1V8YA

Crystal structure analysis of the adp-ribose pyrophosphatase of e86q mutant, complexed with adp-ribose and zn
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
158
structure length
150
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEQTGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 150
sequence length 158
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8yA00
3Q2TA 2I8TA 3OGAA 3O6ZA 4IJXA 3I7VA 2GT4A 3F13A 1IRYA 3G0QA 1VC9A 5CFIA 1V8IA 1XSBA 3Q93A 4C9WA 5ISYA 2A8QA 3EF5A 1G9QA 1KHZA 2VNQA 4KTBA 3GWYA 2YYHA 1NQZA 3GZ8A 3GZ6A 3COUA 2QJTA 3MGMA 4YPHA 3O8SA 3EESA 4NFXA 3WHWA 4YOQA 1K2EA 2I8UA 1SOIA 2G74A 5DDGA 1TUMA 1V8LA 2KDWA 5ANVA 1VIQA 5GHOA 3L85A 2FMLA 1MUTA 2VNPA 4S2WA 1OW2A 4S2YA 1SU2A 2QJOA 2QKMB 4KG3A 1PUNA 1VRLA 5FSIA 3ID9A 5GHQA 4S2XA 2J8QA 3Q4IA 5C7QA 3BAPA 5IW4A 1XSCA 2Q9PA 2YVOA 1V8UA 2R5WA 4ZG0A 2O1CA 5GHNA 5GHJA 5C8LA 3Q1PA 4N1TA 1V8WA 1VIUA 3X0LA 3P6YA 2DSDA 3I9XA 2DSCA 2PNYA 5DD4A 4DYWA 3N77A 5ANSA 1HZTA 1V8MA 1PUQA 3O69A 1V8TA 3MCFA 3X0NA 5I8UA 1KTGA 2GT2A 3RH7A 3FSPA 1Q33A 1PPVA 3ACAA 2PQVA 4YPRA 2FKBA 2CL3A 5ANWA 4ILQA 5GHMA 2B2KA 3AC9A 5ANTA 1PPWA 2YVNA 3J7Ye 1I9AA 1MP2A 2ICJA 3MDIA 1V8RA 3BHOA 1MQEA 5IW5A 5ANUA 3X0JA 2A8PA 4NFWA 3FCMA 2B06A 3X0RA 3EXQA 1G0SA 3Q91A 3ZR0A 1VC8A 1XSAA 2YVPA 3E57A 3DKUA 1U20A 3O61A 1VK6A 2A8SA 2DHOA 3X0OA 1Q27A 4JZUA 2A8RA 5C7TA 5FSMA 1PVFA 1RRSA 2YVMA 3FK9A 1K26A 5GHPA 1JKNA 4K6EA 2W4EA 3FFUA 3SHDA 3SMDA 3X0PA 1RRQA 1V8SA 2FVVA 4KG4A 3EEUA 1SJYA 3X0QA 3QSJA 2DUKA 1KT9A 4C9XA 1MK1A 3A6UA 1RYAA 5DPKA 2XSQA 3X0KA 3P5TA 1SZ3A 5FSOA 1VHZA 4MPOA 1X83A 3R03A 3A6VA 3A6TA 5FSLA 3U53A 1QVJA 5HZXA 5LPGA 4HFQA 4S2VA 5GHIA 1R67A 2A6TA 3MDGA 1GA7A 3H95A 3BM4A 3A6SA 5BONA 2G73A 3GRNA 1X51A 3CNGA 3GZ5A 5FSNA 1Q54A 1NFSA 2I6KA 2ICKA 3GG6A 5DEQA 3F6AA 3DUPA 3N9UA 5FSKA 2B0VA 2DSBA 2AZWA 5BS6A 4ICKA 2RRKA 4N1UA 2KDVA 2O5WA 3ZR1A 4HVYA 4JZTA 1V8VA 3KVHA 1X84A 1PPXA 1HX3A 1V8YA 4JZVA 1MQWA 1VCDA 3X0IA 4JZSA 1NQYA 1MR2A 1JRKA 3SONA 1NFZA 3Q2SA 3FJYA 3I7UA 1V8NA 1PUSA 2JVBA 4V14A 3X0MA 3HYQA 1VHGA 1F3YA 5CFJA 2A8TA 2GB5A 2O5FA 3O52A 3X0SA 3HHJA 4KYXA
