3GZ6A

Crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
219
structure length
219
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTERGRPANLYCLKPDTASYRFLRNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein/dna
total genus 59
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz6A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz6A01
1WSUA 3L2CA 4ICKA 1R36A 3E6MA 3F8NA 5CVVA 3V8LA 4NB5A 1U5TB 2QVOA 3REOA 2O5WA 3KVHA 4LMYA 3RI4A 2DK5A 1BBYA 2VT2A 3IRQA 1FP2A 4MHGA 4RB0A 5J8FA 5FO5A 4WK8F 2RDPA 2A69F 4JQFA 3MDGA 2GB5A 1UHWA 4I01A 1DP7P 2NYXA 3HTSB 2PN6A 2F5EA 5E1XA 3FXUA 2A61A 6PAXA 5ILSA 2FNAA 3ECOA 4AD9A 1JKNA 2L54A 5DYMA 3O61A 5IW4A 1S8NA 5D5WB 4LB6B 1XGSA 1U20A 4S2YA 1FSHA 1KYZA 2CYYA 2VT3A 5H6RA 1RNLA 3ZPLA 2QQ9A 2ZNZA 5I8UA 1QZYA 1KQ8A 4PCQA 1YQAA 3ULQB 1R22A 3WGGA 4EJOA 3WTVC 4S04A 2RNJA 2EB7A 2MD5A 3MQ0A 3LAJA 2VC1A 2I8TA 3KEOA 1SJYA 4XRFA 4WWCA 5ANTA 1IW7F 2DW4A 1D3YA 2IPQX 2V1DA 2KKOA 4I0BA 1IRFA 2J5PA 2CSOA 4U88A 3HYIA 3SHDA 4G7HF 5E20A 4EGZA 3CJNA 4B8XA 5DCFA 3FSPA 1P4WA 3SZPA 3RIRA 1TQIA 2CL3A 2IP2A 2YVOA 4PDKA 5LBQA 2MLGA 5A2QK 4BH9A 2EFWA 2Q9PA 1XMKA 3KP6A 3N4MA 2EK5A 2PQVA 5KVRA 1S7AA 2EWNA 4IRIA 3CUOA 2Q0OA 3CO7C 2GXGA 5HLHA 1FBQA 2Z3YA 1ZARA 1BI0A 2OQRA 1S29A 1YTYA 3LAPA 3W6KB 5FD6A 4K2EA 1Q27A 1NFSA 1ON1A 2J5OA 2VBZA 3MZHA 3B02A 3F13A 2O5FA 4LG0B 2QBYA 2HFHA 3IWZA 1SFUA 3F3XA 3RPQA 2EV0A 4UVAA 4ESFA 2G7HA 3E3VA 4IJAA 1BM9A 2D45A 1K6OA 2M30A 2K7LA 1ZGAA 1VC8A 3VFZA 2QZ8A 4A6DA 4RGSA 4GO1A 1VHGA 1F9NA 3BAPA 1X84A 3BP8A 3HRMA 4EMSA 2F2EA 4UUVA 1TLHB 5LGNA 2GZWA 1V8WA 4V14A 2Z9OA 1MJBA 3GUDA 1HSTA 3ABUA 3TQNA 4M74A 1HZTA 1OR7A 2K4JA 4YG2F 3F21A 2P4WA 1QZZA 4CYDA 1KQ0A 4M6XA 1X51A 4IRGA 5D5UB 3SZTA 4DYWA 5LHGA 5GHMA 5LRSA 4HLXA 3EEUA 3A6UA 5D5VB 3BM4A 1W7PA 3JW4A 3ECHA 1XSBA 4HF2A 3ISPA 2CWEA 3BROA 1VTNC 2HYFA 5LPGA 2DSBA 3T8RA 1Z91A 3GF2A 2A5YB 5JHUA 1SU2A 2HKOA 3A6VA 1W4MA 1DDNA 3COUA 2HZTA 2JZYA 2G74A 2HTJA 1L0OC 1PVFA 1XN7A 2O1CA 3MCZA 2ZMEA 4M71A 2MA3A 1S3JA 3T8TA 2MC3A 5GHQA 4ENJA 3Q5FA 2QM3A 1WRJA 5LLQA 1V4RA 4WXHA 3LQQA 3QPTA 3NEUA 2QYOA 3ROUA 2YVMA 4IXAA 1YLFA 2D2WA 1LEAA 4DNCA 3B73A 4GGGA 5GHOA 5DD8A 1G9QA 1ZG1A 1YYVA 2W57A 3M8EA 3QP6A 5AONA 1NFZA 3X0OA 3V8KA 2HEOA 1O3QA 2FNPA 3ERED 2YX7A 2O0YA 2XAHA 5AIPA 1V8YA 1R1VA 4KN4X 2BYVE 3DF8A 3VEPA 1SFXA 2YYHA 1VIUA 1K79A 4HF1A 3R4KA 3RH7A 1U3EM 2EA4A 2WC2A 4LK0F 1GVJA 3GRNA 3K2ZA 3EYIA 3OV8A 1D8KA 4L9TA 2ADUA 2X0LA 1IN6A 2XVCA 3F23A 2F5DA 1K78A 4KT5C 1PP8F 4U7BA 1LEBA 1YW9A 2G9WA 4D0PA 3X0MA 2A8QA 3P5TA 3O2PE 4LFUA 1ON2A 3A6SA 2QUFA 2ZNYA 3BJ6A 3K9TA 4Y17A 4LJZF 2A68F 2K02A 3ZMZA 3ZMUA 2E7XA 3Q2SA 2W4EA 3CUQA 2FBKA 2OBPA 2A8RA 3ZP5A 3WE3A 3ML6A 2ESHA 1IZ1A 1XB4A 5JI6A 4G6DA 3RYRA 4KG4A 4A0YA 3EQLF 1KU3A 2G7UA 3KFWX 2W25A 3F8CA 1IAWA 4AIJA 2JPBA 4JZVA 2GQQA 4KICA 5ED4A 4B09A 4F7ZA 4L9VA 1QNTA 3WGIA 3ID9A 1J2XA 5LHIA 3RKXA 3U2RA 5LHHA 3CO6C 1E2XA 4A5NA 1SFEA 2YPRA 3PQJA 2B0VA 3U9GA 5HLIA 4NFXA 4MNUA 1YG2A 3JAMZ 4XSXF 1SD7A 1OYWA 4M9SA 1I5ZA 4UV9A 4C9XA 4ZZLA 1UFMA 2R3SA 3G0QA 1P2FA 2ACJA 4ETSA 4LLLA 1TTYA 3J81Z 4EQQA 3DPTA 4RGXA 2P6SA 1O3TA 1YIOA 4UVCA 5LEKA 1DPRA 5D6FA 1JE8A 3I7UA 2IT0A 3GXOA 4A5MA 4GYIA 4RB1A 5DUIA 5CJ9A 5D4SA 1RUOA 2ZCWA 4BHPA 2K86A 1FC3A 4TV7A 4Z2YA 3C1DA 2VONA 2PI0A 5D4RA 4EJVA 1XSDA 4HF0A 2BE5F 1HW2A 4KA4A 2VXZA 3ACAA 5ILVA 2ETHA 3HYQA 1ZG5A 4M9XA 5JFRA 2RN7A 3C18A 3WG9A 1YS6A 1Z6RA 3W6JB 2GAUA 1MKMA 2B06A 1IN8A 2RQPA 1G3WA 4KFCA 2STWA 1GA7A 3R6SA 2Z33A 4G7ZF 1HQCA 1V8UA 5IT3A 2H94A 4Q48A 1D8JA 5ANWA 2YVNA 1X3UA 3JTGA 3QRFF 2E7WA 3DKWA 2DPUA 2DAOA 4Y15A 1SAXA 3E5QA 1IN7A 3JTHA 2ICJA 1JRKA 3GWYA 5ANSA 2IA0A 5D8KB 2VN2A 3GO5A 3S2WA 1R23A 2O6GE 3GWZA 2GT4A 5TRDA 1H0MA 2XAQA 3J80Z 2C6YA 4JZTA 2EV5A 4OU0A 4I98B 1FBSA 2VBYA 4GXOA 3DEUA 1L3LA 3Q4IA 1UCRA 2VNQA 1O3SA 2LSOA 2O03A 3WTTC 3NRVA 3BJAA 1F1ZA 1HKQA 1HW5A 1Z7UA 2GA2A 3KCCA 3LA7A 4U0WA 1IXSB 3WU0A 5A2QZ 1V8IA 2QBYB 3I5UA 4EM0B 1EH7A 3N9UA 3COAC 5ERIA 4RAZA 1MDMA 1LVAA 4L0ZB 3O52A 3Q1PA 3P6YA 2IJLA 5FSOA 1AOYA 2HS5A 1J5YA 3FXRA 3FMRA 4A12A 2AXLA 4M6YA 1F3YA 4ENKA 1J7KA 1DPUA 1XSAA 2JTVA 3R0AA 3AC9A 5K5RA 2P5VA 3KP4A 3R03A 2W24A 1PUEE 4O6JA 2L4MA 3BPVA 3IWFA 4RS8A 5GHPA 1CF7B 3ELKA 4OIRF 5C8LA 4A0XA 3ZR1A 1OMIA 4KYWA 3J80K 3I54A 1MQEA 1QVJA 1MJ9A 2DPDA 1ZLKA 2EFPA 3PFIA 3K1MA 3HHJA 3E6DA 3E97A 4KTBA 3O3KA 3R61A 3R60A 4P96A 2M8EA 2WTEA 1BOAA 3P9CA 1FSEA 4P9FA 2XAJA 1USTA 1XCBA 2PBIA 3DP7A 2IA2A 2Z5UA 2G73A 1W7PB 4UV8A 3GYHX 2L4AA 3WE2A 1KYWA 3WGHA 2JRTA 3LSTA 1KT9A 3KZZA 2UWMA 3X0NA 3SFZA 3EF5A 3WTSC 2XRNA 3LA2A 1JHFA 1KU9A 2CW0F 4YFNF 3EDPA 1PUQA 4OOIA 3N97A 1KA8A 3G73A 1OYYA 1YW8A 2ZMEB 4KMUX 1B9NA 5CLSA 5BONA 3AAFA 2NNYA 2ICKA 3CUQC 1ZREA 4L5JA 2KRFA 3HHHA 1TNTA 5E8GA 1QPMA 2P5KA 2KJBA 2FEZA 4EJUA 5HDKA 4N9HA 4AWXB 1XDSA 2H6BA 3K69A 4U0VA 2VOOA 1XGMA 1FYLA 2PQ8A 4CXFA 3MEXA 2M45A 5HLGA 2EJRA 5L3GA 3X0KA 3X0IA 2E1NA 1S7OA 3E6BA 4NHJA 1PUNA 2D1HA 5TJJA 1Q1HA 1BN5A 1YW7A 4H0EA 2O61A 4HAMA 5ISYA 3FX3A 3X0SA 4HDVA 2MH2A 5FFXA 3IHUA 1RRQA 4IVNA 1EH8A 4LGWA 