1RYAA

Crystal structure of the e. coli gdp-mannose mannosyl hydrolase in complex with gdp and mg
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
160
structure length
160
Chain Sequence
MMFLRQEDFATVVRSTPLVSLDFIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMAELGLRLPITAGQFYGVWQHFYDDNFSGTDFTTHYVVLGFRFRVSEEELLLPDEQHDDYRWLTSDALLASDNVHANSRAYFLAEKRTGVPGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-mannose mannosyl hydrolase
publication title Structure and mechanism of GDP-mannose glycosyl hydrolase, a Nudix enzyme that cleaves at carbon instead of phosphorus.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 45
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2003-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1ryaA00
3A6UA 5DD4A 2J8QA 1XSBA 2YYHA 5FSIA 1PUNA 4IJXA 3I7UA 3BM4A 1V8TA 5GHPA 1MK1A 1X84A 4NFWA 2FVVA 1VCDA 2QJOA 5GHMA 5I8UA 5DDGA 2ICKA 2QKMB 2R5WA 2VNQA 3FJYA 3GWYA 3E57A 3FK9A 2DSDA 3SHDA 3I9XA 5DPKA 1JKNA 1V8NA 3X0JA 1NFSA 1SJYA 5ISYA 4DYWA 1PUQA 2A8TA 2YVMA 3SMDA 5C7TA 2PQVA 3I7VA 2A8RA 4C9XA 4ZG0A 1I9AA 3ID9A 5BONA 3Q4IA 3GRNA 2JVBA 5FSNA 4HFQA 4JZUA 4S2XA 3J7Ye 1VC8A 1V8RA 5IW5A 3FCMA 3F6AA 3GZ8A 3QSJA 1NQYA 2A8SA 2KDWA 4JZTA 1RRQA 3ZR1A 4YPRA 2Q9PA 3COUA 5C7QA 1KHZA 2G73A 2G74A 2GT2A 3R03A 1RRSA 4KTBA 4MPOA 4S2YA 3MDGA 3O52A 5ANSA 1HZTA 1V8WA 3Q91A 4YOQA 2YVOA 3X0MA 2B0VA 3KVHA 1G0SA 1PPXA 1KT9A 1VHGA 1F3YA 5BS6A 3EXQA 5ANTA 5ANVA 3EESA 5CFJA 2FMLA 1V8MA 3U53A 1PPVA 2YVNA 3WHWA 3Q2SA 2RRKA 2I8UA 5DEQA 1K2EA 1VIQA 1V8YA 1V8LA 3MGMA 4HVYA 2KDVA 4N1UA 4YPHA 3GZ6A 1VRLA 4S2VA 2O1CA 3BAPA 2DHOA 1RYAA 4KG4A 2AZWA 3X0QA 5LPGA 3N9UA 4ILQA 3X0RA 3X0KA 2DSCA 3BHOA 1G9QA 1VK6A 3O69A 3N77A 2GT4A 4S2WA 3X0PA 5FSKA 1V8UA 4NFXA 3L85A 5ANUA 3X0SA 1HX3A 4KG3A 3EEUA 3CNGA 2DUKA 2XSQA 1R67A 1NQZA 2VNPA 3AC9A 3X0IA 4C9WA 3DUPA 1JRKA 5GHIA 1X51A 1X83A 1MR2A 5FSLA 1VHZA 5IW4A 3G0QA 3EF5A 1PPWA 3X0OA 3A6SA 3P5TA 1SZ3A 3O6ZA 3H95A 2A6TA 3ACAA 5C8LA 5CFIA 1PUSA 1KTGA 3O61A 2B2KA 