chains in the Genus database with same CATH superfamily
3Q2TA 2I8TA 3OGAA 3O6ZA 4IJXA 3I7VA 2GT4A 3F13A 1IRYA 3G0QA 1VC9A 5CFIA 1V8IA 1XSBA 3Q93A 4C9WA 5ISYA 2A8QA 3EF5A 1G9QA 1KHZA 2VNQA 4KTBA 3GWYA 2YYHA 1NQZA 3GZ8A 3GZ6A 3COUA 2QJTA 3MGMA 4YPHA 3O8SA 3EESA 4NFXA 3WHWA 4YOQA 1K2EA 2I8UA 1SOIA 2G74A 5DDGA 1TUMA 1V8LA 2KDWA 5ANVA 1VIQA 5GHOA 3L85A 2FMLA 1MUTA 2VNPA 4S2WA 1OW2A 4S2YA 1SU2A 2QJOA 2QKMB 4KG3A 1PUNA 1VRLA 5FSIA 3ID9A 5GHQA 4S2XA 2J8QA 3Q4IA 5C7QA 3BAPA 5IW4A 1XSCA 2Q9PA 2YVOA 1V8UA 2R5WA 4ZG0A 2O1CA 5GHNA 5GHJA 5C8LA 3Q1PA 4N1TA 1V8WA 1VIUA 3X0LA 3P6YA 2DSDA 3I9XA 2DSCA 2PNYA 5DD4A 4DYWA 3N77A 5ANSA 1HZTA 1V8MA 1PUQA 3O69A 1V8TA 3MCFA 3X0NA 5I8UA 1KTGA 2GT2A 3RH7A 3FSPA 1Q33A 1PPVA 3ACAA 2PQVA 4YPRA 2FKBA 2CL3A 5ANWA 4ILQA 5GHMA 2B2KA 3AC9A 5ANTA 1PPWA 2YVNA 3J7Ye 1I9AA 1MP2A 2ICJA 3MDIA 1V8RA 3BHOA 1MQEA 5IW5A 5ANUA 3X0JA 2A8PA 4NFWA 3FCMA 2B06A 3X0RA 3EXQA 1G0SA 3Q91A 3ZR0A 1VC8A 1XSAA 2YVPA 3E57A 3DKUA 1U20A 3O61A 1VK6A 2A8SA 2DHOA 3X0OA 1Q27A 4JZUA 2A8RA 5C7TA 5FSMA 1PVFA 1RRSA 2YVMA 3FK9A 1K26A 5GHPA 1JKNA 4K6EA 2W4EA 3FFUA 3SHDA 3SMDA 3X0PA 1RRQA 1V8SA 2FVVA 4KG4A 3EEUA 1SJYA 3X0QA 3QSJA 2DUKA 1KT9A 4C9XA 1MK1A 3A6UA 1RYAA 5DPKA 2XSQA 3X0KA 3P5TA 1SZ3A 5FSOA 1VHZA 4MPOA 1X83A 3R03A 4J7GA 3A6VA 3A6TA 5FSLA 3U53A 1QVJA 5HZXA 5LPGA 4HFQA 4S2VA 5GHIA 1R67A 2A6TA 3MDGA 1GA7A 3H95A 3BM4A 3A6SA 5BONA 2G73A 3GRNA 1X51A 3CNGA 3GZ5A 5FSNA 1Q54A 1NFSA 2I6KA 2ICKA 3GG6A 2CZRA 3F6AA 4J7HA 3DUPA 3N9UA 5DEQA 5FSKA 2B0VA 2DSBA 2AZWA 5BS6A 4ICKA 2RRKA 4N1UA 2KDVA 2O5WA 3ZR1A 4HVYA 4JZTA 1V8VA 3KVHA 1X84A 1PPXA 1HX3A 1V8YA 4JZVA 1MQWA 1VCDA 3X0IA 4JZSA 1NQYA 1MR2A 1JRKA 3SONA 1NFZA 3Q2SA 3FJYA 3I7UA 1V8NA 1PUSA 2JVBA 4V14A 3X0MA 3HYQA 1VHGA 1F3YA 5CFJA 2A8TA 2GB5A 2O5FA 3O52A 3X0SA 3HHJA 4KYXA