4KYXA 2B0LA 4AIKA 3E5UA 1CGPA 2ZXJA 5HDNA 5DEQA 2ISZA 1IXRC 1ZH5A 3KP3A 2DT5A 1K78B 4JZUA 2FBHA 4E70A 4WXDA 1ONVA 1FP1D 3F22A 5C7QA 3C7JA 1SD6A 3F6OA 3ABTA 2EFNA 4A2UA 4RGRA 5D5XB 5FGMA 4I7HA 1VHZA 2VE9A 1BI1A 3FK9A 2FE3A 2V6CA 4YPHA 1R5GA 2K4BA 1J9IA 2GT2A 4ZZDA 1I9AA 3CUQB 2FA5A 3BZ6A 2R7FA 3T0YA 1NQYA 2NAZA 3FXQA 4OIOF 2FBIA 5E17F 3KP5A 5EEHA 3VB2A 1KHZA 3O6BB 3LA3A 3A6TA 2BBYA 4BNCA 3V7SA 5AIQA 2GXBA 2VBWA 3OGAA 1HSJA 5F64A 2QWWA 2OA4A 2IVMA 4AVPA 2HKXA 1QGPA 4ZYGA 4LLNA 5DDGA 5FSNA 4PGHA 1MQWA 4FHTA 3Q91A 2V9VA 5BPDA 4OINF 5FLXZ 5FSMA 3IKTA 4DQ2A 1PPWA 3U53A 2XKOA 1U78A 1I27A 3FWEA 4WCGA 3SONA 1B9MA 4IHTA 2HGCA 4YFXF 1W7PD 2OAZA 3M9AA 4HLYA 3KLOA 3X0JA 3J7Ye 3F8FA 2XV4S 1EV7A 1OKRA 1BC7C 1J59A 1WWXA 2F5CA 2L02A 3RPUA 4ENNA 2OQGA 4A6EA 1ZRCA 1Q54A 1MK1A 1V8TA 4P5OA 3DFGA 2PEXA 2Q8KA 2HQNA 3V8JA 2KIMA 4MEYF 3TO9A 5C7TA 3OOPA 4I0AA 5ANVA 2O8XA 2KIUA 4LLGF 1R5HA 1ZRDA 4Q4ZF 2Y0MA 4ESBA 2A8SA 4R79A 1K2EA 1V8LA 2CGPA 3ZMSA 3I59A 4ENMA 2KDVA 4EGYA 1IF1A 1IRGA 2DU9A 1G0SA 1OPCA 5FLXK 2M5WA 2XIGA 1XMAA 3BDDA 2A3SA 2L01A 1ZYRF 2M87A 3X0RA 4KNYA 2QJOA 5HDGA 2A6TA 2K27A 5L3DA 3ZN1A 2R7DA 3BOQA 1Z6TA 1T98A 3TDZC 5HS9A 4EM1A 4S2VA 2P6TA 1TNSA 5CVIA 3MZYA 4L18B 2I6KA 3WTZA 5H6QA 2Q2EA 2JPCA 4UNOA 1I6XA 1U8RA 4IRHA 5BQTA 3P7NA 4I02A 1FYKA 3HSRA 4QLCU 1RRSA 2CFXA 1SZ3A 4OIQF 4L0YB 4PZJA 3I4PA 3KE2A 1USSA 1V8NA 1R1TA 2DQLA 2BGCA 3Q2TA 2XASA 5K5QA 3H3UA 3KP7A 3L85A 4G6QA 3O6ZA 2ZKZA 3HRSA 4MPOA 3FMQA 1V8MA 3VOEA 3E57A 1QO0D 1P6RA 4CHUA 4GYGA 4YPRA 1AWCA 1F4KA 2RV8A 3RTRA 1PDNC 3HRUA 3LQRA 1B6AA 3M7GA 4EVIA 3KZYA 2O3FA 5ICEA 4ZYHA 2CQKA 5ILUA 1MDMB 1KQ9A 1FPQA 1VCDA 4HX4A 3GX4X 2AS5F 4G7OF 3FCMA 2HYGD 2DFIA 1SD5A 2CO5A 4ZH4F 1ZLJA 4ASNA 4YFKF 4RB2C 2HWVA 2A6HF 5IW5A 1FZPB 2MLKA 3SXYA 5GHNA 4BHCA 2RVCA 2KDWA 5FFZA 1ZRFA 2Z99A 1R58A 2XAGA 5FD5A 1G3YA 4OIPF 1R67A 2NNNA 3TKYA 2IW5A 2KJCA 3NQOA 1FX7A 5FSKA 1KU2A 1DUXC 2FKBA 2XGXA 2OD5A 1JGSA 4IJXA 3GFIA 1T39A 2RGVA 1ZHFA 2CG4A 4JZSA 1XD7A 1B1BA 2DUKA 4CO8A 2FMLA 4I09A 4UVBA 1W5SA 3FJYA 3EESA 3I7VA 2ZJ2A 1FLIA 1HBXG 5DPKA 4XLNF 1JHHA 1GXQA 3HOTA 1VIQA 3QAHA 1XDUA 2A8TA 5CYVA 2EFQA 1C0WA 2STTA 3R0JA 3DQVC 4BHBA 1HKTA 3T5XA 3IRRA 1V3FA 1B59A 3GVAA 5LGTA 2COMA 5ICGA 2FRHA 3FFUA 2GIVA 2RC4A 2GWRA 3TOBA 3TO6A 3MAJA 5L3FA 2FMYA 3RJPA 4NQWA 3V4GA 3GLXA 4G94A 2NRAC 3MDIA 2DLLA 3Q9VA 2FQ3A 2YSRA 5J8CA 3I53A 4WXCA 2QKMB 1IN4A 3FHZA 2QENA 1NQZA 4P55A 1IXCA 4IPAA 3RDIA 4WX9A 4YOQA 2H09A 5F6FA 1MZBA 3DPLC 3HHGA 4XLPF 4MGRA 1VRLA 3KEQA 4MEXF 4BQAA 2WV0A 4HYEA 5ANUA 1UB9A 2QLZA 1BI2A 2ISYA 4HW0A 2FXAA 5HVQC 3F6VA 1FNNA 5E8IA 2DK8A 1J75A 5LGUA 5CFJA 1XSVA 3FZVA 5DCMA 4FX0A 2FSWA 4LK1F 2ZO4A 1SMYF 1LB2A 2RKHA 2DQRA 2M1BA 2OZUA 4KIFA 3QOPA 1P4AA 5D8LB 1FY7A 4EJTA 5BS6A 2TDXA 3X0QA 1ZAOA 1T2KA 1ODDA 5L3EA 2DHOA 2W85A 1K26A 4A0ZA 1Y0UA 1YFHA 4L5IA 5BOXA 1HW1A 1TW2A 3CNGA 1LDJA 3H92A 5CFIA 5CVRA 1LQ1A 3ZN0A 4CZZA 2H27A 4LB5A 1R7JA 1T6SA 1H9GA 1A04A 3HIFA 2YU3A 2HQRA 3I0TA 4M9ZA 2PFBA 4M73A 1XSXA 3CDHA 1OW2A 3ZR0A 4MQ9F 4HX7A 3TO7A 3SQNA 1BIBA 1ZGJA 2ZFWA 1U5TA 3BY6A 2BEOA 3QPHA 4UHTA 4OMYA 2WWYA 2EFOA 1GHCA 1XCVA 2YR2A 3FMSA 3O8SA 1HXDA 1Z05A 1TW3A 1PPXA 5K1YA 5CVUA 2HR3A 2BV6A 1FOKA 2VOPA 3K0LA 4FT8A 4GCVA 2V1UA 3KP2A 4IF4A 5E1ZB 3WHWA 1LNWA 4CDGA 2V79A 2FOKA 3RKYA 1PPVA 2PNYA 1BC8C 3C3WA 3GEZA 3J7AO 5HZXA 4L9NA 3WODF 3WU1B 3F72A 2PMUA 4CGZA 4RAYA 5K5OA 2FF4A 2VODA 1TBXA 3JSOA 3Q9SA 2YX4A 3D5LA 5EEGA 5DUKA 4ZYEA 3GZ8A 1SD4A 1TQPA 2B2KA 4R1HA 1LDKB 3M1EA 2A8PA 4QWQA 5HS7A 3WTYC 2VE8A 3K1NA 3K1PA 3ZMDA 1W5TA 3BJOA 4N1TA 1CF7A 4O3MA 1LJ9A 4ZG0A 4M72A 2XHKA 4HV5A 1RZ4A 1ZG3A 5H20A 5F1RA 2GA1A 2MBFA 3WTXC 1E17A 1MJAA 5LEJA 3DUPA 3GFJA 3M8FA 4Q47A 1P4XA 1ZN2A 3MCFA 1MUTA 4S2WA 1EH6A 3DKUA 3MGMA 3VODA 1FT9A 3FM3A 1GXPA 1X83A 3MFKA 3HOSA 1O7FA 3E5XA 4YIFA 4BAYA 4IHSA 2DSDA 4FX4A 3WTWC 1H9TA 2JSCA 3I59B 4HX8A 4ZYDA 2LDUA 5D6EA 4KDPA 4HQMA 3QSJA 1YS7A 4Y13A 3L9FA 2LNBA 5IT9Z 1KTGA 4Q5SF 3O69A 1BI3A 4LD5A 2P5LC 1S6LA 2YVPA 4I2OA 2XKPA 1MD0A 5KK1A 4XSZF 1B4AA 3L00A 2VBXA 3I64A 4L9JA 1STZA 4LG0A 1V8VA 1R1UA 3F8MA 1VC9A 3I71A 3U1DA 2X4HA 3ZQ7A 2E1CA 2FU4A 1Z1DA 3TDUC 1WI9A 2QJTA 4HBLA 1SOIA 2PG4A 3IC7A 2UXXA 3CTAA 4K6EA 4S2XA 5DV5A 3L09A 1D5VA 3WTUC 4ESJA 4CICA 1J0RA 4NFWA 4YIIA 1T0FA 4HDUA 3SHFA 3LFKA 1G3TA 2D1VA 4UXNA 3HSEA 2LF8A 2DBBA 3GZ5A 5GHJA 4MTEA 2AZWA 2DTRA 1Z9CA 1FBUA 2XSQA 2W84A 2A6EF 1TUMA 5IT9K 3V7CA 4HZFA 4HVYA 3ZMTA 2VNPA 3I9XA 4G8XA 3EXQA 2DO7A 5L3BA 4EV0A 1P92A 3G3ZA 1REPC 1O3RA 1SMTA 2DSCA 2UXNA 3HSFA 1PP7U 3QU3A 5E18F 1HX3A 3FM5A 1MR2A 1O57A 1Q33A 2LKPA 5BPIA 5ICCA 2XAFA 1RUNA 2QQBA 1VK6A 2I8UA 4XBFA 3IL2A 3JSPA 3KLNA 4KIGA 2JVBA 3RYPA 1G4DA 2HDCA 3X0PA 2RRKA 4HA8A 3FF5A 2EV6A 2P7VB 2H6CA 3H95A 5ICFA 3V7RA 1IN5A 3BHOA 1ULYA 1HKSA 3SMDA 2JT1A 1KGSA 5GHIA 3P9IA 2VC0A 3D0SA 4N0BA 1QQIA 3GW2A 4PGGA 1V8SA 3TOAA 3HUGA 4G9YA 5DD4A 1FWZA 1RIOH 4O5VA 3X0LA 4HQEA 1QBJA 4MQVA 1LDDA 4KUMA 1G3SA 5L3CA 3EYYA 3GFMA 3T1BA 2LF7A 1NHAA 5BMZA 2HOEA 4KG3A 2V1XA 4P9UA 1O7LA 5FB2A 1MGTA 1WQ2A 3TGNA 1TQMA 3F6AA 2L3DA 