJU A;  3CLQ A;  2LRE A;  1WJC A;  4XSX F;  1OCP A;  4EGY A;  2O0Y A;  3F6O A;  4A3E J;  3BTI A;  2QCO A;  3V7C A;  5FRO A;  1D8K A;  2DXI A;  2QM3 A;  2OV7 A;  4MPO A;  3TW6 A;  1JE8 A;  1TL8 A;  3ULQ B;  3U1D A;  5KK1 A;  1LFU P;  1QNT A;  3ZQI A;  2GB5 A;  2L01 A;  3X0J A;  3BJO A;  1XB4 A;  2DYS H;  2OZ6 A;  2D45 A;  3C2B A;  5IW5 A;  1U6G A;  2CL3 A;  4C9Y A;  3J81 Z;  1DPR A;  3KYC B;  1FOK A;  1AKH B;  1W7P A;  3R0J A;  1VF9 A;  5GAG J;  2VJI A;  3E6C C;  4HOB A;  3T8R A;  2WV0 A;  3TW7 A;  1SC7 A;  3M9A A;  1N77 A;  1FLI A;  1YO5 C;  2XDV A;  2ZO4 A;  1J59 A;  3IAM 2;  2D2W A;  4M9S A;  4W1U A;  3Q9S A;  1Q1H A;  5H20 A;  1BC7 C;  3PSI A;  3Q3S A;  2GIZ A;  2JUG A;  2I10 A;  3BLY A;  3L09 A;  5EJC A;  1WVR A;  2KLO A;  4GDF A;  4M3B A;  1HKQ A;  1YS6 A;  2X85 A;  2XGX A;  3EUK L;  2ICK A;  1VFC A;  4L0Y B;  1B59 A;  5FSL A;  2L9S A;  1RUO A;  1EA3 A;  1UAA A;  3WTV C;  4A5N A;  1TUM A;  1OKR A;  2VUM J;  3OYL A;  2KDW A;  3G1M A;  2PEX A;  3IWZ A;  2EZH A;  4BDY A;  3DV8 A;  3HSF A;  2CRG A;  4W97 A;  5HS8 A;  1BJA A;  1OLT A;  3ZQG A;  4I09 A;  4ZC3 A;  3BRO A;  2X6O A;  2WAF A;  1JJ6 C;  2XC7 A;  2NRA C;  2K02 A;  2LDU A;  1X1B A;  1HKS A;  3L9F A;  2GA1 A;  3IHU A;  3BOQ A;  1TNT A;  4QWQ A;  4EJV A;  3GTM J;  2JN6 A;  3K1N A;  5F64 A;  4HX4 A;  2FE3 A;  1V8N A;  1P4W A;  3VPR A;  1P6R A;  1T6S A;  3W2W A;  3Q1P A;  2ISY A;  3S1N J;  3K70 D;  1AU7 A;  1R7J A;  3LL7 A;  2Y0S N;  4EJO A;  1X3W B;  4Y3O A;  3TGN A;  5GAE J;  4L5E A;  2NS7 A;  2Z2S B;  5HZX A;  2PFB A;  4XLC A;  3SDG A;  3CJT B;  3W2V A;  3FX3 A;  2V9K A;  1OCT C;  2MG4 A;  1S5L C;  3DTE A;  1K61 A;  2M7B A;  4LLL A;  2VJ4 A;  1WH7 A;  2HXO A;  3IP4 B;  4KT5 C;  3EPZ A;  3DKU A;  1SD6 A;  4U0Y A;  2JRT A;  1U5T C;  3CCR I;  2YPR A;  1V8R A;  5ILU A;  4Q48 A;  1EF4 A;  4RB2 C;  3TED A;  3WU1 B;  3F22 A;  3SFI A;  2YUS A;  1HW5 A;  2XAS A;  3I54 A;  5E1Z B;  2P4W A;  3HTS B;  5E3M A;  3MZH A;  4S04 A;  1N78 A;  4LB5 A;  4FET A;  1UZC A;  2V6C A;  3CP8 A;  5KHD A;  4IOC F;  4U88 A;  2PMZ A;  3ZQL A;  2F5V A;  5E3L A;  5FLM