4KYXA 4N1TA 1MP2A 5GHJA 2O5WA 3A6TA 3HHJA 2FKBA 2I8TA 3P6YA 3GZ5A 1NFZA 3MDIA 3FSPA 1V8IA 1MUTA 1GA7A 2I6KA 2YVPA 4JZSA 1V8VA 2A8QA 5ANWA 5FSMA 3SONA 2CL3A 1Q33A 2DSBA 1XSAA 3Q93A 3OGAA 4ICKA 3DKUA 2QJTA 2GB5A 5GHOA 5GHNA 3Q2TA 5GHQA 3A6VA 1PVFA 3RH7A 1QVJA 1OW2A 1Q54A 2PNYA 3HYQA 2W4EA 1U20A 1VC9A 3GG6A 3X0LA 1MQWA 3X0NA 2ICJA 1SOIA 3Q1PA 1K26A 3ZR0A 2B06A 3F13A 1MQEA 1V8SA 5FSOA 1TUMA 4K6EA 4JZVA 1VIUA 3MCFA 2O5FA 4V14A 5HZXA 2A8PA 3O8SA 1Q27A 1IRYA 1SU2A 3FFUA 1XSCA
chains in the Genus database with same CATH superfamily
3A6UA 5DD4A 2J8QA 1XSBA 2YYHA 5FSIA 1PUNA 4IJXA 3I7UA 3BM4A 1V8TA 5GHPA 1MK1A 1X84A 4NFWA 2FVVA 1VCDA 2QJOA 5GHMA 5I8UA 5DDGA 2ICKA 4J7GA 2QKMB 2R5WA 2VNQA 3FJYA 3GWYA 3E57A 3FK9A 2DSDA 3SHDA 3I9XA 5DPKA 1JKNA 1V8NA 3X0JA 1NFSA 1SJYA 5ISYA 4DYWA 1PUQA 2A8TA 2YVMA 3SMDA 5C7TA 2PQVA 3I7VA 2A8RA 4C9XA 4ZG0A 1I9AA 3ID9A 5BONA 3Q4IA 3GRNA 2JVBA 5FSNA 4HFQA 4JZUA 4S2XA 3J7Ye 1VC8A 1V8RA 5IW5A 3FCMA 3F6AA 3GZ8A 3QSJA 1NQYA 2A8SA 2KDWA 4JZTA 1RRQA 3ZR1A 4YPRA 2Q9PA 3COUA 5C7QA 1KHZA 2G73A 2G74A 2GT2A 3R03A 1RRSA 4KTBA 4MPOA 4S2YA 3MDGA 3O52A 5ANSA 1HZTA 1V8WA 3Q91A 4YOQA 2YVOA 3X0MA 2B0VA 3KVHA 1G0SA 1PPXA 1KT9A 1VHGA 1F3YA 5BS6A 3EXQA 5ANTA 5ANVA 3EESA 5CFJA 2FMLA 1V8MA 3U53A 1PPVA 2YVNA 3WHWA 3Q2SA 2RRKA 2I8UA 5DEQA 4J7HA 1K2EA 1VIQA 1V8YA 1V8LA 3MGMA 4HVYA 2KDVA 4N1UA 4YPHA 3GZ6A 1VRLA 4S2VA 2O1CA 3BAPA 2DHOA 1RYAA 4KG4A 2AZWA 3X0QA 5LPGA 3N9UA 4ILQA 3X0RA 3X0KA 2DSCA 3BHOA 1G9QA 1VK6A 3O69A 3N77A 2GT4A 4S2WA 3X0PA 5FSKA 1V8UA 4NFXA 3L85A 5ANUA 3X0SA 1HX3A 4KG3A 3EEUA 3CNGA 2DUKA 2XSQA 1R67A 1NQZA 2VNPA 3AC9A 3X0IA 4C9WA 3DUPA 1JRKA 5GHIA 1X51A 1X83A 1MR2A 5FSLA 1VHZA 5IW4A 3G0QA 3EF5A 1PPWA 3X0OA 3A6SA 3P5TA 1SZ3A 3O6ZA 3H95A 2A6TA 3ACAA 5C8LA 5CFIA 1PUSA 1KTGA 3O61A 2B2KA 4KYXA 4N1TA 1MP2A 5GHJA 2O5WA 3A6TA 3HHJA 2FKBA 2I8TA 3P6YA 3GZ5A 1NFZA 3MDIA 3FSPA 1V8IA 1MUTA 1GA7A 2I6KA 2YVPA 4JZSA 1V8VA 2A8QA 5ANWA 5FSMA 3SONA 2CL3A 1Q33A 2DSBA 1XSAA 3Q93A 3OGAA 4ICKA 3DKUA 2QJTA 2GB5A 5GHOA 5GHNA 3Q2TA 5GHQA 3A6VA 1PVFA 3RH7A 1QVJA 1OW2A 1Q54A 2PNYA 3HYQA 2W4EA 1U20A 1VC9A 3GG6A 3X0LA 1MQWA 3X0NA 2ICJA 1SOIA 3Q1PA 1K26A 2CZRA 3ZR0A 2B06A 3F13A 1MQEA 1V8SA 5FSOA 1TUMA 4K6EA 4JZVA 1VIUA 3MCFA 2O5FA 4V14A 5HZXA 2A8PA 3O8SA 1Q27A 1IRYA 1SU2A 3FFUA 1XSCA