1F5TA 3EUHA 4U0YA 3H3ZA 3HTUA 3PQKA 2OZ6A 4KIBA 4U7DA 4S05A 1XGOA 3QU6A 1XSCA 4N1UA 4RB3C 3L7WA 5HS8A 4C9WA 2QQAA 1PUSA 1IUYA 1U5TC 2PLYA 2EA2A 1OYIA 2ESNA 3EETA 1I1GA 4WF2A 2J8QA 5CVJA 4AIHA 2MH9A 2A07F 4EJWA 2DI3A 4HOBA 1KU7A 2XROA 2P7CB 4HFQA 3Q93A 4KN7X 1K7AA 1G6NA 5HOOA 1FYMA 2KIFA 2Y75A 2PJPA 4BXUA 1XGNA 2OU2A 2IA1A 5FSLA 5LRRA 5JVTA 3QP5A 3ZMVA 3BWGA 1U6GA 3P9KA 4JBAA 1RI7A 2F5FA 3RKWA 4ON0A 5DCMB 1IRYA 2ZBKA 1WKMA 2HTSA 4KMFA 3MWMA 4RGUA 4EM2A 5JR3A 1JXSA 5FSIA 2PMHA 2P8TA 1UHMA 1U2WA 3GFLA 2XUBA 4BYYA 2FVVA 2Y48A 3JAMK 3F8BA 4OMZA 3LWFA 3DXJF 1R00A 2R5WA 3IKVA 4ILQA 3DV8A 3CLOA 3BPXA 3GZ6A 3I58A 3KETA 1RYAA 4R8HA 3GG6A 1BJAA 2ELHA 4N9IA 3HRTA 1T38A 5E1WA 3J81K 3E6CC 1MP2A 1I1SA 2UZKA 2NS0A 3N77A 1YO5C 1BIAA 1V8RA 4JK1X 4MTDA 5J6XA 2IRFG 4HV6A
chains in the Genus database with same CATH superfamily
2I10A 1WSUA 2DMNA 3SZGA 3L2CA 2DMUA 3GTMJ 4ICKA 1R36A 3E6MA 3F8NA 5CVVA 2FJ1A 4NB5A 1U5TB 2QVOA 3REOA 3V8LA 2DJNA 3AKZA 2O5WA 3KVHA 4E7SA 4LMYA 3SYTA 3RI4A 2DK5A 5JLWA 1BBYA 1MMNA 2VT2A 3IRQA 1FP2A 2DDAA 4MHGA 3BG9A 4RB0A 5J8FA 5FO5A 4WK8F 2RDPA 1ZTRA 2A69F 4JQFA 1FIPA 3MDGA 2GB5A 4Y3OA 1UHWA 4FCYA 3GTPJ 2BY2A 4I01A 1DP7P 2HI3A 2NYXA 3HTSB 2PN6A 2F5EA 2V9KA 1YIJI 5E1XA 3FXUA 2A61A 3ZQLA 6PAXA 3H3VK 5ILSA 4UUSB 4DJAA 2X1EA 2FNAA 2B63J 2CJJA 3AG4H 3ECOA 4D1QA 4AD9A 3BG3A 1JKNA 2L54A 5DYMA 4II3A 3M1CA 1LFPA 3O61A 5EEAA 5IOYA 5IW4A 3DBLB 1S8NA 5D5WB 3QPLA 4LB6B 2NOJB 1A36A 1XGSA 1U20A 2Y69H 4S2YA 2CRGA 2GLOA 1FSHA 1KYZA 1JUSA 2BY3A 1VNDA 2CYYA 3TW7A 2VT3A 5H6RA 3DKXA 1RNLA 2KISA 1X1PA 3IP4B 1Y8RB 4J7GA 3ZPLA 2QQ9A 5M5YJ 2ZNZA 5I8UA 3JRBA 1QZYA 1KQ8A 1RR8C 1O4XA 2EH3A 4B44A 4BQNA 2ID6A 1YQAA 2HVQA 4PCQA 3ULQB 1R22A 3WGGA 3TMOA 4LIVA 1E0EA 4EJOA 3BLYA 3WTVC 5IPAA 4BE1A 4S04A 1TWCJ 2RNJA 4C2MJ 2EB7A 2MD5A 3MQ0A 2ME6A 2JQ7A 3LAJA 1WJ5A 1QU3A 2VC1A 2I8TA 2RAEA 2HYJA 3KEOA 1SJYA 4XRFA 1Z3YA 4WWCA 4FE4A 5ANTA 5HNHA 1IW7F 2DW4A 3PO2J 1WPKA 2HOAA 4DOZA 4BEHA 1T0FC 1D3YA 2IPQX 2V1DA 3G1LA 1YRNA 2KKOA 2HVSA 4I0BA 2BHYA 1IRFA 2EQRA 4JX6A 2J5PA 5CQEA 2CSOA 4U88A 3HYIA 3SHDA 5GPCA 1TP4A 1DU0A 4G7HF 2DMTA 5E20A 4EGZA 3CJNA 4B8XA 5DCFA 3FSPA 1XG1A 1P4WA 3SZPA 3RIRA 1TQIA 2CL3A 2IP2A 2YVOA 2LRDA 3H9GA 4PDKA 5LBQA 2MLGA 5A2QK 4BH9A 4LG3A 5KCMA 1XMKA 3CMYA 2EFWA 2Q9PA 2KMUA 3KP6A 1QZEA 3LSMA 3N4MA 2EK5A 1IV6A 3S8PA 5J3LA 2IS1A 2PQVA 2V26A 5KVRA 1S7AA 5FKNA 2EWNA 3CCEI 3ZXSA 2FX0A 4IRIA 5B66C 3CUOA 2Q0OA 3H0DA 5EG0B 3CO7C 2JWTA 2GXGA 5HLHA 3ERMA 1FBQA 2PJRB 3S14J 2Z3YA 1ZARA 1BI0A 2OQRA 1JT6A 1S29A 1YTYA 3LAPA 1WJFA 3W6KB 1TWFJ 2OCCH 4K2EA 5FD6A 1TC3C 2K9SA 3DCFA 1UG2A 1Q27A 1NFSA 1ON1A 2J5OA 2VBZA 3MZHA 3B02A 3F13A 3PM1A 4LG0B 1MNMC 2CW7A 2QBYA 2O5FA 2HFHA 3IWZA 3GMEA 1SFUA 3F3XA 3RPQA 2EV0A 3DPUA 4UVAA 4ESFA 2G7HA 1AKHB 1LUJB 3E3VA 4IJAA 2L7ZA 1BM9A 2D45A 3BCAA 1K6OA 2M30A 3QWLA 4N4OB 3FDYA 2K7LA 1ZGAA 1VC8A 3VFZA 4HNTA 1MMDA 2HPIA 2QZ8A 1MBJA 1Y8QB 4A6DA 2E35A 5C44J 2LP0A 4RGSA 4GO1A 5HLTA 3A01B 1VHGA 1SVMA 1F9NA 3BAPA 4NC6A 3BZKA 3LOCA 2R7WA 1K6YA 1DU6A 1X84A 2R7TA 3AG1H 3BP8A 4QSHA 2GOMA 3HRMA 2OV7A 4EMSA 2F2EA 4UUVA 1TLHB 3ZGKA 2M7BA 4IQ4A 5LGNA 2GZWA 4C30A 1XX5A 1V8WA 4V14A 3BG7A 3JCUC 2Z9OA 1WHUA 1MJBA 3GUDA 1U9OA 2JUCA 2QGUA 2FQ4A 4G12A 3FXLA 1HSTA 3ABUA 3MD2A 3TQNA 1TWAJ 3Q3SA 4M74A 4DGWB 3GTKJ 2P0WA 1HZTA 1VF9A 4DZJA 2LMDA 1OR7A 2K3PA 2K4JA 4YG2F 3M8JA 3F21A 2P4WA 1QZZA 2CUZA 4CYDA 1KQ0A 2PMZN 1MBFA 4B47A 4M6XA 1X51A 4IRGA 3EUHC 3LSRA 3BQYA 2V7FA 4JYKA 5D5UB 2KRHA 1NG6A 3SZTA 4DYWA 5LHGA 5GHMA 4PSXA 1TZLA 3HG9A 3TP0A 5LRSA 4A3GJ 4HLXA 1TT5B 3EEUA 3A6UA 2MABA 5D5VB 3BM4A 5FKKA 1X3WB 3QPSA 4XR6A 1W7PA 1OJLA 2KQRA 1W0TA 3JW4A 3X2QH 3ECHA 1XSBA 4HF2A 3ISPA 4KT6A 2G0EA 2CWEA 4CH7A 3BROA 1VTNC 2HYFA 5GAHJ 5LPGA 2DSBA 3JRCA 3T8RA 1Z91A 2DOAA 2CH0A 3GF2A 4BDZA 2A5YB 5IYBJ 5JHUA 1SU2A 2HKOA 2ZXWH 3A6VA 3NWSA 1W4MA 4XKBA 1DDNA 1E3OC 3COUA 3BR3A 3A02A 2HZTA 2JZYA 2G74A 2HTJA 1L0OC 1PVFA 1XN7A 2O1CA 2QEXI 2XDVA 2VKDA 2LBFA 3MCZA 5KAIC 4W1UA 2ZMEA 2IS6A 4M71A 3DEEA 2MA3A 2VJJA 1S3JA 1KZHA 3T8TA 4XRSG 2MC3A 3OYLA 3H1CA 5GHQA 4C9YA 4ENJA 4UUTA 1A5JA 2DA7A 2ELJA 2LOOA 3ABKH 4UY8I 3JRIA 3Q5FA 1G59A 2QM3A 1WRJA 4IEJA 2DFHA 5LLQA 3OY9A 1V4RA 4WXHA 3LQQA 4MFDA 3QPTA 3NEUA 3A4CA 1T33A 2QYOA 3HUGB 3ROUA 2YVMA 3OR2C 1YLFA 2D2WA 4IXAA 2B9SA 1LEAA 3K4KA 4DNCA 4FQGA 5B1BH 4XNFA 4JX4A 2LFBA 3B73A 4GGGA 3D5SC 5GHOA 2X6OA 2N8GA 5DD8A 1G9QA 5IYCJ 2CU7A 1ZG1A 1YYVA 2LH9A 2W57A 3M8EA 1RC9A 3QP6A 5AONA 2X85A 1NFZA 3S3NA 3X0OA 3V8KA 2HEOA 1O3QA 3GTGJ 1VZ0A 2FNPA 3ERED 4IO9F 2YX7A 2O0YA 4X1EA 3CC4I 4PFOA 2XAHA 5AIPA 1V8YA 1R1VA 4KN4X 2BYVE 3DF8A 3VEPA 1SFXA 2YYHA 2CQQA 4ZDLA 1VQ8I 1P9QC 1VIUA 3HKZN 1K79A 4HF1A 3CCUI 3R4KA 3RH7A 4F52A 1U3EM 2EA4A 4J7HA 3G4SI 2WC2A 2DA3A 4LK0F 1GVJA 3GRNA 2W4SA 3JRHA 1Q1VA 3CDLA 4IHVA 3F9KA 3K2ZA 2NVUB 3EYIA 3OV8A 1GUUA 2FUG2 1D8KA 4L9TA 2ADUA 3LSIA 2X0LA 1IN6A 2XVCA 2F5DA 3F23A 1K78A 2DOEA 3CJTB 4M3BA 4KT5C 1PP8F 1NK2P 4BBSJ 1AA7A 4U7BA 1VQ7I 3OOUA 1YW9A 2G9WA 1LEBA 2NS8A 2LTPA 4D0PA 2AHQA 2A8QA 3P5TA 3X0MA 3O2PE 4FE7A 