J;  1UJ8 A;  2H27 A;  1GT0 C;  4II3 A;  3HHG A;  3CDL A;  4PJJ A;  2KDV A;  2JSC A;  4IHV A;  5EEG A;  1MQE A;  2Y30 A;  2G73 A;  1T38 A;  1MP2 A;  4CXF A;  3VSL A;  5K5R A;  3V7R A;  5FSM A;  2BY0 A;  3V8L A;  2FEZ A;  2VNQ A;  1Y8Q B;  4WCG A;  3HJE A;  4BXF A;  2A07 F;  3GRN A;  2YR2 A;  1SD5 A;  4IOA F;  3M7G A;  3DKY A;  4D5F A;  2J5P A;  2XAF A;  4M71 A;  3OYM A;  4ZH4 F;  3D5S C;  4I99 C;  1IN4 A;  4FX4 A;  5A2Q K;  2A5W A;  4CIC A;  3FDY A;  4N4N B;  3LSP A;  1NHA A;  4B3A A;  4BU2 A;  1AKH A;  5CPR B;  3M1E A;  4NC6 A;  3T0Y A;  2QKM B;  4PSX A;  5F0F A;  4G7O F;  2XUB A;  3MWM A;  1CF7 A;  1GDT A;  5EGO A;  3M4O J;  1U9N A;  2FOW A;  4XRF A;  3JRE A;  4A3D J;  5B1A H;  2ICW G;  5FSN A;  1TLH B;  1GV5 A;  1I3Q J;  2GQQ A;  1O57 A;  2P7V B;  4Q4Z F;  1OJL A;  2OTL I;  3CJR B;  1FTZ A;  4YPR A;  2HZD A;  3OYN A;  1W36 C;  2PG4 A;  4AYB A;  2VPL A;  4C3I J;  1FEX A;  1BI1 A;  4BE2 A;  1HBX G;  3ZPL A;  3M8E A;  1D1A A;  3HYI A;  1BC8 C;  3PUB A;  4XLF A;  4NHJ A;  1R1U A;  1IG7 A;  2IP2 A;  4J7G A;  2E34 A;  3F72 A;  3WU2 C;  1T08 B;  3V7S A;  2DA1 A;  1SZ3 A;  3HIF A;  3LQR A;  1GLN A;  1R36 A;  2GIV A;  4PGG A;  3OOU A;  3RZD J;  3IH2 A;  4IHY A;  4UUV A;  1KU3 A;  2KL4 A;  4IXA A;  5E18 F;  1ZLK A;  2KKO A;  1TQI A;  1X2M A;  2R3S A;  4EV0 A;  2DUK A;  1BIB A;  2KFD A;  4X1E A;  3E6B A;  1XS9 A;  3FBN B;  5JR3 A;  5GHQ A;  5IT9 Z;  1YOV B;  2ZSH B;  3H3U A;  2AQF A;  1FOY A;  3GTP J;  4U7D A;  1PVE A;  3JCU C;  3PIP F;  3L1P A;  5LLQ A;  2ECB A;  1TW3 A;  4Z2Y A;  3GZ6 A;  3CNG A;  3TQN A;  3EET A;  3FXJ A;  2HU9 A;  3QP6 A;  3L7W A;  4AC0 A;  2DMN A;  3ZMZ A;  4HPQ A;  3QYB A;  5LD2 C;  1IXR C;  1JJ8 C;  3IUO A;  1R58 A;  1ORK A;  2MW8 A;  3RKX A;  1B72 A;  5HDK A;  3FSP A;  4UV9 A;  1NG7 A;  3KE2 A;  3WGG A;  4A3B J;  2JZY A;  1V8Y A;  3NRV A;  2ZME C;  2WY8 Q;  5EEH A;  5GAH J;  2HTS A;  2XGD A;  1PVF A;  3ELK A;  3GW2 A;  4PSW A;  4S2X A;  4XON A;  1DDN A;  2WB1 N;  2W4S A;  1E3O C;  3FHZ A;  3UNG C;  3HKZ A;  1IV6 A;  2L9V A;  2BE5 F;  2CYY A;  2ELJ A;  1ENH A;  4BS9 A;  2CV0 