3GZ6A

Crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
219
structure length
219
Chain Sequence
QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTERGRPANLYCLKPDTASYRFLRNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein/dna
total genus 59
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz6A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz6A01
3IWZA 3NEUA 4G6QA 4RS8A 2HOEA 3CJNA 2FQ3A 4OINF 2EV6A 5IW4A 1E2XA 3E3VA 1QNTA 1RUOA 3N9UA 2XHKA 3BM4A 1HKTA 1U5TC 4EJTA 1XSAA 3MCFA 1MP2A 4BYYA 3SONA 4ENMA 5ANVA 2QBYA 2RVCA 4LD5A 5E1ZB 2JVBA 2TDXA 1FLIA 1V8VA 4HW0A 3F72A 4NHJA 1ZGJA 2FU4A 4RB3C 1H9TA 2PJPA 1RYAA 3ELKA 3WGIA 2LKPA 3O52A 4WXDA 2IA0A 2ZNZA 1NFZA 4MQ9F 5ICCA 3M9AA 5F64A 5HDKA 2LDUA 1G9QA 2XAFA 2J5OA 4EJWA 3VFZA 4G7ZF 2GAUA 3PQKA 4BHCA 2CL3A 1B1BA 1FP2A 2RDPA 4JZSA 4B8XA 4NFWA 4OIRF 5JVTA 2A07F 2Y48A 3IRQA 3KLNA 2QYOA 5D5WB 2EA2A 4YFXF 1ULYA 2JSCA 2P5LC 3ZN0A 2ZO4A 1S7OA 4OMYA 4HQMA 1IN6A 1VRLA 2HEOA 3RYPA 2A61A 1MDMB 4S2YA 4K6EA 1ZARA 1IRGA 4YOQA 1YW8A 2GXGA 3X0RA 5L3FA 2MLGA 4MHGA 2Y0MA 5ICGA 1HZTA 5ISYA 2BBYA 5ILUA 4ZYGA 2O1CA 3RPQA 4CDGA 2F5CA 2DUKA 3WE2A 2JZYA 4KYWA 1EH7A 2VC1A 3JTGA 4KG3A 2X4HA 1V8UA 1BN5A 4XLNF 5DD4A 1TQIA 2STWA 2M87A 4PGGA 4S2WA 3I7VA 5C7QA 2KDVA 1XGOA 3HHHA 2IW5A 5F1RA 4BAYA 3KCCA 2XV4S 5LBQA 3KZYA 5ED4A 4Q4ZF 4MNUA 3GWYA 5BS6A 3QP6A 2KRFA 4ZZLA 3WTYC 5K5OA 3DQVC 2OZ6A 1TUMA 4AIHA 4DYWA 1KU3A 2PBIA 2XASA 1G6NA 5J8FA 2G74A 2PEXA 3ECOA 1JE8A 3VEPA 4Y13A 3P9CA 4R1HA 3C7JA 4I2OA 3KLOA 4M72A 2CG4A 5GHNA 5GHOA 3ROUA 4KG4A 2OQGA 3V8KA 3K69A 5D4SA 2EV0A 5LEJA 3GRNA 1NHAA 2OD5A 5D8KB 2LSOA 1PPWA 3N77A 2DK5A 3QU6A 3TKYA 4JQFA 1Q33A 4O5VA 2O5FA 1SOIA 4PZJA 1BI0A 1I9AA 3T1BA 2L4MA 