4LFUA 1ON2A 3H0GJ 3A6SA 2QUFA 2ZNYA 2E5ZA 3VPRA 1K4TA 2RREA 2L9NA 1ZGWA 3BJ6A 3K9TA 3ZQIA 1R71A 1OCZH 3S3OA 1K83J 2HDWA 4Y17A 1BOBA 1OLTA 2QSFX 3I55I 4LJZF 2R7UA 2A68F 2K02A 4ANJA 1YJNI 3OYMA 3OS1A 4A3DJ 3ZMZA 3BR5A 1MH3A 1RKWA 3S93A 3ZMUA 2L7FP 2E7XA 2M7AA 1A35A 3Q2SA 2W4EA 3CUQA 2FBKA 2OBPA 5HODA 2WB1N 2A8RA 3WE3A 3FXJA 3ZP5A 4D7MA 4XLAA 3ML6A 2ESHA 1IZ1A 3Q0WA 2BY1A 1XB4A 3K4JA 5JI6A 1K4SA 4G6DA 3GTLJ 1Z21A 2EBIA 3RYRA 4EATA 3WU2C 4P1WA 2ZJRF 2Y0SA 4KG4A 4A0YA 3H9JA 3F0CA 2UUZA 3N05A 3LSGA 2ZSHB 2E36A 3EQLF 1KU3A 2G7UA 1FOYA 3KFWX 5EGOB 3OIOA 3WG7H 4ZDPA 4HNVA 2W25A 3F8CA 1IAWA 3KEYA 4AIJA 2JPBA 4JZVA 3HJEA 2GQQA 3C2GA 4KICA 5ED4A 4B09A 4F7ZA 4L9VA 1QNTA 1Z0XA 2ZJPF 4BE2A 5F27A 3WGIA 3ID9A 1J2XA 1SAUA 2KDOA 4CCMA 2HVRA 3DTIA 5LHIA 2VQLA 3RKXA 3HPHA 4AYBN 3U2RA 4CCLA 5LHHA 3CO6C 2R93J 1E2XA 4A5NA 1SFEA 2M3AA 3BTJA 4JP0A 2YPRA 4ABZA 3PQJA 4CYCA 2B0VA 1Y56A 2CUJA 1MH4A 1XC5A 3U9GA 4BXFA 2LREA 1D1AA 5FROA 5M3MJ 5HLIA 4NFXA 4G6TB 4MNUA 1VQ5I 2DJIA 2OCEA 1YG2A 3JAMZ 4XSXF 4RAFA 2OF7A 4XN0A 3L2VA 3CMEI 1SD7A 3OSGA 1OYWA 2VKVA 3HB9A 3KZIC 2L7MP 4M9SA 4C3IJ 1I5ZA 4UV9A 4C9XA 4ZZLA 1UFMA 2R3SA 4C2TA 3G0QA 2HDDA 1OCPA 3OIQA 1P2FA 2LYCA 3S1QJ 2ACJA 4ETSA 4LLLA 3LL7A 2AQFA 2DODA 2TCTA 3OMYA 3OS0A 1GVDA 1TTYA 3J81Z 3SDGA 4EQQA 3DPTA 1QRYA 4RGXA 2P6SA 1AHDP 1O3TA 1YIOA 4UVCA 5LEKA 1DPRA 1S7EA 3UNGC 5D6FA 5IY5H 1JE8A 4XL9A 4XORA 2OPTA 3ZR8X 5GTHC 3I7UA 2IT0A 3J7YJ 1IJWC 4FASD 3GXOA 4IHXA 2Q1ZB 4A5MA 1OFCX 5C4XJ 4NC8A 4YEJA 4GYIA 2K40A 3HZJA 4RB1A 2DFFA 2ELKA 5DUIA 2X9DA 5CJ9A 4J01A 1VQLI 5EZGA 4BDYA 5D4SA 1I3AA 3I56I 1RUOA 2NXNB 2XGEA 2ZCWA 2K86A 3IAM2 4BHPA 1FC3A 3HM5A 4TV7A 4Z2YA 2BXYA 3C1DA 4V2GA 2VONA 4V2FA 2PI0A 2VL8A 3L2UA 5D4RA 4BJTA 4EJVA 3UR3C 4F55A 1XSDA 4HF0A 2IS2A 3MMYB 2BE5F 4XICA 1A6IA 2MFZA 3MKZA 1HW2A 4KA4A 2VXZA 3ACAA 5ILVA 2ETHA 3PFYA 3HYQA 1ZG5A 4M9XA 1I39A 3KYLA 3ZQGA 5JFRA 2CW8A 2RN7A 3C18A 3WG9A 1YS6A 1Z6RA 1ETQA 1MSEC 3W6JB 4L5EA 2GAUA 2R5ZA 1MBKA 2WBMA 1MKMA 1X1DA 2B06A 3MKYB 1IN8A 2WY7Q 2RQPA 1G3WA 4KFCA 2R7VA 2STWA 3BR2A 1GA7A 3R6SA 4OWRB 2Z33A 3H5AA 4G7ZF 1HQCA 2FD5A 3CD6I 1V8UA 5J1UA 5IT3A 2H94A 4Q48A 5B1AH 1RESA 1D8JA 5ANWA 2YVNA 1X3UA 4BEHB 3JTGA 3QRFF 2E7WA 3DKWA 1MMGA 4N4NB 4PJJA 5FRMA 2DPUA 2MG4A 2HOTA 3PIPF 1YRNB 3DKYA 2DAOA 2GM4A 4Y15A 1SAXA 1JT0A 2JVHA 3E5QA 3K4BA 3OYIA 1IN7A 2R7OA 3JTHA 1OR7C 2ICJA 1JRKA 4BE0A 3GWYA 5ANSA 2IA0A 5D8KB 2VN2A 3GO5A 1S5LC 3KX2A 1APLC 5F04A 3S2WA 2NVXJ 1JTYA 1VQOI 1R23A 3CZ6A 2O6GE 5E3LA 1VQKI 3GWZA 4XN3A 4NUBA 2GT4A 4E4HA 5TRDA 2A5WA 3W2WA 2XAQA 1H0MA 3J80Z 2C6YA 4JZTA 2EV5A 4OU0A 4I98B 1FBSA 2GIZA 2VBYA 2W82A 3IH4A 5C4JJ 3S17J 4GXOA 2CV2A 1BW6A 3IV5A 3DEUA 2K5CA 5HNFA 2RQQA 1WI3A 1L3LA 3Q4IA 1UCRA 4MLOA 2VNQA 1HDPA 3PIOF 1N25A 1O3SA 4DIQA 5DM6F 2LSOA 4B3XA 3BR6A 2O03A 1BR4A 3WTTC 3TP3A 3NRVA 4XMYA 3BJAA 1F1ZA 1HKQA 1HW5A 1Z7UA 2GA2A 2XB5A 3KCCA 3LA7A 4ZC3A 1OISA 4U0WA 1IXSB 3WU0A 4I99C 3PO3J 4XQFA 5A2QZ 1V8IA 2QBYB 3I5UA 4EM0B 2O7OA 1EH7A 4YELA 1XS9A 3N9UA 3COAC 5ERIA 2VPLA 3HXLA 4RAZA 1MDMA 2M0MA 1LVAA 3SDBA 4L0ZB 2ZMEC 4ITVA 2R5YA 3O52A 3OWTA 2IS4A 3Q1PA 3ABMH 1FIAA 3P6YA 4M3DA 2IJLA 3KYDB 5FSOA 1AOYA 2HS5A 2LLKA 1J5YA 3FXRA 3FMRA 2VKEA 1XMXA 2AXLA 2WAQA 3EUKL 1ETVA 2DT7B 4M6YA 4A12A 1F3YA 4OAZA 4ENKA 1YI2I 1J7KA 4B43A 1S9HA 1DPUA 3M07A 3B6CA 1XSAA 2JTVA 2VQHA 3R0AA 1HLVA 3AC9A 5K5RA 2R4GA 2P5VA 3KP4A 5FJ8J 3R03A 3S16J 3VYRB 2W24A 2ICWG 3DTKA 4O6JA 1PUEE 3DU6A 5F0HA 2JA2A 2L4MA 2ZSIB 3BPVA 3IWFA 3KYCB 4NBQA 4RS8A 5GHPA 3PUBA 4B4CA 1CF7B 3ELKA 2CQXA 1MNEA 4OIRF 5C8LA 4A0XA 3ZR1A 1OMIA 3MVPA 4KYWA 3J80K 3I54A 1MQEA 1QVJA 2X1CA 1MJ9A 2DPDA 3RSNA 1ZLKA 2K9NA 2EFPA 1MMSA 4IKFA 3PFIA 3HL2A 3K1MA 3HHJA 2M4GA 3E6DA 2H8RA 3E97A 4KTBA 4D9JA 3S1NJ 3BG5A 3O3KA 3R61A 3R60A 4P96A 2M8EA 1POGA 1BOAA 2WTEA 1FTZA 1ZQ3P 3P9CA 1MSFC 2FOWA 1FSEA 4P9FA 5GADJ 2XAJA 1USTA 1DGWY 5FKOA 3ESWB 1XCBA 2PBIA 3DP7A 2IA2A 2Z5UA 3PL8A 2G73A 1DGRM 1W7PB 4UV8A 3GYHX 2L4AA 3BR1A 3FISA 3WE2A 1ZKGA 1KYWA 3WGHA 5FRNA 2IXSA 2E5NA 2JRTA 3LSTA 1KT9A 3KZZA 2W00A 2UWMA 3X0NA 2F5VA 3SFZA 3EF5A 3WTSC 3LSPA 2XRNA 1ZELA 3VDXA 1LE8B 1YX3A 3LA2A 1HC8A 2MSYA 3LSJA 2BVMA 3PUFA 1JHFA 1N78A 1KU9A 1N75A 2CW0F 4MO7A 4YFNF 3CP2A 3EDPA 1PUQA 5E79C 4OOIA 1UAAA 1F36A 2VUMJ 2HXIA 3N97A 1KA8A 3MN2A 3G73A 1OYYA 4BY1J 2NVQJ 2LBFB 4AC0A 1YW8A 2ZMEB 1W1WE 4KMUX 1B9NA 5CLSA 5BONA 3HOWJ 3AAFA 1YE9A 2ID3A 4A93J 3CJQB 3SEQA 4NNJA 2NNYA 2ICKA 1YITI 3W6VA 3CUQC 3C2BA 1WH7A 3D5RC 1ZREA 4L5JA 2KRFA 4M3FA 3HHHA 1TNTA 5E8GA 1QPMA 2P5KA 2KJBA 3K10A 2FEZA 3U1KA 4EJUA 5HDKA 1VI0A 2DXIA 2QQ8A 4N9HA 4AWXB 4RAGA 3L1PA 1XDSA 1NK3P 1X4OA 1ACIA 2H6BA 2F4IA 3K69A 4U0VA 2VOOA 2EZKA 1XGMA 2MYSA 4B3AA 1FYLA 2R7ZJ 2PQ8A 4CXFA 3MEXA 2M45A 2DMPA 5CKTA 3OR1C 3CP8A 3AFHA 4RMNA 3FXOA 5HLGA 2EJRA 5L3GA 3X0KA 4F91B 3X0IA 1LFUP 2E1NA 1S7OA 3E6BA 4NHJA 1PUNA 5J1RA 3CLQA 4J19A 2D1HA 5TJJA 1Q1HA 3CCLI 1BN5A 1YW7A 4C3HJ 4H0EA 2O61A 5FKMA 4U87A 4XM3A 3VYTB 2Y9YA 4HAMA 5ISYA 2EZIA 3FX3A 2F48A 4PJLA 3X0SA 4HDVA 2MH2A 5FFXA 2W7NA 1LKXA 3IHUA 2QKLB 1RRQA 