A;  3I9V 2;  2IJL A;  1O4X A;  3RDI A;  2MD0 A;  2ELH A;  1RKW A;  3O3K A;  1IRX A;  1Q27 A;  2F4I A;  4AVP A;  2ESH A;  1S3J A;  1MMS A;  4HDV A;  4E7I A;  3DEU A;  1TWH J;  4CHU A;  4MQ9 F;  3CJN A;  3K4K A;  3VYS B;  4HST A;  1RR8 C;  3HOW J;  4BHC A;  4A3J J;  4I2O A;  1MBK A;  4LK1 F;  2BHZ A;  4CA0 A;  5C3E J;  1J09 A;  1F4K A;  1FIP A;  3R60 A;  1Y1W J;  1FSH A;  1MMG A;  2Q1Z B;  3GCM A;  1OQY A;  1HLV A;  1TWF J;  1KHZ A;  4M74 A;  2NNN A;  3TMO A;  4V2F A;  3CUQ C;  3VB2 A;  4AIH A;  2JA6 J;  1ITY A;  1F3Y A;  3DCF A;  2LY9 A;  3DXJ F;  4XM3 A;  3KCC A;  2XGC A;  3FCM A;  4IRH A;  1XPX A;  3TDZ C;  4RB3 C;  1A35 A;  2VBY A;  3D1N I;  2QYO A;  3HOV J;  2YU9 J;  2DCE A;  2CGP A;  1KQ0 A;  2K4J A;  2X4H A;  2Y48 A;  1ZG5 A;  2I8D A;  3NWS A;  5LPG A;  2Q2E B;  1X3Z B;  4P55 A;  1G8X A;  1HXD A;  3S1Q J;  1IF1 A;  3OYF A;  3PUF A;  3OMY A;  2AXL A;  3DPU A;  5DTD A;  2QJT A;  2HOS A;  4DYW A;  4JQF A;  3BAP A;  4CCO A;  1YYV A;  2EK5 A;  4U0V A;  3J80 K;  3OR2 C;  1X84 A;  3SYT A;  3LSG A;  3K4M A;  1B6A A;  5J8F A;  1WH5 A;  3EXQ A;  2GT2 A;  5FLX K;  2EZL A;  3CES A;  2E71 A;  2HNH A;  2DOF A;  4FE4 A;  2VB6 A;  3SFZ A;  5DD4 A;  1MMN A;  2JPB A;  4B44 A;  4HW0 A;  1PUE E;  3BC8 A;  1ETO A;  4J19 A;  5GHM A;  3AG4 H;  3JR9 A;  4HV6 A;  3REO A;  1ZKG A;  4ENN A;  4BKX A;  2R5W A;  1X3U A;  4BQN A;  3OGA A;  5FGM A;  4ZZD A;  1XX5 A;  3MDG A;  1G3S A;  2DMP A;  4HNU A;  4PFP A;  3ZP5 A;  2V79 A;  1JI8 A;  4A0Z A;  2DMT A;  2V4J C;  3FK9 A;  2PQ8 A;  1U8B A;  3GFL A;  5IYC J;  1YE9 A;  2E1M C;  2WTE A;  4C3H J;  2EIM H;  3MFK A;  2MBF A;  3OSG A;  2CO5 A;  1KA8 A;  4ESJ A;  2R7W A;  2HVR A;  2RN7 A;  4B4C A;  2ZNZ A;  5LRR A;  2ICJ A;  4ZDO A;  1FBS A;  3JRF A;  3K0L A;  3AG1 H;  2CW7 A;  3MCF A;  2AO9 A;  3KX2 A;  4LFU A;  5CVU A;  4XQF A;  4IL6 C;  1UEL B;  5F1R A;  3WTY C;  2OBP A;  3F8C A;  1D0X A;  3ABK H;  2ZXI A;  3KZZ A;  4G6Q A;  3WU0 A;  2MLK A;  2L54 A;  5FFX A;  2GM4 A;  5AON A;  3BR0 A;  2G74 A;  3CCQ I;  5TGT A;  2VT2 A;  3H5N A;  2M0C A;  3GUD A;  4JK1 X;  3CF2 A;  4AM3 