chains in the Genus database with same CATH topology
3Q2TA 2I8TA 3OGAA 3O6ZA 4IJXA 3I7VA 2GT4A 3F13A 1IRYA 3G0QA 1VC9A 5CFIA 1V8IA 1XSBA 3Q93A 4C9WA 5ISYA 2A8QA 3EF5A 1G9QA 1KHZA 2VNQA 4KTBA 3GWYA 2YYHA 1NQZA 3GZ8A 3GZ6A 3COUA 2QJTA 3MGMA 4YPHA 3O8SA 3EESA 4NFXA 3WHWA 4YOQA 1K2EA 2I8UA 1SOIA 2G74A 5DDGA 1TUMA 1V8LA 2KDWA 5ANVA 1VIQA 5GHOA 3L85A 2FMLA 1MUTA 2VNPA 4S2WA 1OW2A 4S2YA 1SU2A 2QJOA 2QKMB 4KG3A 1PUNA 1VRLA 5FSIA 3ID9A 5GHQA 4S2XA 2J8QA 3Q4IA 5C7QA 3BAPA 5IW4A 1XSCA 2Q9PA 2YVOA 1V8UA 2R5WA 4ZG0A 2O1CA 5GHNA 5GHJA 5C8LA 3Q1PA 4N1TA 1V8WA 1VIUA 3X0LA 3P6YA 2DSDA 3I9XA 2DSCA 2PNYA 5DD4A 4DYWA 3N77A 5ANSA 1HZTA 1V8MA 1PUQA 3O69A 1V8TA 3MCFA 3X0NA 5I8UA 1KTGA 2GT2A 3RH7A 3FSPA 1Q33A 1PPVA 3ACAA 2PQVA 4YPRA 2FKBA 2CL3A 5ANWA 4ILQA 5GHMA 2B2KA 3AC9A 5ANTA 1PPWA 2YVNA 3J7Ye 1I9AA 1MP2A 2ICJA 3MDIA 1V8RA 3BHOA 1MQEA 5IW5A 5ANUA 3X0JA 2A8PA 4NFWA 3FCMA 2B06A 3X0RA 3EXQA 1G0SA 3Q91A 3ZR0A 1VC8A 1XSAA 2YVPA 3E57A 3DKUA 1U20A 3O61A 1VK6A 2A8SA 2DHOA 3X0OA 1Q27A 4JZUA 2A8RA 5C7TA 5FSMA 1PVFA 1RRSA 2YVMA 3FK9A 1K26A 5GHPA 1JKNA 4K6EA 2W4EA 3FFUA 3SHDA 3SMDA 3X0PA 1RRQA 1V8SA 2FVVA 4KG4A 3EEUA 1SJYA 3X0QA 3QSJA 2DUKA 1KT9A 4C9XA 1MK1A 3A6UA 1RYAA 5DPKA 2XSQA 3X0KA 3P5TA 1SZ3A 5FSOA 1VHZA 4MPOA 1X83A 3R03A 4J7GA 3A6VA 3A6TA 5FSLA 3U53A 1QVJA 5HZXA 5LPGA 4HFQA 4S2VA 5GHIA 1R67A 2A6TA 3MDGA 1GA7A 3H95A 3BM4A 3A6SA 5BONA 2G73A 3GRNA 1X51A 3CNGA 3GZ5A 5FSNA 1Q54A 1NFSA 2I6KA 2ICKA 3GG6A 2CZRA 3F6AA 4J7HA 3DUPA 3N9UA 5DEQA 5FSKA 2B0VA 2DSBA 2AZWA 5BS6A 4ICKA 2RRKA 4N1UA 2KDVA 2O5WA 3ZR1A 4HVYA 4JZTA 1V8VA 3KVHA 1X84A 1PPXA 1HX3A 1V8YA 4JZVA 1MQWA 1VCDA 3X0IA 4JZSA 1NQYA 1MR2A 1JRKA 3SONA 1NFZA 3Q2SA 3FJYA 3I7UA 1V8NA 1PUSA 2JVBA 4V14A 3X0MA 3HYQA 1VHGA 1F3YA 5CFJA 2A8TA 2GB5A 2O5FA 3O52A 3X0SA 3HHJA 4KYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2T A;  2I8T A;  3OGA A;  3O6Z A;  4IJX A;  3I7V A;  2GT4 A;  3F13 A;  1IRY A;  3G0Q A;  1VC9 A;  5CFI A;  1V8I