3OYFA 4IVNA 4E7IA 1EH8A 4LGWA 3G1MA 5DM7F 2B0LA 4KYXA 4AIKA 3E5UA 1CGPA 2ZXJA 5HDNA 1BR2A 5TGTA 4M3GA 1E3HA 5DEQA 2ISZA 2BW3A 4F3QA 1IXRC 1ZH5A 1S72I 1G2HA 3LNQA 3KP3A 3HOXJ 2DT5A 1DP3A 3CCVI 4IQJA 1K78B 4JZUA 2FBHA 3FXKA 3K70D 3D1NI 4QPQA 3HDDA 4E70A 4WXDA 3CDIA 1BR1A 1U9NA 1ONVA 4BQOA 1FP1D 3F22A 5C7QA 2M0CA 3C7JA 1SD6A 3F6OA 2RNGA 1WCMJ 1V55H 4D5CA 3JRFA 2JVGA 3ABTA 3PNTA 2EFNA 4A2UA 4RGRA 5D5XB 5FGMA 1XPXA 4I7HA 1BL0A 1VHZA 2VE9A 1BI1A 2XGCA 4RLFA 3FK9A 2CFOA 2FE3A 2V6CA 2QF7A 4YPHA 4F93B 1R5GA 2K4BA 1J9IA 2GT2A 4ZZDA 5BNGA 1JKOC 3CUQB 1I9AA 2L0KA 1Y39A 2FA5A 3BZ6A 2LK2A 2R7FA 4LIUA 2LR8A 1W36C 2AO9A 3HGGA 3T0YA 3A2KA 3BTIA 1NQYA 1BA5A 2NAZA 4LOCA 3W2AA 3FXQA 1PUFA 3VSKA 3BR0A 4OIOF 3OSFA 3OL4A 2FBIA 5E17F 3KP5A 5EEHA 3VB2A 1MNDA 2X48A 2V6EA 1KHZA 3O6BB 2W48A 3LA3A 3A6TA 2BBYA 2XGDA 4BNCA 3V7SA 5AIQA 5EDNA 2GXBA 2VBWA 3OGAA 4A3EJ 1JKQC 1HSJA 2LG4A 5F64A 1SVOA 2QWWA 2E2IJ 3K4LA 2OA4A 4E7LA 2IVMA 4AVPA 2HKXA 1QGPA 3A03A 4ZYGA 5DDGA 4LLNA 5FSNA 4HPQA 4PGHA 1MQWA 3NARA 1RPWA 2PMZA 3AG2H 4FHTA 3OYEA 3Q91A 2V9VA 5BPDA 4OINF 5FLXZ 5FSMA 3IKTA 4DQ2A 4DYCA 1PPWA 4PSWA 4CYCB 2H1LA 3FK7A 2XKOA 3CCMI 1U78A 1I27A 2QCOA 1Z3XA 3FWEA 4WCGA 3SONA 1B9MA 2KZGA 3Q0VA 1W0UA 4IHTA 2A05A 2HGCA 4YFXF 5E3OA 1W7PD 2OAZA 3M9AA 4RM2A 4HLYA 3KLOA 3X0JA 2LC2A 3F8FA 3J7Ye 2XV4S 1EV7A 1OKRA 3K7AJ 2VJIA 3IUOA 2ZXIA 1BC7C 3I9V2 3IH2A 1J59A 1WWXA 2F5CA 2L02A 3RPUA 4ENNA 2OQGA 1EKEA 1WJEA 2L2OA 3OYKA 4A6EA 1D0XA 1ZRCA 3GTQJ 1TL8A 1MK1A 1Q54A 1V8TA 4P5OA 4DZPA 2VI6A 2L7KA 3DFGA 2PEXA 2ZXHA 2Z16A 2Q8KA 2XC7A 2NVTJ 3S32A 2HQNA 3V8JA 2Y9ZA 4DBRA 2KIMA 4MEYF 3TO9A 5C7TA 3OOPA 3OYCA 1X58A 1FEXA 4I0AA 4A3KJ 5ANVA 5DTDA 2BHZA 2CV1A 1ORKA 2DDBA 2JK3A 2CQNA 2KIUA 2O8XA 4Y7NJ 5IYDJ 1EF4A 4LLGF 1R5HA 1ZRDA 4Q4ZF 2K9QA 2JRMA 2X6XA 2Y0MA 4ESBA 3NWTA 4R79A 4EEFG 1K2EA 2A8SA 1V8LA 2EIJH 2CGPA 3ZMSA 3I59A 4ENMA 1R4NB 2KDVA 2YUSA 5GTIC 4EGYA 1IF1A 1IC8A 1IRGA 1FMWA 2DU9A 1G0SA 4CCKA 1Y1VJ 2HNHA 4X6AJ 1OPCA 1BJZA 1WJBA 5FLXK 2M5WA 2XIGA 2XSDC 1XMAA 2GBYA 4J00A 3BDDA 4CZCA 2A3SA 2L01A 1ZYRF 2M87A 3X0RA 4KNYA 2QJOA 5HDGA 2XRLA 2A6TA 4XKWA 4A69C 1EA3A 5IP9J 3WHBA 2R5ZB 2K27A 4RM3A 5L3DA 1VQ9I 1GV5A 1MBHA 3ZN1A 2R7DA 3BOQA 2KL4A 3S3MA 2K9LA 3G71I 1JTXA 2B7EA 5M3FJ 4IHWA 1Z6TA 1I50J 4LITA 1T98A 3TDZC 4BL0B 5HS9A 1W5CC 3FBNB 4EM1A 2EIKH 4S2VA 2P6TA 1TNSA 2DA1A 5CVIA 3MZYA 4L18B 2I6KA 1OCRH 3HKZA 3WTZA 1WJCA 5H6QA 2Q2EA 2JPCA 3NAUA 4UNOA 1I6XA 4QPOA 1U8RA 1RRJA 1QHGA 1IDYA 4IRHA 2GXAA 3VYUB 3P7NA 5BQTA 4I02A 1VQNI 1FYKA 5B5EC 3HSRA 4QLCU 1XTAA 5CPRB 1RRSA 2CFXA 1SZ3A 2LKSA 4OIQF 5F0FA 4L0YB 4PK4A 4PZJA 3I4PA 2XPVA 3KE2A 4UB8C 1I3QJ 1U0JA 1USSA 2VPRA 1QVTA 1V8NA 1R1TA 2DQLA 3ONQA 1X2MA 1MMAA 2BGCA 3ZQCA 3Q2TA 2XASA 5K5QA 3UKGA 3H3UA 1WH5A 1EJ9A 3KP7A 1H89C 4AU7A 5F08A 4DW6A 2IAIA 3L85A 4G6QA 3O6ZA 5IOZA 2ZKZA 3HRSA 4MPOA 3FMQA 3ABLH 2F4MB 1GV2A 3EPZA 1MIJA 1V8MA 3VYSB 3VOEA 3E57A 1QO0D 1P6RA 4CHUA 3DEWA 1GT0C 2DYSH 4GYGA 4PJ0C 4ZTFA 1F4KA 5DS9A 1AWCA 4YPRA 1VFCA 2EPFA 2RV8A 3H5NA 3RTRA 3K4NA 4W97A 4B1RA 5GPAA 4MFEA 1PDNC 3HRUA 2WB1A 3OL3A 3LQRA 1B6AA 1SC7A 3ASNH 3M7GA 4OAYA 4EVIA 2ZJQF 3KZYA 2O3FA 5ICEA 4ZYHA 5K7ZA 5JVGF 2CQKA 3QQAA 5ILUA 3CC7I 2DMQA 2IGOA 1MDMB 1IG7A 3W2VA 2R5YB 1KQ9A 1FPQA 3RZOJ 2KHMA 1VCDA 2YU9J 4HX4A 3GX4X 4KJZA 2AS5F 3P5JA 4G7OF 1BW5A 4UB6C 3FCMA 2HYGD 2H8WA 1AU7A 2DFIA 1SD5A 3ZCOA 2CO5A 2KZVA 4ZH4F 1ZLJA 4ASNA 4YFKF 5C3EJ 4RB2C 2HWVA 2A6HF 3FXMA 5IW5A 2Y30A 3FBIB 4IX7A 1FZPB 4BJ6C 3S2DJ 2MLKA 2F4OB 2R7XA 4AYBA 3SXYA 5GHNA 4BHCA 2RVCA 2KDWA 4M3EA 5FFZA 1ZRFA 2VB6A 2Z99A 1R58A 2XAGA 5FD5A 2M9HA 1G3YA 4OIPF 1R67A 1FMVA 1R6RA 2NNNA 4JX5A 3TKYA 2OTJI 1T8IA 2HQ5A 2IW5A 2KJCA 2Y31A 3CESA 3H9QA 3NQOA 1FX7A 1OCCH 1KU2A 5FSKA 1DUXC 4FTHA 3JRGA 2FKBA 2XGXA 2OD5A 1JGSA 2K85A 2COBA 4IJXA 3GFIA 1T39A 2RGVA 5J40A 1K61A 2JMWA 4XLHA 1ZHFA 2CG4A 2CUEA 1XD7A 2CZRA 1RKTA 4JZSA 3LSHA 4PJNA 2CQ7A 1B1BA 4Z6YA 2DUKA 2DA4A 3FKJA 4CCJA 3HOYJ 4A3MJ 4CO8A 2FMLA 2WAQN 1WVRA 2ECCA 4I09A 4UVBA 1W5SA 4A3JJ 2LY2A 3FJYA 3EESA 3A0HC 3OYNA 3I7VA 2ZJ2A 1D1CA 1FLIA 1HBXG 3I4NJ 5DPKA 1Y6IA 4XLNF 1JHHA 1GXQA 3HOTA 4RBOA 1VIQA 3PSIA 4CCOA 3QAHA 1WGXA 3AL0C 1IDZA 3OYDA 1XDUA 3HPGA 2A8TA 4Y4RA 2DA6A 1IRXA 4XLCA 2EFQA 5CYVA 1C0WA 2STTA 3R0JA 3DQVC 4BGDA 4BHBA 1B8IA 1HA8A 1HKTA 3T5XA 3IRRA 1V3FA 1B59A 3GVAA 3SFIA 2COMA 5LGTA 2WY8Q 3TL4X 5ICGA 3JRDA 2R7SA 4ZTJA 2FRHA 3FFUA 2GIVA 2RC4A 2GWRA 3A1YA 1Y0NA 3QYEA 4XKCA 3TOBA 2VQGA 3TO6A 3MAJA 1W36D 3SEZA 5L3FA 1HCRA 2AQEA 1ETXA 2FMYA 1GLNA 3RJPA 4NQWA 3V4GA 1Z77A 2L9SA 1UELB 1MBEA 3GLXA 3K4MA 4G94A 2NRAC 3MDIA 5IP7J 2DLLA 3Q9VA 2HPMA 4HRIA 2FQ3A 2GOXB 1JKPC 1WJAA 2YSRA 5J8CA 3BG6A 3I53A 4HNUA 5KNLA 5M5WJ 1ENHA 3DBRB 4JOMA 4WXCA 2KDZA 2QKMB 1IN4A 1UJ8A 3QYBA 3G6EI 1DQUA 2E1OA 2QENA 3FHZA 1NQZA 4P55A 1IXCA 1LPQA 2DCEA 4IPAA 2BZTA 3RDIA 1WJDA 4WX9A 2K3FA 4YOQA 2H09A 5F6FA 4A3FJ 2KLOA 1RR7A 2F6CA 1MZBA 3DPLC 3HHGA 4XKVA 5F1JA 4XLPF 4MGRA 2QA4I 3ZQQA 1VRLA 3KEQA 4MEXF 4E7KA 2E34A 2WV0A 4HYEA 4BQAA 5ANUA 1UB9A 2JUGA 2QLZA 1D5YA 2DT6A 1BI2A 1MW7A 5FLMJ 