A;  1RR7 A;  3S1R J;  5GHJ A;  1YJN I;  2W57 A;  1OPC A;  2J5O A;  5HVQ C;  4ESF A;  1XCB A;  5DS9 A;  4F92 B;  2NYX A;  5FB2 A;  4R79 A;  3ACA A;  2LD5 A;  3MKW B;  3FXU A;  3RZO J;  2O61 A;  2K86 A;  2K7L A;  2YX4 A;  4BBR J;  1HSJ A;  2QEX I;  1OCR H;  3EDP A;  2R7U A;  1OCZ H;  1B8I B;  2K27 A;  1MK1 A;  1MBH A;  1O3T A;  2G0E A;  2JTV A;  3OOP A;  3M1C A;  4NQW B;  3RSN A;  1UCR A;  3K70 C;  1OR7 A;  2HZT A;  4CSW A;  1F43 A;  3O52 A;  3ZCO A;  5CFI A;  3F8M A;  2DTR A;  2B06 A;  3ONQ A;  2X1E A;  3DLL F;  3IRR A;  3N77 A;  1KQ8 A;  5GPA A;  1X19 A;  3CP2 A;  3QRF F;  2HYG D;  2GLO A;  2LK2 A;  1X2N A;  1PUF A;  4WX9 A;  1I9A A;  1FBQ A;  4XOR A;  4Y33 A;  3KYL A;  2W1O A;  1YHQ I;  3DFG A;  4A3C J;  2XGE A;  2ZFW A;  3ECO A;  1ETX A;  2TDX A;  5DYM A;  2CFO A;  1YTY A;  1QVJ A;  1ZN2 A;  3C7J A;  4I76 A;  3ZQF A;  5IOY A;  3WE3 A;  3FXO A;  3VYU B;  3EES A;  3E3V A;  3OIO A;  3A4C A;  2LY1 A;  3P6Y A;  4MQV A;  2HQN A;  2MGQ A;  2WAQ N;  4N1T A;  3T5X A;  3VYT B;  4XOT A;  4HQE A;  3F6A A;  2L7F P;  1ZRC A;  5LBQ A;  2E5Z A;  3LSI A;  4GO1 A;  2E7W A;  1MH3 A;  2Q2E A;  3X0S A;  2LYC A;  3WTX C;  1Q1V A;  2FSW A;  3MZY A;  2FRH A;  2P7C B;  1XC5 A;  4BY1 J;  3C1D A;  4P9U A;  4KNY A;  1YJ9 I;  3Q0U A;  3MD2 A;  1VQM I;  2CWE A;  2O5R A;  4YPH A;  5H2F C;  2NNY A;  4M9Z A;  4DIQ A;  2STW A;  1ERD A;  4ASN A;  1BW6 A;  5BS6 A;  2P5V A;  1R00 A;  2JVB A;  3OYD A;  1SU2 A;  1NH3 A;  2NVU B;  3E6M A; 
#chains in the Genus database with same CATH homology
 1SJY A;  2DXI A;  2KHM A;  2O5W A;  2PNY A;  1VC9 A;  2OV7 A;  4MPO A;  3O6Z A;  3SON A;  1VZ0 A;  4KIS A;  1PJR A;  2X1D A;  1V5F A;  2X6X A;  4XR6 A;  4N4O B;  1AA7 A;  3I7U A;  4RLF A;  3OL3 A;  2GB5 A;  1VCD A;  3X0J A;  2VKH A;  3E1S A;  1Z21 A;  2M4K A;  4OAZ A;  4IZZ A;  4IJX A;  3DTK A;  4RMN A;  2LG4 A;  5IW5 A;  5ISY A;  1MQW A;  2CL3 A;  4C9Y A;  3K4B A;  4B3X A;  3R03 A;  1PYV A;  2R7O A;  1Q54 A;  4ITV A;  1Y6I A;  5FRN A;  2M0M A;  3DWL E;  1XSA A;  2W00 A;  2YYH A;  2VJI A;  1MMA A;  1N77 A;  3OR1 C;  2LY2 A;  2FKB A;  3I7V A;  