chains in the Genus database with same CATH topology
3A6UA 5DD4A 2J8QA 1XSBA 2YYHA 5FSIA 1PUNA 4IJXA 3I7UA 3BM4A 1V8TA 5GHPA 1MK1A 1X84A 4NFWA 2FVVA 1VCDA 2QJOA 5GHMA 5I8UA 5DDGA 2ICKA 4J7GA 2QKMB 2R5WA 2VNQA 3FJYA 3GWYA 3E57A 3FK9A 2DSDA 3SHDA 3I9XA 5DPKA 1JKNA 1V8NA 3X0JA 1NFSA 1SJYA 5ISYA 4DYWA 1PUQA 2A8TA 2YVMA 3SMDA 5C7TA 2PQVA 3I7VA 2A8RA 4C9XA 4ZG0A 1I9AA 3ID9A 5BONA 3Q4IA 3GRNA 2JVBA 5FSNA 4HFQA 4JZUA 4S2XA 3J7Ye 1VC8A 1V8RA 5IW5A 3FCMA 3F6AA 3GZ8A 3QSJA 1NQYA 2A8SA 2KDWA 4JZTA 1RRQA 3ZR1A 4YPRA 2Q9PA 3COUA 5C7QA 1KHZA 2G73A 2G74A 2GT2A 3R03A 1RRSA 4KTBA 4MPOA 4S2YA 3MDGA 3O52A 5ANSA 1HZTA 1V8WA 3Q91A 4YOQA 2YVOA 3X0MA 2B0VA 3KVHA 1G0SA 1PPXA 1KT9A 1VHGA 1F3YA 5BS6A 3EXQA 5ANTA 5ANVA 3EESA 5CFJA 2FMLA 1V8MA 3U53A 1PPVA 2YVNA 3WHWA 3Q2SA 2RRKA 2I8UA 5DEQA 4J7HA 1K2EA 1VIQA 1V8YA 1V8LA 3MGMA 4HVYA 2KDVA 4N1UA 4YPHA 3GZ6A 1VRLA 4S2VA 2O1CA 3BAPA 2DHOA 1RYAA 4KG4A 2AZWA 3X0QA 5LPGA 3N9UA 4ILQA 3X0RA 3X0KA 2DSCA 3BHOA 1G9QA 1VK6A 3O69A 3N77A 2GT4A 4S2WA 3X0PA 5FSKA 1V8UA 4NFXA 3L85A 5ANUA 3X0SA 1HX3A 4KG3A 3EEUA 3CNGA 2DUKA 2XSQA 1R67A 1NQZA 2VNPA 3AC9A 3X0IA 4C9WA 3DUPA 1JRKA 5GHIA 1X51A 1X83A 1MR2A 5FSLA 1VHZA 5IW4A 3G0QA 3EF5A 1PPWA 3X0OA 3A6SA 3P5TA 1SZ3A 3O6ZA 3H95A 2A6TA 3ACAA 5C8LA 5CFIA 1PUSA 1KTGA 3O61A 2B2KA 4KYXA 4N1TA 1MP2A 5GHJA 2O5WA 3A6TA 3HHJA 2FKBA 2I8TA 3P6YA 3GZ5A 1NFZA 3MDIA 3FSPA 1V8IA 1MUTA 1GA7A 2I6KA 2YVPA 4JZSA 1V8VA 2A8QA 5ANWA 5FSMA 3SONA 2CL3A 1Q33A 2DSBA 1XSAA 3Q93A 3OGAA 4ICKA 3DKUA 2QJTA 2GB5A 5GHOA 5GHNA 3Q2TA 5GHQA 3A6VA 1PVFA 3RH7A 1QVJA 1OW2A 1Q54A 2PNYA 3HYQA 2W4EA 1U20A 1VC9A 3GG6A 3X0LA 1MQWA 3X0NA 2ICJA 1SOIA 3Q1PA 1K26A 2CZRA 3ZR0A 2B06A 3F13A 1MQEA 1V8SA 5FSOA 1TUMA 4K6EA 4JZVA 1VIUA 3MCFA 2O5FA 4V14A 