2ISYA 3ZQFA 2VJ4A 4HW0A 1F43A 2FXAA 2CS3A 5K7FA 4NDLA 4Y33A 5HVQC 1P7JA 1GDTA 3F6VA 1FNNA 5E8IA 2DK8A 4I6ZA 5LGUA 4DBQA 1J75A 5CFJA 1XSVA 3FZVA 5DCMA 4FX0A 2FSWA 2CUFA 1VQMI 4XOPA 4LK1F 2XF7A 1B72A 2ZO4A 1SMYF 1JJ6C 2W1OA 4FETA 1LB2A 2RKHA 2DQRA 2M1BA 2OZUA 2UV1A 4KIFA 1VQ6I 4PFPA 3QOPA 1P4AA 2KIQA 1V5GA 1SANA 5D8LB 1X1AA 3OYJA 1FY7A 1YX5A 4EJTA 2H1KA 2OJED 5BS6A 2TDXA 3X0QA 1SVLA 1G8XA 1ZAOA 1T2KA 1ODDA 5L3EA 3JRAA 1V5FA 2CV0A 4V19K 3AL0B 1UHSA 2DHOA 2W85A 4M6VA 1K26A 2BW3B 3ZQHA 4BJ5C 4A0ZA 3Q0UA 1Y0UA 1YFHA 4L5IA 5BOXA 1HW1A 1TW2A 3CNGA 1LDJA 1V5EA 2VKHA 2XSJC 3H92A 2IGNA 5CVRA 3ZN0A 1R9TJ 1V54H 4CZZA 1NH3A 1LQ1A 2H27A 1R7JA 1T6SA 4LB5A 3G1OA 1H9GA 1D0YA 1FTTA 1A04A 2EZHA 3HIFA 2YU3A 4XK4A 2HQRA 2MC4A 1R5ID 3I0TA 3LSKA 4M9ZA 4QTRA 3JR9A 2PFBA 4M73A 3CCYA 1XSXA 3DBHB 3CDHA 3IH3A 1OW2A 4XLFA 3ZR0A 4MQ9F 5J4YA 2IGKA 4GFBA 4HX7A 3TO7A 3HC7A 4DYRA 3SQNA 2V9PA 3J7ZI 5EF6A 1BIBA 5LFAA 1ZGJA 3HGYA 3DLLF 2ZFWA 1U5TA 3BY6A 2BEOA 2OC6A 3S2HJ 3QPHA 4UHTA 2Z2SB 4OMYA 2WWYA 2EFOA 1GHCA 3CMAI 2IGMA 3S15J 1XCVA 2YR2A 3FMSA 1T08B 3M4OJ 3O8SA 1HXDA 1PUFB 1Z05A 1TW3A 1PPXA 4YIRX 4BU2A 5K1YA 2DTZA 5CVUA 2HR3A 3BC8A 2BV6A 1FOKA 1ETKA 4UUSA 3OYGA 2VOPA 4II2A 3K0LA 4FT8A 2O8KA 4GCVA 4A3BJ 2V1UA 3KP2A 4IF4A 5E1ZB 2JA7J 2VXDA 3WHWA 1LNWA 2BVLA 4CDGA 2V79A 4CUGA 1VQ4I 3I4MJ 3PSFA 2FOKA 2O5RA 3RKYA 1PPVA 2PNYA 2P81A 1BC8C 3CMMA 2L9VA 3C3WA 4XLEA 2DOFA 3GEZA 3J7AO 4GRIA 5HZXA 3E1SA 4L9NA 3WODF 3WU1B 5EYRA 3F72A 2ZC2A 3J7AY 2AXTC 2PMUA 4CGZA 4RAYA 5K5OA 2FF4A 2VODA 1TBXA 3JSOA 1UG0A 3Q9SA 5J1YA 2YX4A 2VQCA 3D5LA 5EEGA 5DUKA 3TW6A 4F92B 4ZDOA 4ZYEA 4CA0A 3GZ8A 1SD4A 1TQPA 4RA2A 1FOXA 2B2KA 2EIMH 1LDKB 4R1HA 3ZOBA 1QA6A 1X1CA 2WV1A 3KIOA 3M1EA 2A8PA 4BKXA 2MGQA 4AVZA 2YS9A 4QWQA 1H8AC 2BXZA 5HS7A 3U21A 3WTYC 2XF6A 2LKXA 2VE8A 2KRCA 3K1NA 3K1PA 3ZMDA 5FKLA 1W5TA 3BT9A 3HEFA 4HG2A 4I76A 3BJOA 4N1TA 1CF7A 4O3MA 2X1DA 5JLXA 1LJ9A 4ZG0A 4M72A 2XHKA 1E3PA 3CCSI 1Y1WJ 4HV5A 4XOTA 1RZ4A 1IRZA 1ZG3A 5H20A 2DN0A 2GA1A 2MBFA 5F1RA 3WTXC 1U8BA 1E17A 1MJAA 5LEJA 3GCMA 3GZNB 1TT0A 3GFJA 3DUPA 3M8FA 4Q47A 1P4XA 1ZN2A 2KP6A 1JKRC 3MCFA 3FHNA 1MUTA 3QODA 2R7RA 1EH6A 2HZDA 2XPUA 3BQZA 5KHDA 3DKUA 2I5UA 4S2WA 4RLQA 3MGMA 4IOCF 2EINH 2V1NA 3VODA 1FT9A 3FM3A 4C3JJ 3CC2I 1GXPA 1X83A 2EILH 3MFKA 3HOSA 1O7FA 3E5XA 3L2RA 4YIFA 4BAYA 4IHSA 2X51A 4NC7A 2JA8J 1A31A 4FISA 4FX4A 3WTWC 1R49A 4IL6C 2DSDA 2ZFUA 1H9TA 2JSCA 3I59B 4HX8A 4B48A 4PUSA 2LDUA 4ZYDA 5D6EA 1OCTC 4KDPA 4HQMA 1SFKA 3DTEA 3QSJA 1YS7A 2NOGA 2HXOA 3QYFA 1X2NA 4Y13A 2OUMA 5EG0A 3VWBA 1Z67A 3L9FA 2LNBA 3TEDA 2HU9A 1LE8A 2O9LA 5IT9Z 1IO2A 1KTGA 3S1RJ 4C2UA 4Q5SF 3O69A 1X19A 1BI3A 2PJRA 3K2AA 4LD5A 2P5LC 1D1BA 3AG3H 1S6LA 5K7HA 1IV8A 2YVPA 3VSLA 4HSTA 2XKPA 4I2OA 1MD0A 4E7ZA 1QPIA 2E19A 5KK1A 3GTJJ 3TBIA 5JHFA 4XSZF 2ME0A 1B4AA 3L00A 2VBXA 3I64A 4L9JA 2WADA 1STZA 4LG0A 1T95A 1V8VA 4A3IJ 2KPMA 2E1MC 1R1UA 3F8MA 1VC9A 3I71A 2Z1DA 2XPWA 2JJ7A 3O8HA 1J09A 1ETYA 3U1DA 1AKHA 2X4HA 1HF0A 3MKLA 4BQQA 3OYBA 2Q2EB 3RCOA 3B6AA 3ZQ7A 5TISC 3L2QA 1N77A 1HOMA 2X6YA 2E1CA 2FU4A 1Z1DA 2LVSA 4E6KG 3TDUC 1WI9A 1PYVA 1SFOJ 3A01A 2QJTA 4HBLA 4BXXJ 2ZB9A 1M1EB 1SOIA 3BCBA 2PG4A 1LFBA 3OYAA 1P7IA 3IC7A 5E3MA 2UXXA 1X4PA 2Y2ZA 3CTAA 4K6EA 4S2XA 5DV5A 3L09A 2Y0SN 1D5VA 3WTUC 1JJ8C 4ESJA 2E2JJ 2HOSA 2QSGX 4CICA 1J0RA 2QSHX 2TRTA 3K4CA 3HOVJ 4NFWA 1YJ9I 4H4KC 4YIIA 3BTCA 1T0FA 4HDUA 3SHFA 3LFKA 5GAEJ 2JA6J 2M4KA 4BUPA 1G3TA 1OCOH 2D1VA 2HQAA 4UXNA 4A3LJ 3HSEA 2L5QA 2DBBA 2LF8A 2NS7A 3GZ5A 3K6GA 3O8GA 1ZR2A 5GHJA 4MIMA 3M3YJ 2XAUA 4MTEA 4ZJZA 2AZWA 2DTRA 1FOWA 1FBUA 1Z9CA 1VQPI 3HOUJ 2XSQA 2W84A 2A6EF 3IAS2 1TUMA 5IT9K 3BTLA 3V7CA 4HZFA 4HVYA 3ZMTA 4KITB 1ETWA 2LY1A 1PVEA 3ZRGA 3RQ4A 2VNPA 4RDUA 5LD2C 3I9XA 1JGGA 4G8XA 3FK6A 2E60A 1UZCA 3EXQA 2DO7A 1R4MB 1HDDC 4DYQA 5L3BA 3OIPA 4EV0A 1P92A 3G3ZA 4AIDA 1REPC 2JN6A 1O3RA 4XIDA 2M8GX 3BZCA 1T56A 4HSRA 1SMTA 2DSCA 2UXNA 3HSFA 1PP7U 3QU3A 3GBGA 4XRSA 1QHHD 4QIWN 5E18F 1HX3A 1X3ZB 3FM5A 4BY7J 2PX9A 1MR2A 1H88C 1O57A 1Q33A 2LKPA 5BPIA 5ICCA 4GDFA 2WA0A 3RKQA 1MBGA 3S1MJ 2XAFA 2KFDA 3EUAA 1RUNA 5KAFC 2QQBA 1VK6A 2I8UA 2X6WA 1ZR4A 2M34A 4XBFA 3IL2A 9ANTA 3JSPA 2E1MB 3KLNA 4KIGA 2JVBA 3RYPA 2JA5J 3KPHA 1G4DA 2HDCA 3PJRA 3X0PA 2DA5A 1IUFA 2RRKA 4HA8A 3FF5A 3H5RA 1A6QA 2I8DA 2EV6A 5J4VA 2P7VB 2H6CA 4ZYAA 3H95A 4S0HB 3L2WA 5ICFA 1ETOA 3OYHA 3V7RA 1NG7A 1IN5A 3BHOA 1LVKA 1ULYA 1HKSA 1YOVB 4PJMA 4BBRJ 3SMDA 2JT1A 1KGSA 4IOAF 5GHIA 2E71A 2R0QC 2D5VA 1PJRA 2MW8A 3P9IA 5EJCA 2VC0A 3RPUD 3D0SA 4N0BA 1QQIA 3GW2A 3DLAA 4PGGA 1V8SA 3H36A 3TOAA 5M5XJ 1YHQI 3HUGA 2LY9A 4G9YA 5DD4A 1ITYA 1FWZA 3E0JB 4IHYA 1RIOH 4CCNA 4O5VA 3X0LA 4HQEA 4XONA 5GAGJ 1QBJA 1WFXA 4MQVA 1LDDA 4KUMA 3CCRI 1G3SA 5L3CA 2XF5A 3EYYA 3GFMA 3T1BA 1KONA 4D7NA 2DA2A 2IBDA 1NHAA 2LF7A 5BMZA 5H2FC 2DFEA 1JI8A 2ECBA 2HOEA 1B8IB 1FJLA 4KG3A 2V1XA 4P9UA 1O7LA 3I3LA 1MGTA 5FB2A 1WQ2A 3TGNA 1TQMA 3F6AA 2L3DA 1NTCA 2EZLA 3CCQI 1F5TA 3EUHA 4U0YA 3H3ZA 3HTUA 2VJ5A 3PQKA 2IEKA 1QVUA 2OZ6A 4KIBA 4U7DA 3DWLE 3HOZJ 2XB0X 2VASA 1JUPA 2NVYJ 4BS9A 4S05A 