2XDV A;  4G6T B;  3K4J A;  1DGR M;  4OWR B;  2PJR A;  3IAM 2;  3SMD A;  1VHG A;  1DP3 A;  2CH0 A;  3N9U A;  3N05 A;  3PSI A;  3A2K A;  4BE1 A;  3WHW A;  4Y4R A;  5HLT A;  2JUG A;  1Z3Y A;  2W82 A;  2W7N A;  3BLY A;  4OAY A;  4PUS A;  4K6E A;  2LRD A;  2KLO A;  2XF5 A;  4XMY A;  3L85 A;  3X0O A;  3DPT A;  4YEJ A;  2X85 A;  2XAU A;  3EUK L;  3FHN A;  4U87 A;  2ICK A;  1BR4 A;  2WY7 Q;  4KJZ A;  4XKB A;  2Y0S A;  2DT6 A;  5FSL A;  2L9S A;  4AVZ A;  1EA3 A;  5FSI A;  3S3M A;  1UAA A;  3O52 A;  4PK4 A;  4XKV A;  1TUM A;  3OYL A;  3LMM A;  2KDW A;  2WB1 A;  1JKN A;  4E7H A;  3O69 A;  3Q4I A;  4HFQ A;  2IGM A;  1V8I A;  3ZQQ A;  4BDY A;  4DBR A;  1LVK A;  1V8M A;  1T95 A;  3I9X A;  2VLA A;  2MC4 A;  1OLT A;  3TL4 X;  2Q9P A;  4ZC3 A;  2IXS A;  4E6K G;  2JVH A;  3IAS 2;  4LG3 A;  1NFZ A;  1V8L A;  3C2H A;  2V1N A;  3HUG B;  2WAF A;  2BVM A;  3OS2 A;  5ANW A;  1GA7 A;  2JSP A;  2XC7 A;  5C8L A;  1X1B A;  3BM4 A;  2ZXH A;  2I6K A;  3HYQ A;  2YVM A;  3FJY A;  3H0D A;  2CW8 A;  4E7L A;  3SEZ A;  3GZ8 A;  4DGW B;  3RH7 A;  1MW7 A;  1V8N A;  3W2W A;  3A6S A;  4JOM A;  3Q1P A;  1MND A;  2VJ5 A;  2VKD A;  2CV2 A;  3Q2T A;  1Z3X A;  3ZR8 X;  3OYI A;  4ZYA A;  3K70 D;  3LL7 A;  2FVV A;  3GWY A;  4X0G A;  1D1B A;  2VQH A;  4XN3 A;  4Y3O A;  4BJT A;  5KNL A;  1HA8 A;  2Z2S B;  5HZX A;  3SEQ A;  4ILQ A;  2VXD A;  2WAD A;  2KMU A;  4XLC A;  1V5G A;  3W2V A;  2MFZ A;  1MUT A;  4XLH A;  2V9K A;  3X0M A;  3U21 A;  2MYS A;  4BL0 B;  1SAU A;  3DTE A;  2X51 A;  2M7B A;  1S9H A;  4HG2 A;  2VJ4 A;  3IP4 B;  1NFS A;  3EPZ A;  5BON A;  3DKU A;  1KON A;  1V8U A;  4QPO A;  1MR2 A;  2DT7 B;  1V8R A;  3LSK A;  4CUG A;  4JZV A;  4YOQ A;  3RTR A;  4II2 A;  5CQG A;  4J00 A;  5DDG A;  4F3Q A;  3PNV A;  4BDZ A;  2FML A;  2DOA A;  3EF5 A;  3ZXS A;  2CUZ A;  2VNP A;  3OYH A;  1N78 A;  1E0E A;  4C2U A;  5ANU A;  4FET A;  4DOZ A;  3PNT A;  3CP8 A;  5KHD A;  4ZTF A;  4F52 A;  3OS1 A;  2PMZ A;  2A8S A;  2F5V A;  3K4L A;  2KRC A;  2KZV A;  1KT9 A;  4CCN A;  3I3L A;  1R67 A;  2LBF A;  3LSM A;  4BEH A;  2E60 A;  2MAB A;  4II3 A;  2KDV A;  