A;  1XSB A;  3Q93 A;  4C9W A;  5ISY A;  2A8Q A;  3EF5 A;  1G9Q A;  1KHZ A;  2VNQ A;  4KTB A;  3GWY A;  2YYH A;  1NQZ A;  3GZ8 A;  3GZ6 A;  3COU A;  2QJT A;  3MGM A;  4YPH A;  3O8S A;  3EES A;  4NFX A;  3WHW A;  4YOQ A;  1K2E A;  2I8U A;  1SOI A;  2G74 A;  5DDG A;  1TUM A;  1V8L A;  2KDW A;  5ANV A;  1VIQ A;  5GHO A;  3L85 A;  2FML A;  1MUT A;  2VNP A;  4S2W A;  1OW2 A;  4S2Y A;  1SU2 A;  2QJO A;  2QKM B;  4KG3 A;  1PUN A;  1VRL A;  5FSI A;  3ID9 A;  5GHQ A;  4S2X A;  2J8Q A;  3Q4I A;  5C7Q A;  3BAP A;  5IW4 A;  1XSC A;  2Q9P A;  2YVO A;  1V8U A;  2R5W A;  4ZG0 A;  2O1C A;  5GHN A;  5GHJ A;  5C8L A;  3Q1P A;  4N1T A;  1V8W A;  1VIU A;  3X0L A;  3P6Y A;  2DSD A;  3I9X A;  2DSC A;  2PNY A;  5DD4 A;  4DYW A;  3N77 A;  5ANS A;  1HZT A;  1V8M A;  1PUQ A;  3O69 A;  1V8T A;  3MCF A;  3X0N A;  5I8U A;  1KTG A;  2GT2 A;  3RH7 A;  3FSP A;  1Q33 A;  1PPV A;  3ACA A;  2PQV A;  4YPR A;  2FKB A;  2CL3 A;  5ANW A;  4ILQ A;  5GHM A;  2B2K A;  3AC9 A;  5ANT A;  1PPW A;  2YVN A;  3J7Y e;  1I9A A;  1MP2 A;  2ICJ A;  3MDI A;  1V8R A;  3BHO A;  1MQE A;  5IW5 A;  5ANU A;  3X0J A;  2A8P A;  4NFW A;  3FCM A;  2B06 A;  3X0R A;  3EXQ A;  1G0S A;  3Q91 A;  3ZR0 A;  1VC8 A;  1XSA A;  2YVP A;  3E57 A;  3DKU A;  1U20 A;  3O61 A;  1VK6 A;  2A8S A;  2DHO A;  3X0O A;  1Q27 A;  4JZU A;  2A8R A;  5C7T A;  5FSM A;  1PVF A;  1RRS A;  2YVM A;  3FK9 A;  1K26 A;  5GHP A;  1JKN A;  4K6E A;  2W4E A;  3FFU A;  3SHD A;  3SMD A;  3X0P A;  1RRQ A;  1V8S A;  2FVV A;  4KG4 A;  3EEU A;  1SJY A;  3X0Q A;  3QSJ A;  2DUK A;  1KT9 A;  4C9X A;  1MK1 A;  3A6U A;  1RYA A;  5DPK A;  2XSQ A;  3X0K A;  3P5T A;  1SZ3 A;  5FSO A;  1VHZ A;  4MPO A;  1X83 A;  3R03 A;  3A6V A;  3A6T A;  5FSL A;  3U53 A;  1QVJ A;  5HZX A;  5LPG A;  4HFQ A;  4S2V A;  5GHI A;  1R67 A;  2A6T A;  3MDG A;  1GA7 A;  3H95 A;  3BM4 A;  3A6S A;  5BON A;  2G73 A;  3GRN A;  1X51 A;  3CNG A;  3GZ5 A;  5FSN A;  1Q54 A;  1NFS A;  2I6K A;  2ICK