1XGOA 3CCJI 1I6HJ 3QU6A 4X0GA 4NQWB 1XSCA 4N1UA 4RB3C 1JUMA 5CQGA 4KISA 4AUXA 2E2HJ 2VIXA 3L7WA 5HS8A 4C9WA 2QQAA 1PUSA 3MZ8A 3CQZJ 1IUYA 1U5TC 2PLYA 2EA2A 4CSWA 1OYIA 1ZK8A 2BOLA 2ESNA 3EETA 1I1GA 4WF2A 2J8QA 1RETA 2DYRH 5CVJA 2R7QA 3PNVA 4AIHA 3OS2A 5FLVA 2M2EA 2MH9A 3U53A 2A07F 2BY0A 4EJWA 2JSPA 2DI3A 4XRMA 4HOBA 1KU7A 2XROA 2P7CB 3SJMA 4HFQA 3Q93A 4KN7X 3K70C 1G6NA 1K7AA 5HOOA 1FYMA 3LFUA 1OQYA 2KIFA 3C2HA 2Y75A 3MKWB 2PJPA 4AM3A 4BXUA 4HEA2 5E3NA 1IGNA 1XGNA 2OU2A 2VLAA 4YRVA 2IA1A 5FSLA 5LRRA 5JVTA 3QP5A 1UMQA 4Y52J 2WAEA 3ZMVA 2MD0A 5GP9A 5F0CA 5B3SH 3BWGA 1U6GA 3P9KA 2KT0A 1CQTA 3FKIJ 4JBAA 1RI7A 2F5FA 3A0BC 3V42A 3RKWA 3DU5A 4ON0A 5DCMB 3CF5F 3E7LA 1IRYA 2ZBKA 1WKMA 4IZZA 2HTSA 1B72B 4KMFA 3MWMA 2V4JC 4RGUA 4EM2A 5JR3A 1JXSA 5J47A 2LD5A 5FSIA 2CMPA 2PMHA 2WAFA 2P8TA 5EZHA 1UHMA 1U2WA 3GFLA 3HBLA 1YJWI 2XUBA 4D5FA 4BYYA 1X1BA 2FVVA 2Y48A 4E7JA 3JAMK 3F8BA 4OMZA 3LWFA 3DXJF 1WZ2A 3PNYA 5EGOA 1R00A 3RZDJ 2R5WA 3IKVA 3GTOJ 4ILQA 3DV8A 3WHCA 3CLOA 3BPXA 3LMMA 3GZ6A 3I58A 3KETA 1TWGJ 1RYAA 4R8HA 3W3CA 3GG6A 1BJAA 3CJRB 2ELHA 1ERDA 4N9IA 3HRTA 1Z7LA 2L9RA 3RQIA 3ASOH 1T38A 5E1WA 1D0ZA 3J81K 3E6CC 1MP2A 1I1SA 1SEUA 2K9MA 4BACA 2UZKA 2NS0A 3N77A 1YO5C 3QOEA 3CF2A 1TWHJ 1BIAA 5IP6A 1V8RA 3H35A 3GLLA 3G2BA 4A3CJ 3JREA 4JK1X 4MTDA 5J6XA 3FIWA 2IRFG 4HV6A 4E7HA 5CFIA 2R92J 2OTLI
chains in the Genus database with same CATH topology
1WSUA 3L2CA 4ICKA 1R36A 3E6MA 3F8NA 5CVVA 3V8LA 4NB5A 1U5TB 2QVOA 3REOA 2O5WA 3KVHA 4LMYA 3RI4A 2DK5A 1BBYA 2VT2A 3IRQA 1FP2A 4MHGA 4RB0A 5J8FA 5FO5A 4WK8F 2RDPA 2A69F 4JQFA 3MDGA 2GB5A 1UHWA 4I01A 1DP7P 2NYXA 3HTSB 2PN6A 2F5EA 5E1XA 3FXUA 2A61A 6PAXA 5ILSA 2FNAA 3ECOA 4AD9A 1JKNA 2L54A 5DYMA 3O61A 5IW4A 1S8NA 5D5WB 4LB6B 1XGSA 1U20A 4S2YA 1FSHA 1KYZA 2CYYA 2VT3A 5H6RA 1RNLA 4J7GA 3ZPLA 2QQ9A 2ZNZA 5I8UA 1QZYA 1KQ8A 4PCQA 1YQAA 3ULQB 1R22A 3WGGA 4EJOA 3WTVC 4S04A 2RNJA 2EB7A 2MD5A 3MQ0A 3LAJA 2VC1A 2I8TA 3KEOA 1SJYA 4XRFA 4WWCA 5ANTA 1IW7F 2DW4A 1D3YA 2IPQX 2V1DA 2KKOA 4I0BA 1IRFA 2J5PA 2CSOA 4U88A 3HYIA 3SHDA 4G7HF 5E20A 4EGZA 3CJNA 4B8XA 5DCFA 3FSPA 1P4WA 3SZPA 3RIRA 1TQIA 2CL3A 2IP2A 2YVOA 4PDKA 5LBQA 2MLGA 5A2QK 4BH9A 2EFWA 2Q9PA 1XMKA 3KP6A 3N4MA 2EK5A 2PQVA 5KVRA 1S7AA 2EWNA 4IRIA 3CUOA 2Q0OA 3CO7C 2GXGA 5HLHA 1FBQA 2Z3YA 1ZARA 1BI0A 2OQRA 1S29A 1YTYA 3LAPA 3W6KB 5FD6A 4K2EA 1Q27A 1NFSA 1ON1A 2J5OA 2VBZA 3MZHA 3B02A 3F13A 2O5FA 4LG0B 2QBYA 2HFHA 3IWZA 1SFUA 3F3XA 3RPQA 2EV0A 4UVAA 4ESFA 2G7HA 3E3VA 4IJAA 1BM9A 2D45A 1K6OA 2M30A 2K7LA 1ZGAA 1VC8A 3VFZA 2QZ8A 4A6DA 4RGSA 4GO1A 1VHGA 1F9NA 3BAPA 1X84A 3BP8A 3HRMA 4EMSA 2F2EA 4UUVA 1TLHB 5LGNA 2GZWA 1V8WA 4V14A 2Z9OA 1MJBA 3GUDA 1HSTA 3ABUA 3TQNA 4M74A 1HZTA 1OR7A 2K4JA 4YG2F 3F21A 2P4WA 1QZZA 4CYDA 1KQ0A 4M6XA 1X51A 4IRGA 5D5UB 3SZTA 4DYWA 5LHGA 5GHMA 5LRSA 4HLXA 3EEUA 3A6UA 5D5VB 3BM4A 1W7PA 3JW4A 3ECHA 1XSBA 4HF2A 3ISPA 2CWEA 3BROA 1VTNC 2HYFA 5LPGA 2DSBA 3T8RA 1Z91A 3GF2A 2A5YB 5JHUA 1SU2A 2HKOA 3A6VA 1W4MA 1DDNA 3COUA 2HZTA 2JZYA 2G74A 2HTJA 1L0OC 1PVFA 1XN7A 2O1CA 3MCZA 2ZMEA 4M71A 2MA3A 1S3JA 3T8TA 2MC3A 5GHQA 4ENJA 3Q5FA 2QM3A 1WRJA 5LLQA 1V4RA 4WXHA 3LQQA 3QPTA 3NEUA 2QYOA 3ROUA 2YVMA 4IXAA 1YLFA 2D2WA 1LEAA 4DNCA 3B73A 4GGGA 5GHOA 5DD8A 1G9QA 1ZG1A 1YYVA 2W57A 3M8EA 3QP6A 5AONA 1NFZA 3X0OA 3V8KA 2HEOA 1O3QA 2FNPA 3ERED 2YX7A 2O0YA 2XAHA 5AIPA 1V8YA 1R1VA 4KN4X 2BYVE 3DF8A 3VEPA 1SFXA 2YYHA 1VIUA 1K79A 4HF1A 3R4KA 3RH7A 1U3EM 2EA4A 4J7HA 2WC2A 4LK0F 1GVJA 3GRNA 3K2ZA 3EYIA 3OV8A 1D8KA 4L9TA 2ADUA 2X0LA 1IN6A 2XVCA 3F23A 2F5DA 1K78A 4KT5C 1PP8F 4U7BA 1LEBA 1YW9A 2G9WA 4D0PA 3X0MA 2A8QA 3P5TA 3O2PE 4LFUA 1ON2A 3A6SA 2QUFA 2ZNYA 3BJ6A 3K9TA 4Y17A 4LJZF 2A68F 2K02A 3ZMZA 3ZMUA 2E7XA 3Q2SA 2W4EA 3CUQA 2FBKA 2OBPA 2A8RA 3ZP5A 3WE3A 3ML6A 2ESHA 1IZ1A 1XB4A 5JI6A 4G6DA 3RYRA 4KG4A 4A0YA 3EQLF 1KU3A 2G7UA 3KFWX 2W25A 3F8CA 1IAWA 4AIJA 2JPBA 4JZVA 2GQQA 4KICA 5ED4A 4B09A 4F7ZA 4L9VA 1QNTA 3WGIA 3ID9A 1J2XA 5LHIA 3RKXA 3U2RA 5LHHA 3CO6C 1E2XA 4A5NA 1SFEA 2YPRA 3PQJA 2B0VA 3U9GA 5HLIA 4NFXA 4MNUA 1YG2A 3JAMZ 4XSXF 1SD7A 1OYWA 4M9SA 1I5ZA 4UV9A 4C9XA 4ZZLA 1UFMA 2R3SA 3G0QA 1P2FA 2ACJA 4ETSA 4LLLA 1TTYA 3J81Z 4EQQA 3DPTA 4RGXA 2P6SA 1O3TA 1YIOA 4UVCA 5LEKA 1DPRA 5D6FA 1JE8A 3I7UA 2IT0A 3GXOA 4A5MA 4GYIA 4RB1A 5DUIA 5CJ9A 5D4SA 1RUOA 2ZCWA 4BHPA 2K86A 1FC3A 4TV7A 4Z2YA 3C1DA 2VONA 2PI0A 5D4RA 4EJVA 1XSDA 4HF0A 2BE5F 1HW2A 4KA4A 2VXZA 3ACAA 5ILVA 2ETHA 3HYQA 1ZG5A 4M9XA 5JFRA 2RN7A 3C18A 3WG9A 1YS6A 1Z6RA 3W6JB 2GAUA 1MKMA 2B06A 1IN8A 2RQPA 1G3WA 4KFCA 2STWA 1GA7A 3R6SA 2Z33A 4G7ZF 1HQCA 1V8UA 5IT3A 2H94A 4Q48A 1D8JA 5ANWA 2YVNA 1X3UA 3JTGA 3QRFF 2E7WA 3DKWA 2DPUA 2DAOA 4Y15A 1SAXA 3E5QA 1IN7A 3JTHA 2ICJA 1JRKA 3GWYA 5ANSA 2IA0A 5D8KB 2VN2A 3GO5A 3S2WA 1R23A 2O6GE 3GWZA 2GT4A 5TRDA 1H0MA 2XAQA 3J80Z 2C6YA 4JZTA 2EV5A 4OU0A 4I98B 1FBSA 2VBYA 4GXOA 3DEUA 1L3LA 3Q4IA 1UCRA 2VNQA 1O3SA 2LSOA 2O03A 3WTTC 3NRVA 3BJAA 1F1ZA 1HKQA 1HW5A 1Z7UA 2GA2A 3KCCA 3LA7A 4U0WA 1IXSB 3WU0A 5A2QZ 1V8IA 2QBYB 3I5UA 4EM0B 1EH7A 3N9UA 3COAC 5ERIA 4RAZA 1MDMA 