4PJJ A;  4JZS A;  2VXZ A;  4B48 A;  1MQE A;  5FSK A;  2ZFU A;  2G73 A;  3A1Y A;  5CFJ A;  1MP2 A;  4F91 B;  5CKT A;  3BHO A;  1MMD A;  2WAE A;  3GBG A;  3S32 A;  3MMY B;  3BG6 A;  3VSL A;  2V26 A;  4HSR A;  4RM2 A;  4E7Z A;  1XSC A;  2I8T A;  4KYX A;  5FSM A;  2VNQ A;  1DGW Y;  4BXF A;  4J01 A;  1G9Q A;  2RRK A;  3GRN A;  3OYA A;  3KVH A;  2CV1 A;  1HX3 A;  1K26 A;  3OWT A;  3AL0 B;  3DKY A;  2VAS A;  3DKX A;  4HRI A;  3HPH A;  2R7Q A;  4CZC A;  3OYM A;  3S3N A;  3F9K A;  2QJO A;  4NFW A;  4HEA 2;  3D5S C;  4DBQ A;  2FUG 2;  3H95 A;  4KTB A;  1JRK A;  1PUN A;  2K9M A;  2A5W A;  2CUJ A;  3OY9 A;  4BAC A;  2CMP A;  2B0V A;  3FBI B;  1BR1 A;  5ANT A;  3FDY A;  4N4N B;  2UUZ A;  4BU2 A;  3CZ6 A;  3H5R A;  5CPR B;  3OYK A;  4IQJ A;  2QKM B;  5FRM A;  4PSX A;  1YX3 A;  1PPV A;  5I8U A;  3O61 A;  1Q33 A;  2A8R A;  1V8V A;  2V6E A;  1BOB A;  3VWB A;  1V8S A;  1R6R A;  5FSN A;  3VYR B;  1K2E A;  1WJE A;  3DPL C;  5GHP A;  4PJL A;  3GG6 A;  3OL4 A;  3E57 A;  3QOE A;  3OS0 A;  3CJR B;  2YVN A;  3X0K A;  4YPR A;  4EAT A;  2HZD A;  3OYN A;  1W36 C;  4AYB A;  2VPL A;  1D0Z A;  4BE2 A;  2OC6 A;  1W36 D;  4S2W A;  1D1A A;  2L9N A;  3ZR1 A;  3PUB A;  4XLF A;  3BCA A;  3K6G A;  4J7G A;  1DQU A;  1WJA A;  5GHI A;  3E0J B;  1WJF A;  3OIP A;  2DSC A;  1X4O A;  3A6V A;  1SZ3 A;  2RQQ A;  2PJR B;  4DJA A;  2F6C A;  1N75 A;  4BQO A;  1GLN A;  1PPW A;  2A8P A;  2A8Q A;  2JVG A;  3OOU A;  4XN0 A;  2YVP A;  4JZT A;  2KL4 A;  2DUK A;  2E1M B;  4F93 B;  3PNY A;  2WBM A;  2ZSI B;  2L7K A;  4XKW A;  1G0S A;  3FBN B;  4PJM A;  5GHQ A;  3J7Y e;  3FKJ A;  3L2U A;  2ZSH B;  1VRL A;  2AQF A;  2IS6 A;  3X0R A;  2R4G A;  3X0N A;  2HVQ A;  4N1U A;  1LKX A;  1QHG A;  3GZ6 A;  3SZG A;  3CNG A;  4B47 A;  3SDB A;  5HNH A;  1KTG A;  4E7J A;  2HU9 A;  2HDW A;  1NQY A;  4HPQ A;  3QSJ A;  5KCM A;  4YRV A;  5ANV A;  3QYB A;  5LD2 C;  3OYB A;  4C2T A;  2HQA A;  3DU6 A;  3IUO A;  3OYG A;  3FSP A;  1NG7 A;  2V7F A;  4J7H A;  3CMM A;  4D1Q A;  1V5E A;  1U20 A;  2BW3 B;  4NFX A;  4NUB A;  1V8Y A;  3O8S A;  3HOS A;  4ZG0 A;  2X1C A;  2WY8 Q;  