5HZXA 2A8PA 3O8SA 1Q27A 1IRYA 1SU2A 3FFUA 1XSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A6U A;  5DD4 A;  2J8Q A;  1XSB A;  2YYH A;  5FSI A;  1PUN A;  4IJX A;  3I7U A;  3BM4 A;  1V8T A;  5GHP A;  1MK1 A;  1X84 A;  4NFW A;  2FVV A;  1VCD A;  2QJO A;  5GHM A;  5I8U A;  5DDG A;  2ICK A;  2QKM B;  2R5W A;  2VNQ A;  3FJY A;  3GWY A;  3E57 A;  3FK9 A;  2DSD A;  3SHD A;  3I9X A;  5DPK A;  1JKN A;  1V8N A;  3X0J A;  1NFS A;  1SJY A;  5ISY A;  4DYW A;  1PUQ A;  2A8T A;  2YVM A;  3SMD A;  5C7T A;  2PQV A;  3I7V A;  2A8R A;  4C9X A;  4ZG0 A;  1I9A A;  3ID9 A;  5BON A;  3Q4I A;  3GRN A;  2JVB A;  5FSN A;  4HFQ A;  4JZU A;  4S2X A;  3J7Y e;  1VC8 A;  1V8R A;  5IW5 A;  3FCM A;  3F6A A;  3GZ8 A;  3QSJ A;  1NQY A;  2A8S A;  2KDW A;  4JZT A;  1RRQ A;  3ZR1 A;  4YPR A;  2Q9P A;  3COU A;  5C7Q A;  1KHZ A;  2G73 A;  2G74 A;  2GT2 A;  3R03 A;  1RRS A;  4KTB A;  4MPO A;  4S2Y A;  3MDG A;  3O52 A;  5ANS A;  1HZT A;  1V8W A;  3Q91 A;  4YOQ A;  2YVO A;  3X0M A;  2B0V A;  3KVH A;  1G0S A;  1PPX A;  1KT9 A;  1VHG A;  1F3Y A;  5BS6 A;  3EXQ A;  5ANT A;  5ANV A;  3EES A;  5CFJ A;  2FML A;  1V8M A;  3U53 A;  1PPV A;  2YVN A;  3WHW A;  3Q2S A;  2RRK A;  2I8U A;  5DEQ A;  1K2E A;  1VIQ A;  1V8Y A;  1V8L A;  3MGM A;  4HVY A;  2KDV A;  4N1U A;  4YPH A;  3GZ6 A;  1VRL A;  4S2V A;  2O1C A;  3BAP A;  2DHO A;  1RYA A;  4KG4 A;  2AZW A;  3X0Q A;  5LPG A;  3N9U A;  4ILQ A;  3X0R A;  3X0K A;  2DSC A;  3BHO A;  1G9Q A;  1VK6 A;  3O69 A;  3N77 A;  2GT4 A;  4S2W A;  3X0P A;  5FSK A;  1V8U A;  4NFX A;  3L85 A;  5ANU A;  3X0S A;  1HX3 A;  4KG3 A;  3EEU A;  3CNG A;  2DUK A;  2XSQ A;  1R67 A;  1NQZ A;  2VNP A;  3AC9 A;  3X0I A;  4C9W A;  3DUP A;  1JRK A;  5GHI A;  1X51 A;  1X83 A;  1MR2 A;  5FSL A;  1VHZ A;  5IW4 A;  3G0Q A;  3EF5 A;  1PPW A;  3X0O A;  3A6S A;  3P5T A;  1SZ3 A;  3O6Z A;  3H95 A;  2A6T A;  3ACA A;  5C8L A;  5CFI A;  1PUS A;  1KTG A;  3O61 A;  2B2K A;  4KYX A;  4N1T A;  1MP2 A;  5GHJ A;  2O5W A;  3A6T A;  3HHJ A;  2FKB A;  