1MGTA 2VBZA 2HYGD 3LSTA 4A12A 1WI9A 1DP7P 5FSMA 1XDUA 2EFQA 1FX7A 3MGMA 2HYFA 2X0LA 5BPIA 3BDDA 5FSOA 1CGPA 2ZBKA 5AIPA 4WF2A 4G6DA 1C0WA 1O7FA 2PLYA 3BROA 5DUIA 2QLZA 1F5TA 3KE2A 3LQQA 2AS5F 4GCVA 4JK1X 3FXQA 1K78A 5DYMA 1SZ3A 1IZ1A 4EM1A 1FOKA 1U78A 3P5TA 4HX7A 5LHGA 5LGUA 3A6VA 2W24A 1KYWA 4OMZA 1XSBA 5FO5A 1XCBA 5JHUA 2HTJA 2XVCA 2HGCA 2OQRA 2VODA 3JSOA 2A8TA 3GLXA 2HZTA 2W25A 1KQ9A 3LQRA 4HOBA 4V14A 1ZAOA 4I0BA 3QAHA 2M45A 4Q5SF 2NAZA 4EGZA 2G7HA 1UHMA 1USTA 1XDSA 2A6EF 2YVOA 5BOXA 2O03A 3J81K 3RYRA 3EETA 4GO1A 3EUHA 4HQEA 5HS8A 3OGAA 3DEUA 3TO7A 4KNYA 2A3SA 1YO5C 4MTDA 3TO6A 4FX0A 2RNJA 5KK1A 3HSFA 3DP7A 1KT9A 1X83A 1ZRDA 3E6MA 4ZYEA 4ESFA 3TQNA 3I7UA 2L3DA 1F4KA 3X0KA 4XBFA 3BP8A 3GZ6A 1ODDA 2D45A 1TW2A 3C3WA 5ANTA 1U5TB 1F9NA 2CO5A 4N9HA 3KVHA 2D1HA 1S8NA 2L54A 3LFKA 1ZYRF 5D4RA 5DCMB 3L7WA 1YTYA 2FBIA 3AAFA 3HHGA 3ECHA 1ZLKA 2I6KA 2A69F 1HW1A 2OAZA 4GXOA 1VC9A 1B59A 2ETHA 3ISPA 3TOAA 1IRFA 2KJBA 3EYIA 3ZP5A 5FB2A 1TW3A 1H9GA 5E17F 2Z9OA 4KDPA 3H92A 3IKTA 3FX3A 1MKMA 3FSPA 4YIIA 3GO5A 2V1DA 4LFUA 2HR3A 2K4BA 4BNCA 1GHCA 2VT3A 3CUQA 1SU2A 1EH8A 2CWEA 3S2WA 3SFZA 1Z91A 1D8JA 5GHJA 3HRSA 4N1TA 1DPRA 3EYYA 4N9IA 3EQLF 3R0AA 1JXSA 3O3KA 3KP2A 3QPHA 2GQQA 3SQNA 5GHPA 4I7HA 1UB9A 2CQKA 2MLKA 3M7GA 3FCMA 1U2WA 2RKHA 2GA2A 3MAJA 2XAQA 4ESBA 2XAGA 2NNYA 2I8UA 2B06A 3KP7A 3Q5FA 1EV7A 1Z6RA 1PPXA 1KU7A 1T39A 2PQ8A 1Z1DA 1R00A 2LF8A 1VIUA 3FM3A 3R61A 2EFWA 3QP5A 4FT8A 5CVRA 1NFSA 3F22A 4UVBA 1D3YA 4A0XA 1MK1A 2R7DA 3FMQA 2QM3A 4EVIA 2EFOA 3EF5A 3LAJA 1S3JA 4KUMA 3RTRA 3I71A 3I59A 2VONA 3O69A 3ABUA 4G8XA 3WU1B 4S2VA 1P4XA 4GYIA 3GFIA 2QJTA 3JAMZ 4EJUA 3E5QA 3TGNA 1QGPA 1HXDA 1USSA 5H6RA 1U8RA 1BI2A 5KVRA 1KQ0A 1KU9A 5AONA 4WX9A 