1LVAA 4L0ZB 3O52A 3Q1PA 3P6YA 2IJLA 5FSOA 1AOYA 2HS5A 1J5YA 3FXRA 3FMRA 4A12A 2AXLA 4M6YA 1F3YA 4ENKA 1J7KA 1DPUA 1XSAA 2JTVA 3R0AA 3AC9A 5K5RA 2P5VA 3KP4A 3R03A 2W24A 1PUEE 4O6JA 2L4MA 3BPVA 3IWFA 4RS8A 5GHPA 1CF7B 3ELKA 4OIRF 5C8LA 4A0XA 3ZR1A 1OMIA 4KYWA 3J80K 3I54A 1MQEA 1QVJA 1MJ9A 2DPDA 1ZLKA 2EFPA 3PFIA 3K1MA 3HHJA 3E6DA 3E97A 4KTBA 3O3KA 3R61A 3R60A 4P96A 2M8EA 2WTEA 1BOAA 3P9CA 1FSEA 4P9FA 2XAJA 1USTA 1XCBA 2PBIA 3DP7A 2IA2A 2Z5UA 2G73A 1W7PB 4UV8A 3GYHX 2L4AA 3WE2A 1KYWA 3WGHA 2JRTA 3LSTA 1KT9A 3KZZA 2UWMA 3X0NA 3SFZA 3EF5A 3WTSC 2XRNA 3LA2A 1JHFA 1KU9A 2CW0F 4YFNF 3EDPA 1PUQA 4OOIA 3N97A 1KA8A 3G73A 1OYYA 1YW8A 2ZMEB 4KMUX 1B9NA 5CLSA 5BONA 3AAFA 2NNYA 2ICKA 3CUQC 1ZREA 4L5JA 2KRFA 3HHHA 1TNTA 5E8GA 1QPMA 2P5KA 2KJBA 2FEZA 4EJUA 5HDKA 4N9HA 4AWXB 1XDSA 2H6BA 3K69A 4U0VA 2VOOA 1XGMA 1FYLA 2PQ8A 4CXFA 3MEXA 2M45A 5HLGA 2EJRA 5L3GA 3X0KA 3X0IA 2E1NA 1S7OA 3E6BA 4NHJA 1PUNA 2D1HA 5TJJA 1Q1HA 1BN5A 1YW7A 4H0EA 2O61A 4HAMA 5ISYA 3FX3A 3X0SA 4HDVA 2MH2A 5FFXA 3IHUA 1RRQA 4IVNA 1EH8A 4LGWA 4KYXA 2B0LA 4AIKA 3E5UA 1CGPA 2ZXJA 5HDNA 5DEQA 2ISZA 1IXRC 1ZH5A 3KP3A 2DT5A 1K78B 4JZUA 2FBHA 4E70A 4WXDA 1ONVA 1FP1D 3F22A 5C7QA 3C7JA 1SD6A 3F6OA 3ABTA 2EFNA 4A2UA 4RGRA 5D5XB 5FGMA 4I7HA 1VHZA 2VE9A 1BI1A 3FK9A 2FE3A 2V6CA 4YPHA 1R5GA 2K4BA 1J9IA 2GT2A 4ZZDA 1I9AA 3CUQB 2FA5A 3BZ6A 2R7FA 3T0YA 1NQYA 2NAZA 3FXQA 4OIOF 2FBIA 5E17F 3KP5A 5EEHA 3VB2A 1KHZA 3O6BB 3LA3A 3A6TA 2BBYA 4BNCA 3V7SA 5AIQA 2GXBA 2VBWA 3OGAA 1HSJA 5F64A 2QWWA 2OA4A 2IVMA 4AVPA 2HKXA 1QGPA 4ZYGA 4LLNA 5DDGA 5FSNA 4PGHA 1MQWA 4FHTA 3Q91A 2V9VA 5BPDA 4OINF 5FLXZ 5FSMA 3IKTA 4DQ2A 1PPWA 3U53A 2XKOA 1U78A 1I27A 3FWEA 4WCGA 3SONA 1B9MA 4IHTA 2HGCA 4YFXF 1W7PD 2OAZA 3M9AA 4HLYA 3KLOA 3X0JA 3J7Ye 3F8FA 2XV4S 1EV7A 1OKRA 1BC7C 1J59A 1WWXA 2F5CA 2L02A 3RPUA 4ENNA 2OQGA 4A6EA 1ZRCA 1Q54A 1MK1A 1V8TA 4P5OA 3DFGA 2PEXA 2Q8KA 2HQNA 3V8JA 2KIMA 4MEYF 3TO9A 5C7TA 3OOPA 4I0AA 5ANVA 2O8XA 2KIUA 4LLGF 1R5HA 1ZRDA 4Q4ZF 2Y0MA 4ESBA 2A8SA 4R79A 1K2EA 1V8LA 2CGPA 3ZMSA 3I59A 4ENMA 2KDVA 4EGYA 1IF1A 1IRGA 2DU9A 1G0SA 1OPCA 5FLXK 2M5WA 2XIGA 1XMAA 3BDDA 2A3SA 2L01A 1ZYRF 2M87A 3X0RA 4KNYA 2QJOA 5HDGA 2A6TA 2K27A 5L3DA 3ZN1A 2R7DA 3BOQA 1Z6TA 1T98A 3TDZC 5HS9A 4EM1A 4S2VA 2P6TA 1TNSA 5CVIA 3MZYA 4L18B 2I6KA 3WTZA 5H6QA 2Q2EA 2JPCA 4UNOA 1I6XA 1U8RA 4IRHA 5BQTA 3P7NA 4I02A 1FYKA 3HSRA 4QLCU 1RRSA 2CFXA 1SZ3A 4OIQF 4L0YB 4PZJA 3I4PA 3KE2A 1USSA 1V8NA 1R1TA 2DQLA 2BGCA 3Q2TA 2XASA 5K5QA 3H3UA 3KP7A 3L85A 4G6QA 3O6ZA 2ZKZA 3HRSA 4MPOA 3FMQA 1V8MA 3VOEA 3E57A 1QO0D 1P6RA 4CHUA 4GYGA 4YPRA 1AWCA 1F4KA 2RV8A 3RTRA 1PDNC 3HRUA 3LQRA 1B6AA 3M7GA 4EVIA 3KZYA 2O3FA 5ICEA 4ZYHA 2CQKA 5ILUA 1MDMB 1KQ9A 1FPQA 1VCDA 4HX4A 3GX4X 2AS5F 4G7OF 3FCMA 2HYGD 2DFIA 1SD5A 2CO5A 4ZH4F 1ZLJA 4ASNA 4YFKF 4RB2C 2HWVA 2A6HF 5IW5A 1FZPB 2MLKA 3SXYA 5GHNA 4BHCA 2RVCA 2KDWA 5FFZA 1ZRFA 2Z99A 1R58A 2XAGA 5FD5A 1G3YA 4OIPF 1R67A 2NNNA 3TKYA 2IW5A 2KJCA 3NQOA 1FX7A 5FSKA 1KU2A 1DUXC 2FKBA 2XGXA 2OD5A 1JGSA 4IJXA 3GFIA 1T39A 2RGVA 1ZHFA 2CG4A 4JZSA 1XD7A 2CZRA 1B1BA 2DUKA 4CO8A 2FMLA 4I09A 4UVBA 1W5SA 3FJYA 3EESA 3I7VA 2ZJ2A 1FLIA 1HBXG 5DPKA 4XLNF 1JHHA 1GXQA 3HOTA 1VIQA 3QAHA 1XDUA 2A8TA 5CYVA 2EFQA 1C0WA 2STTA 3R0JA 3DQVC 4BHBA 1HKTA 3T5XA 3IRRA 1V3FA 1B59A 3GVAA 5LGTA 2COMA 5ICGA 2FRHA 3FFUA 2GIVA 2RC4A 2GWRA 3TOBA 3TO6A 3MAJA 5L3FA 2FMYA 3RJPA 4NQWA 3V4GA 3GLXA 4G94A 2NRAC 3MDIA 2DLLA 3Q9VA 2FQ3A 2YSRA 5J8CA 3I53A 4WXCA 2QKMB 1IN4A 3FHZA 2QENA 1NQZA 4P55A 1IXCA 4IPAA 3RDIA 4WX9A 4YOQA 2H09A 5F6FA 1MZBA 3DPLC 3HHGA 4XLPF 4MGRA 1VRLA 3KEQA 4MEXF 4BQAA 2WV0A 4HYEA 5ANUA 1UB9A 2QLZA 1BI2A 2ISYA 4HW0A 2FXAA 5HVQC 3F6VA 1FNNA 5E8IA 2DK8A 1J75A 5LGUA 5CFJA 1XSVA 3FZVA 5DCMA 4FX0A 2FSWA 4LK1F 2ZO4A 1SMYF 1LB2A 2RKHA 2DQRA 2M1BA 2OZUA 4KIFA 3QOPA 1P4AA 5D8LB 1FY7A 4EJTA 5BS6A 2TDXA 3X0QA 1ZAOA 1T2KA 1ODDA 5L3EA 2DHOA 2W85A 1K26A 4A0ZA 1Y0UA 1YFHA 4L5IA 5BOXA 1HW1A 1TW2A 3CNGA 1LDJA 3H92A 5CFIA 5CVRA 1LQ1A 3ZN0A 4CZZA 2H27A 4LB5A 1R7JA 1T6SA 1H9GA 1A04A 3HIFA 2YU3A 2HQRA 3I0TA 4M9ZA 2PFBA 4M73A 1XSXA 3CDHA 1OW2A 3ZR0A 4MQ9F 4HX7A 3TO7A 3SQNA 1BIBA 1ZGJA 2ZFWA 1U5TA 3BY6A 2BEOA 3QPHA 4UHTA 4OMYA 2WWYA 2EFOA 1GHCA 1XCVA 2YR2A 3FMSA 3O8SA 1HXDA 1Z05A 1TW3A 1PPXA 5K1YA 5CVUA 2HR3A 2BV6A 1FOKA 2VOPA 3K0LA 4FT8A 4GCVA 2V1UA 3KP2A 4IF4A 5E1ZB 3WHWA 1LNWA 4CDGA 2V79A 2FOKA 3RKYA 1PPVA 2PNYA 1BC8C 3C3WA 3GEZA 3J7AO 5HZXA 4L9NA 3WODF 3WU1B 3F72A 2PMUA 4CGZA 4RAYA 5K5OA 2FF4A 2VODA 1TBXA 3JSOA 3Q9SA 2YX4A 3D5LA 5EEGA 5DUKA 4ZYEA 3GZ8A 1SD4A 1TQPA 2B2KA 4R1HA 1LDKB 3M1EA 2A8PA 4QWQA 5HS7A 3WTYC 2VE8A 3K1NA 3K1PA 3ZMDA 1W5TA 3BJOA 4N1TA 1CF7A 4O3MA 1LJ9A 4ZG0A 4M72A 2XHKA 4HV5A 1RZ4A 1ZG3A 5H20A 5F1RA 2GA1A 2MBFA 3WTXC 1E17A 1MJAA 5LEJA 3DUPA 3GFJA 3M8FA 4Q47A 1P4XA 1ZN2A 3MCFA 1MUTA 4S2WA 1EH6A 3DKUA 3MGMA 3VODA 1FT9A 3FM3A 1GXPA 1X83A 3MFKA 3HOSA 1O7FA 3E5XA 4YIFA 4BAYA 4IHSA 2DSDA 4FX4A 3WTWC 1H9TA 2JSCA 3I59B 4HX8A 4ZYDA 2LDUA 5D6EA 4KDPA 4HQMA 3QSJA 1YS7A 4Y13A 3L9FA 2LNBA 5IT9Z 1KTGA 4Q5SF 3O69A 1BI3A 4LD5A 2P5LC 1S6LA