5DEQ A;  1PVF A;  1WFX A;  3KEY A;  3AKZ A;  4PSW A;  4BE0 A;  5C7T A;  4S2X A;  4XON A;  2W4S A;  4IKF A;  1VK6 A;  3UNG C;  4BGD A;  4V14 A;  1PPX A;  3HKZ A;  3TBI A;  2ELJ A;  4C30 A;  4BS9 A;  3NWT A;  2VL8 A;  4BQQ A;  3I9V 2;  3HC7 A;  2CV0 A;  2OUM A;  2MD0 A;  3OIQ A;  1IRX A;  1Q27 A;  2DSB A;  2F4I A;  3A6T A;  3C2G A;  2X6Y A;  1NQZ A;  4E7I A;  2IS4 A;  3HPG A;  1VC8 A;  4BUP A;  1QU3 A;  3K4K A;  3VYS B;  4HST A;  4HVY A;  2M7A A;  5FSO A;  1D0Y A;  4CA0 A;  4ANJ A;  1J09 A;  2X6W A;  3CJQ B;  1Z7L A;  1MMG A;  2K3P A;  3H35 A;  2Q1Z B;  1K6Y A;  1X1A A;  1KHZ A;  3TMO A;  3MGM A;  1SOI A;  4XLA A;  3UR3 C;  1PUS A;  1F3Y A;  2R7T A;  2DSD A;  3AC9 A;  2AQE A;  4XM3 A;  5LFA A;  1YX5 A;  4F55 A;  3FCM A;  4FAS D;  4BJ5 C;  3RQ4 A;  2XSJ C;  1ZEL A;  4CCL A;  2CZR A;  2J8Q A;  1VHZ A;  2IGK A;  2DCE A;  4NC7 A;  1U0J A;  2A6T A;  4IQ4 A;  3DUP A;  2I8D A;  3NWS A;  5GHO A;  2Q2E B;  5LPG A;  2IS1 A;  2KP6 A;  3H9G A;  4JZU A;  3AL0 C;  1G8X A;  4IX7 A;  1TZL A;  3S3O A;  4S2V A;  2LBF B;  2L2O A;  2Z16 A;  3H9Q A;  4BEH B;  3U53 A;  3OYF A;  3OMY A;  3DPU A;  3L2V A;  3QYF A;  2QJT A;  4S2Y A;  2O5F A;  4DYW A;  4JQF A;  2XSQ A;  3BAP A;  3ZRG A;  4LIV A;  4CCO A;  1FMW A;  1X84 A;  3OR2 C;  3SYT A;  1X4P A;  5JHF A;  1Y56 A;  4C9W A;  3LSG A;  3K4M A;  1RYA A;  4RM3 A;  1WJD A;  3EXQ A;  3OYC A;  2GT2 A;  2WA0 A;  3AFH A;  3CES A;  2HNH A;  2VB6 A;  1FMV A;  1SFK A;  1P9Q C;  2BVL A;  5DD4 A;  1MMN A;  3J7A Y;  4B44 A;  1IRY A;  3Q93 A;  1OW2 A;  1G59 A;  3H9J A;  3BC8 A;  5GHM A;  2XF7 A;  4E7K A;  2VJJ A;  3X0L A;  2M4G A;  4CH7 A;  2P0W A;  4MLO A;  3PJR A;  1LFP A;  3W2A A;  2R5W A;  3COU A;  2VIX A;  5DPK A;  5GHN A;  4BQN A;  2R7X A;  2O1C A;  3OGA A;  4XLE A;  2R7S A;  3MDG A;  3HHJ A;  3QYE A;  4HNU A;  4PFP A;  4XOP A;  1TT0 A;  2LOO A;  4GRI A;  1JI8 A;  1RRS A;  2V4J C;  1T0F C;  3FK9 A;  4P1W A;  2YVO A;  1WJB A;  3H5A A;  3K10 A;  3RPU D;  4RLQ A;  2KQR A;  1YE9 A;  2E1M C;  3EUA A;  2BOL A;  4D9J A;  1X51 A;  2VQC A;  3PFY A;  4KT6 A;  3MKY B;  3VDX A;  4XL9 A;  2VQG