2I8T A;  3P6Y A;  3GZ5 A;  1NFZ A;  3MDI A;  3FSP A;  1V8I A;  1MUT A;  1GA7 A;  2I6K A;  2YVP A;  4JZS A;  1V8V A;  2A8Q A;  5ANW A;  5FSM A;  3SON A;  2CL3 A;  1Q33 A;  2DSB A;  1XSA A;  3Q93 A;  3OGA A;  4ICK A;  3DKU A;  2QJT A;  2GB5 A;  5GHO A;  5GHN A;  3Q2T A;  5GHQ A;  3A6V A;  1PVF A;  3RH7 A;  1QVJ A;  1OW2 A;  1Q54 A;  2PNY A;  3HYQ A;  2W4E A;  1U20 A;  1VC9 A;  3GG6 A;  3X0L A;  1MQW A;  3X0N A;  2ICJ A;  1SOI A;  3Q1P A;  1K26 A;  3ZR0 A;  2B06 A;  3F13 A;  1MQE A;  1V8S A;  5FSO A;  1TUM A;  4K6E A;  4JZV A;  1VIU A;  3MCF A;  2O5F A;  4V14 A;  5HZX A;  2A8P A;  3O8S A;  1Q27 A;  1IRY A;  1SU2 A;  3FFU A;  1XSC A; 
#chains in the Genus database with same CATH topology
 3A6U A;  5DD4 A;  2J8Q A;  1XSB A;  2YYH A;  5FSI A;  1PUN A;  4IJX A;  3I7U A;  3BM4 A;  1V8T A;  5GHP A;  1MK1 A;  1X84 A;  4NFW A;  2FVV A;  1VCD A;  2QJO A;  5GHM A;  5I8U A;  5DDG A;  2ICK A;  4J7G A;  2QKM B;  2R5W A;  2VNQ A;  3FJY A;  3GWY A;  3E57 A;  3FK9 A;  2DSD A;  3SHD A;  3I9X A;  5DPK A;  1JKN A;  1V8N A;  3X0J A;  1NFS A;  1SJY A;  5ISY A;  4DYW A;  1PUQ A;  2A8T A;  2YVM A;  3SMD A;  5C7T A;  2PQV A;  3I7V A;  2A8R A;  4C9X A;  4ZG0 A;  1I9A A;  3ID9 A;  5BON A;  3Q4I A;  3GRN A;  2JVB A;  5FSN A;  4HFQ A;  4JZU A;  4S2X A;  3J7Y e;  1VC8 A;  1V8R A;  5IW5 A;  3FCM A;  3F6A A;  3GZ8 A;  3QSJ A;  1NQY A;  2A8S A;  2KDW A;  4JZT A;  1RRQ A;  3ZR1 A;  4YPR A;  2Q9P A;  3COU A;  5C7Q A;  1KHZ A;  2G73 A;  2G74 A;  2GT2 A;  3R03 A;  1RRS A;  4KTB A;  4MPO A;  4S2Y A;  3MDG A;  3O52 A;  5ANS A;  1HZT A;  1V8W A;  3Q91 A;  4YOQ A;  2YVO A;  3X0M A;  2B0V A;  3KVH A;  1G0S A;  1PPX A;  1KT9 A;  1VHG A;  1F3Y A;  5BS6 A;  3EXQ A;  5ANT A;  5ANV A;  3EES A;  5CFJ A;  2FML A;  1V8M A;  3U53 A;  1PPV A;  2YVN A;  3WHW A;  3Q2S A;  2RRK A;  2I8U A;  5DEQ A;  4J7H A;  1K2E A;  1VIQ A;  1V8Y A;  1V8L A;  3MGM A;  4HVY A;  2KDV A;  4N1U A;  4YPH A;  3GZ6 A;  1VRL A;  4S2V A;  2O1C A;  3BAP A;  2DHO A;  1RYA A;  4KG4 A;  