A;  3GG6 A;  5DEQ A;  3F6A A;  3DUP A;  3N9U A;  5FSK A;  2B0V A;  2DSB A;  2AZW A;  5BS6 A;  4ICK A;  2RRK A;  4N1U A;  2KDV A;  2O5W A;  3ZR1 A;  4HVY A;  4JZT A;  1V8V A;  3KVH A;  1X84 A;  1PPX A;  1HX3 A;  1V8Y A;  4JZV A;  1MQW A;  1VCD A;  3X0I A;  4JZS A;  1NQY A;  1MR2 A;  1JRK A;  3SON A;  1NFZ A;  3Q2S A;  3FJY A;  3I7U A;  1V8N A;  1PUS A;  2JVB A;  4V14 A;  3X0M A;  3HYQ A;  1VHG A;  1F3Y A;  5CFJ A;  2A8T A;  2GB5 A;  2O5F A;  3O52 A;  3X0S A;  3HHJ A;  4KYX A; 
#chains in the Genus database with same CATH topology
 3Q2T A;  2I8T A;  3OGA A;  3O6Z A;  4IJX A;  3I7V A;  2GT4 A;  3F13 A;  1IRY A;  3G0Q A;  1VC9 A;  5CFI A;  1V8I A;  1XSB A;  3Q93 A;  4C9W A;  5ISY A;  2A8Q A;  3EF5 A;  1G9Q A;  1KHZ A;  2VNQ A;  4KTB A;  3GWY A;  2YYH A;  1NQZ A;  3GZ8 A;  3GZ6 A;  3COU A;  2QJT A;  3MGM A;  4YPH A;  3O8S A;  3EES A;  4NFX A;  3WHW A;  4YOQ A;  1K2E A;  2I8U A;  1SOI A;  2G74 A;  5DDG A;  1TUM A;  1V8L A;  2KDW A;  5ANV A;  1VIQ A;  5GHO A;  3L85 A;  2FML A;  1MUT A;  2VNP A;  4S2W A;  1OW2 A;  4S2Y A;  1SU2 A;  2QJO A;  2QKM B;  4KG3 A;  1PUN A;  1VRL A;  5FSI A;  3ID9 A;  5GHQ A;  4S2X A;  2J8Q A;  3Q4I A;  5C7Q A;  3BAP A;  5IW4 A;  1XSC A;  2Q9P A;  2YVO A;  1V8U A;  2R5W A;  4ZG0 A;  2O1C A;  5GHN A;  5GHJ A;  5C8L A;  3Q1P A;  4N1T A;  1V8W A;  1VIU A;  3X0L A;  3P6Y A;  2DSD A;  3I9X A;  2DSC A;  2PNY A;  5DD4 A;  4DYW A;  3N77 A;  5ANS A;  1HZT A;  1V8M A;  1PUQ A;  3O69 A;  1V8T A;  3MCF A;  3X0N A;  5I8U A;  1KTG A;  2GT2 A;  3RH7 A;  3FSP A;  1Q33 A;  1PPV A;  3ACA A;  2PQV A;  4YPR A;  2FKB A;  2CL3 A;  5ANW A;  4ILQ A;  5GHM A;  2B2K A;  3AC9 A;  5ANT A;  1PPW A;  2YVN A;  3J7Y e;  1I9A A;  1MP2 A;  2ICJ A;  3MDI A;  1V8R A;  3BHO A;  1MQE A;  5IW5 A;  5ANU A;  3X0J A;  2A8P A;  4NFW A;  3FCM A;  2B06 A;  3X0R A;  3EXQ A;  1G0S A;  3Q91 A;  3ZR0 A;  1VC8 A;  1XSA A;  2YVP A;  3E57 A;  3DKU A;  1U20 A;  3O61 A;  1VK6 A;  2A8S