A;  2XF6 A;  3BG7 A;  4QPQ A;  2R7W A;  2HVR A;  3PSF A;  3DQV C;  2ICJ A;  4C9X A;  1QHH D;  4ZDO A;  2HVS A;  1XSB A;  1UG0 A;  2CS3 A;  5IW4 A;  2GOM A;  4B43 A;  2CW7 A;  3MCF A;  3KX2 A;  2AZW A;  3MDI A;  3EUH C;  2Z1D A;  3HG9 A;  4XQF A;  1UEL B;  3ZR0 A;  1D0X A;  5CQE A;  2ZXI A;  1VIU A;  3FFU A;  3X0Q A;  2K9L A;  2L5Q A;  3F13 A;  3LFU A;  4KIT B;  3VSK A;  2I8U A;  2KDO A;  2G74 A;  1V8W A;  5TGT A;  3H5N A;  3EEU A;  3X0I A;  3CF2 A;  3ID9 A;  2DJI A;  4PFO A;  3LSH A;  3L2R A;  4ZTJ A;  5GHJ A;  4HNT A;  3HOT A;  5C7Q A;  3RCO A;  5HVQ C;  2BW3 A;  4F92 B;  2WAQ A;  4E4H A;  3DEE A;  4CCM A;  4R79 A;  3ACA A;  1VIQ A;  3MKW B;  3K4N A;  4NC8 A;  3X0P A;  2RNG A;  2IS2 A;  4CCJ A;  1OR7 C;  3G0Q A;  2R7U A;  1PUQ A;  1MK1 A;  3L2W A;  4U7B A;  1MNE A;  3W3C A;  3DTI A;  3M1C A;  2E5N A;  2KRH A;  4NQW B;  3RSN A;  4CSW A;  3K70 C;  2LH9 A;  2K5C A;  3ZCO A;  4XNF A;  2B2K A;  5CFI A;  2B06 A;  3ONQ A;  5HNF A;  1NG6 A;  2QKL B;  2X1E A;  4ZDP A;  3BCB A;  3N77 A;  4KG3 A;  3SHD A;  1X1C A;  1X19 A;  3CP2 A;  3G2B A;  1HZT A;  3K4C A;  3HL2 A;  3M8J A;  2RRE A;  2R7V A;  4AU7 A;  3P5T A;  3S93 A;  1D1C A;  1I9A A;  4XOR A;  1LDK B;  1WJ5 A;  4Y33 A;  4YEL A;  3KYL A;  2W1O A;  3DU5 A;  2GOX B;  1X83 A;  2M3A A;  1V8T A;  3Q2S A;  2CFO A;  2JA2 A;  1BR2 A;  3D5R C;  1QVJ A;  3HXL A;  3ZGK A;  4ICK A;  3MKZ A;  4ZDL A;  3VYU B;  3Q91 A;  2IGO A;  4LIU A;  3QOD A;  3V42 A;  2HPI A;  2R7R A;  3EES A;  2VQL A;  3GZ5 A;  3A4C A;  4LIT A;  2LY1 A;  4P5O A;  3P6Y A;  4N1T A;  4KG4 A;  3VYT B;  3D5L A;  4XOT A;  4E7S A;  2PQV A;  5HOO A;  3F6A A;  3A6U A;  3OYE A;  2NOJ B;  3L2Q A;  2A8T A;  5ANS A;  2E5Z A;  3LSI A;  4H4K C;  3S8P A;  2DHO A;  4PJN A;  1RRQ A;  4BJ6 C;  2LYC A;  2HPM A;  3X0S A;  4ZJZ A;  2KPM A;  2W4E A;  2LC2 A;  2GT4 A;  3MD2 A;  4NNJ A;  2O5R A;  4YPH A;  4DIQ A;  3DLA A;  3OYJ A;  2IGN A;  2LRE A;  1X1D A;  2UWM A;  1ERD A;  1WJC A;  5BS6 A;  3PL8 A;  2JVB A;  3OYD A;  2UV1 A;  1SU2 A;  4CCK A;  5FRO A;  4XKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...