2AZW A;  3X0Q A;  5LPG A;  3N9U A;  4ILQ A;  3X0R A;  3X0K A;  2DSC A;  3BHO A;  1G9Q A;  1VK6 A;  3O69 A;  3N77 A;  2GT4 A;  4S2W A;  3X0P A;  5FSK A;  1V8U A;  4NFX A;  3L85 A;  5ANU A;  3X0S A;  1HX3 A;  4KG3 A;  3EEU A;  3CNG A;  2DUK A;  2XSQ A;  1R67 A;  1NQZ A;  2VNP A;  3AC9 A;  3X0I A;  4C9W A;  3DUP A;  1JRK A;  5GHI A;  1X51 A;  1X83 A;  1MR2 A;  5FSL A;  1VHZ A;  5IW4 A;  3G0Q A;  3EF5 A;  1PPW A;  3X0O A;  3A6S A;  3P5T A;  1SZ3 A;  3O6Z A;  3H95 A;  2A6T A;  3ACA A;  5C8L A;  5CFI A;  1PUS A;  1KTG A;  3O61 A;  2B2K A;  4KYX A;  4N1T A;  1MP2 A;  5GHJ A;  2O5W A;  3A6T A;  3HHJ A;  2FKB A;  2I8T A;  3P6Y A;  3GZ5 A;  1NFZ A;  3MDI A;  3FSP A;  1V8I A;  1MUT A;  1GA7 A;  2I6K A;  2YVP A;  4JZS A;  1V8V A;  2A8Q A;  5ANW A;  5FSM A;  3SON A;  2CL3 A;  1Q33 A;  2DSB A;  1XSA A;  3Q93 A;  3OGA A;  4ICK A;  3DKU A;  2QJT A;  2GB5 A;  5GHO A;  5GHN A;  3Q2T A;  5GHQ A;  3A6V A;  1PVF A;  3RH7 A;  1QVJ A;  1OW2 A;  1Q54 A;  2PNY A;  3HYQ A;  2W4E A;  1U20 A;  1VC9 A;  3GG6 A;  3X0L A;  1MQW A;  3X0N A;  2ICJ A;  1SOI A;  3Q1P A;  1K26 A;  2CZR A;  3ZR0 A;  2B06 A;  3F13 A;  1MQE A;  1V8S A;  5FSO A;  1TUM A;  4K6E A;  4JZV A;  1VIU A;  3MCF A;  2O5F A;  4V14 A;  5HZX A;  2A8P A;  3O8S A;  1Q27 A;  1IRY A;  1SU2 A;  3FFU A;  1XSC A; 
#chains in the Genus database with same CATH homology
 3A6U A;  5DD4 A;  2J8Q A;  1XSB A;  2YYH A;  5FSI A;  1PUN A;  4IJX A;  3I7U A;  3BM4 A;  1V8T A;  5GHP A;  1MK1 A;  1X84 A;  4NFW A;  2FVV A;  1VCD A;  2QJO A;  5GHM A;  5I8U A;  5DDG A;  2ICK A;  4J7G A;  2QKM B;  2R5W A;  2VNQ A;  3FJY A;  3GWY A;  3E57 A;  3FK9 A;  2DSD A;  3SHD A;  3I9X A;  5DPK A;  1JKN A;  1V8N A;  3X0J A;  1NFS A;  1SJY A;  5ISY A;  4DYW A;  1PUQ A;  2A8T A;  2YVM A;  3SMD A;  5C7T A;  2PQV A;  3I7V A;  2A8R A;  4C9X A;  4ZG0 A;  1I9A A;  3ID9 A;  5BON A;  3Q4I A;  3GRN A;  2JVB A;  5FSN A;  4HFQ A;  4JZU A;  4S2X A;  3J7Y e;  1VC8 A;  1V8R A;  5IW5 A;  3FCM A;  3F6A A;  3GZ8 A;  3QSJ A;  1NQY A;  2A8S A;  2KDW A;  4JZT A;  1RRQ A;  3ZR1 A;  4YPR A;  2Q9P A;  3COU A;  5C7Q A;  1KHZ A;  2G73 A;  2G74 A;  2GT2 A;  3R03 A;  1RRS A;  4KTB A;  4MPO A;  4S2Y A;  3MDG A;  3O52 A;  5ANS A;  1HZT A;  1V8W A;  3Q91 A;  4YOQ A;  2YVO A;  3X0M A;  2B0V A;  3KVH A;  1G0S A;  1PPX A;  1KT9 A;  1VHG A;  1F3Y A;  5BS6 A;  3EXQ A;  5ANT A;  5ANV A;  3EES A;  5CFJ A;  2FML A;  1V8M A;  3U53 A;  1PPV A;  2YVN A;  3WHW A;  3Q2S A;  2RRK A;  2I8U A;  5DEQ A;  4J7H A;  1K2E A;  1VIQ A;  1V8Y A;  1V8L A;  3MGM A;  4HVY A;  2KDV A;  4N1U A;  4YPH A;  3GZ6 A;  1VRL A;  4S2V A;  2O1C A;  3BAP A;  2DHO A;  1RYA A;  4KG4 A;  2AZW A;  3X0Q A;  5LPG A;  3N9U A;  4ILQ A;  3X0R A;  3X0K A;  2DSC A;  3BHO A;  1G9Q A;  1VK6 A;  3O69 A;  3N77 A;  2GT4 A;  4S2W A;  3X0P A;  5FSK A;  1V8U A;  4NFX A;  3L85 A;  5ANU A;  3X0S A;  1HX3 A;  4KG3 A;  3EEU A;  3CNG A;  2DUK A;  2XSQ A;  1R67 A;  1NQZ A;  2VNP A;  3AC9 A;  3X0I A;  4C9W A;  3DUP A;  1JRK A;  5GHI A;  1X51 A;  1X83 A;  1MR2 A;  5FSL A;  1VHZ A;  5IW4 A;  3G0Q A;  3EF5 A;  1PPW A;  3X0O A;  3A6S A;  3P5T A;  1SZ3 A;  3O6Z A;  3H95 A;  2A6T A;  3ACA A;  5C8L A;  5CFI A;  1PUS A;  1KTG A;  3O61 A;  2B2K A;  4KYX A;  4N1T A;  1MP2 A;  5GHJ A;  2O5W A;  3A6T A;  3HHJ A;  2FKB A;  2I8T A;  3P6Y A;  3GZ5 A;  1NFZ A;  3MDI A;  3FSP A;  1V8I A;  1MUT A;  1GA7 A;  2I6K A;  2YVP A;  4JZS A;  1V8V A;  2A8Q A;  5ANW A;  5FSM A;  3SON A;  2CL3 A;  1Q33 A;  2DSB A;  1XSA A;  3Q93 A;  3OGA A;  4ICK A;  3DKU A;  2QJT A;  2GB5 A;  5GHO A;  5GHN A;  3Q2T A;  5GHQ A;  3A6V A;  1PVF A;  3RH7 A;  1QVJ A;  1OW2 A;  1Q54 A;  2PNY A;  3HYQ A;  2W4E A;  1U20 A;  1VC9 A;  3GG6 A;  3X0L A;  1MQW A;  3X0N A;  2ICJ A;  1SOI A;  3Q1P A;  1K26 A;  2CZR A;  3ZR0 A;  2B06 A;  3F13 A;  1MQE A;  1V8S A;  5FSO A;  1TUM A;  4K6E A;  4JZV A;  1VIU A;  3MCF A;  2O5F A;  4V14 A;  5HZX A;  2A8P A;  3O8S A;  1Q27 A;  1IRY A;  1SU2 A;  3FFU A;  1XSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...