A;  2DHO A;  3X0O A;  1Q27 A;  4JZU A;  2A8R A;  5C7T A;  5FSM A;  1PVF A;  1RRS A;  2YVM A;  3FK9 A;  1K26 A;  5GHP A;  1JKN A;  4K6E A;  2W4E A;  3FFU A;  3SHD A;  3SMD A;  3X0P A;  1RRQ A;  1V8S A;  2FVV A;  4KG4 A;  3EEU A;  1SJY A;  3X0Q A;  3QSJ A;  2DUK A;  1KT9 A;  4C9X A;  1MK1 A;  3A6U A;  1RYA A;  5DPK A;  2XSQ A;  3X0K A;  3P5T A;  1SZ3 A;  5FSO A;  1VHZ A;  4MPO A;  1X83 A;  3R03 A;  4J7G A;  3A6V A;  3A6T A;  5FSL A;  3U53 A;  1QVJ A;  5HZX A;  5LPG A;  4HFQ A;  4S2V A;  5GHI A;  1R67 A;  2A6T A;  3MDG A;  1GA7 A;  3H95 A;  3BM4 A;  3A6S A;  5BON A;  2G73 A;  3GRN A;  1X51 A;  3CNG A;  3GZ5 A;  5FSN A;  1Q54 A;  1NFS A;  2I6K A;  2ICK A;  3GG6 A;  2CZR A;  3F6A A;  4J7H A;  3DUP A;  3N9U A;  5DEQ A;  5FSK A;  2B0V A;  2DSB A;  2AZW A;  5BS6 A;  4ICK A;  2RRK A;  4N1U A;  2KDV A;  2O5W A;  3ZR1 A;  4HVY A;  4JZT A;  1V8V A;  3KVH A;  1X84 A;  1PPX A;  1HX3 A;  1V8Y A;  4JZV A;  1MQW A;  1VCD A;  3X0I A;  4JZS A;  1NQY A;  1MR2 A;  1JRK A;  3SON A;  1NFZ A;  3Q2S A;  3FJY A;  3I7U A;  1V8N A;  1PUS A;  2JVB A;  4V14 A;  3X0M A;  3HYQ A;  1VHG A;  1F3Y A;  5CFJ A;  2A8T A;  2GB5 A;  2O5F A;  3O52 A;  3X0S A;  3HHJ A;  4KYX A; 
#chains in the Genus database with same CATH homology
 3Q2T A;  2I8T A;  3OGA A;  3O6Z A;  4IJX A;  3I7V A;  2GT4 A;  3F13 A;  1IRY A;  3G0Q A;  1VC9 A;  5CFI A;  1V8I A;  1XSB A;  3Q93 A;  4C9W A;  5ISY A;  2A8Q A;  3EF5 A;  1G9Q A;  1KHZ A;  2VNQ A;  4KTB A;  3GWY A;  2YYH A;  1NQZ A;  3GZ8 A;  3GZ6 A;  3COU A;  2QJT A;  3MGM A;  4YPH A;  3O8S A;  3EES A;  4NFX A;  3WHW A;  4YOQ A;  1K2E A;  2I8U A;  1SOI A;  2G74 A;  5DDG A;  1TUM A;  1V8L A;  2KDW A;  5ANV A;  1VIQ A;  5GHO A;  3L85 A;  2FML A;  1MUT A;  2VNP A;  4S2W A;  1OW2 A;  4S2Y A;  1SU2 A;  2QJO A;  2QKM B;  4KG3 A;  1PUN A;  1VRL A;  5FSI A;  3ID9 A;  5GHQ A;  4S2X A;  2J8Q A;  3Q4I A;  5C7Q A;  3BAP A;  5IW4 A;  1XSC A;  2Q9P A;  2YVO A;  1V8U A;  2R5W A;  4ZG0 A;  2O1C A;  5GHN A;  5GHJ A;  5C8L A;  3Q1P A;  4N1T A;  1V8W A;  1VIU A;  3X0L A;  3P6Y A;  2DSD A;  3I9X A;  2DSC A;  2PNY A;  5DD4 A;  4DYW A;  3N77 A;  5ANS A;  1HZT A;  1V8M A;  1PUQ A;  3O69 A;  1V8T A;  3MCF A;  3X0N A;  5I8U A;  1KTG A;  2GT2 A;  3RH7 A;  3FSP A;  1Q33 A;  1PPV A;  3ACA A;  2PQV A;  4YPR A;  2FKB A;  2CL3 A;  5ANW A;  4ILQ A;  5GHM A;  2B2K A;  3AC9 A;  5ANT A;  1PPW A;  2YVN A;  3J7Y e;  1I9A A;  1MP2 A;  2ICJ A;  3MDI A;  1V8R A;  3BHO A;  1MQE A;  5IW5 A;  5ANU A;  3X0J A;  2A8P A;  4NFW A;  3FCM A;  2B06 A;  3X0R A;  3EXQ A;  1G0S A;  3Q91 A;  3ZR0 A;  1VC8 A;  1XSA A;  2YVP A;  3E57 A;  3DKU A;  1U20 A;  3O61 A;  1VK6 A;  2A8S A;  2DHO A;  3X0O A;  1Q27 A;  4JZU A;  2A8R A;  5C7T A;  5FSM A;  1PVF A;  1RRS A;  2YVM A;  3FK9 A;  1K26 A;  5GHP A;  1JKN A;  4K6E A;  2W4E A;  3FFU A;  3SHD A;  3SMD A;  3X0P A;  1RRQ A;  1V8S A;  2FVV A;  4KG4 A;  3EEU A;  1SJY A;  3X0Q A;  3QSJ A;  2DUK A;  1KT9 A;  4C9X A;  1MK1 A;  3A6U A;  1RYA A;  5DPK A;  2XSQ A;  3X0K A;  3P5T A;  1SZ3 A;  5FSO A;  1VHZ A;  4MPO A;  1X83 A;  3R03 A;  4J7G A;  3A6V A;  3A6T A;  5FSL A;  3U53 A;  1QVJ A;  5HZX A;  5LPG A;  4HFQ A;  4S2V A;  5GHI A;  1R67 A;  2A6T A;  3MDG A;  1GA7 A;  3H95 A;  3BM4 A;  3A6S A;  5BON A;  2G73 A;  3GRN A;  1X51 A;  3CNG A;  3GZ5 A;  5FSN A;  1Q54 A;  1NFS A;  2I6K A;  2ICK A;  3GG6 A;  2CZR A;  3F6A A;  4J7H A;  3DUP A;  3N9U A;  5DEQ A;  5FSK A;  2B0V A;  2DSB A;  2AZW A;  5BS6 A;  4ICK A;  2RRK A;  4N1U A;  2KDV A;  2O5W A;  3ZR1 A;  4HVY A;  4JZT A;  1V8V A;  3KVH A;  1X84 A;  1PPX A;  1HX3 A;  1V8Y A;  4JZV A;  1MQW A;  1VCD A;  3X0I A;  4JZS A;  1NQY A;  1MR2 A;  1JRK A;  3SON A;  1NFZ A;  3Q2S A;  3FJY A;  3I7U A;  1V8N A;  1PUS A;  2JVB A;  4V14 A;  3X0M A;  3HYQ A;  1VHG A;  1F3Y A;  5CFJ A;  2A8T A;  2GB5 A;  2O5F A;  3O52 A;  3X0S A;  3HHJ A;  4KYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...