2QBYB 4WK8F 2VBXA 2QVOA 1D8KA 2HWVA 2CW0F 3RPUA 3X0MA 4HYEA 3X0LA 1ONVA 2P5KA 5GHMA 1P6RA 3ERED 2PMUA 2DLLA 4HX4A 3HHJA 1LJ9A 1V8YA 1SD4A 2XUBA 4I01A 2QJOA 4LB6B 1R1UA 3BJAA 4EQQA 4ENJA 1J0RA 5ICEA 2XKPA 3CUQC 1HSTA 2HS5A 1XSDA 2DI3A 3L9FA 1BBYA 3J80Z 1UFMA 4IVNA 5L3GA 2ISZA 3R0JA 5HS7A 2IPQX 4L9JA 2DPUA 2ZMEA 5K5QA 2FOKA 4QWQA 4ASNA 4L9NA 1FY7A 5LHHA 1TQPA 1HW5A 3TDZC 2FMYA 1JGSA 1LEAA 3BWGA 4R8HA 4HLYA 1LDKB 4AD9A 3BOQA 3O6ZA 2G7UA 2WV0A 4IHSA 4HF0A 4WXCA 1KGSA 3BJOA 2MBFA 4A2UA 1RUNA 3RIRA 4G7OF 3EXQA 4A0ZA 2K02A 3KP3A 5H6QA 1ZH5A 3CO6C 1XMAA 2XAJA 1R58A 2PMHA 1O7LA 3MEXA 3V7CA 3OV8A 4LGWA 4UXNA 1QZYA 2QUFA 4KMFA 1FZPB 3T8RA 1JHFA 4MEYF 1FBSA 1JKNA 2ADUA 1A04A 1R23A 2V79A 4HAMA 1G0SA 1LB2A 4KIBA 1MJAA 4I0AA 4UVCA 1ZG1A 3EDPA 5L3BA 2NNNA 5E20A 2QQBA 5D5VB 2Q8KA 1V8IA 2FSWA 3F23A 4EMSA 3K0LA 3WTXC 5JR3A 1WKMA 3ID9A 5FLXK 1KA8A 4ENNA 2YYHA 1KU2A 1QBJA 3F6AA 3X0NA 3K1NA 1S6LA 3IC7A 1LDDA 4XSXF 3WGGA 5CLSA 1VIQA 2D1VA 3KP4A 3L00A 1XN7A 4L0YB 5TJJA 4NFXA 2FMLA 3V7SA 1IN8A 1FNNA 3MDGA 3HRTA 2DFIA 1RRQA 4C9WA 5LRRA 1VK6A 3F8CA 3Q93A 4ZH4F 3FXUA 4U0VA 1K78B 2HTSA 2RRKA 5D6FA 3WGHA 4LG0A 2PG4A 5FGMA 3EESA 2ICJA 2OU2A 5HLIA 4A5MA 2VNPA 1Z05A 2L4AA 5HLHA 4U0YA 1VTNC 5FSLA 2M8EA 1K6OA 1O3QA 2ZFWA 4M6XA 3GX4X 2Z33A 1K7AA 2RGVA 2FNAA 1U20A 1Z6TA 1F1ZA 1F3YA 1OKRA 3SHDA 1RNLA 4WXHA 4HZFA 1AOYA 3IHUA 3REOA 2YSRA 2DBBA 3LWFA 1YW7A 4CYDA 1T6SA 3T0YA 1MR2A 5ANWA 3GFMA 2VC0A 3KP5A 3ZN1A 2QQAA 1V3FA 4ENKA 2YR2A 1REPC 1BC7C 4JZVA 1J59A 1QO0D 5CFIA 5F6FA 2E1CA 2ZNYA 3E6CC 2CFXA 2ICKA 2JT1A 3WE3A 4JBAA 2QWWA 2STTA 2O8XA 3PFIA 2VOPA 1I1SA 2NS0A 1FPQA 3FJYA 2GXBA 3E97A 2OZUA 3SMDA 2O61A 2Y75A 2DSDA 3U1DA 3GUDA 2V6CA 3RKWA 5BQTA 2P5VA 2LNBA 1W7PA 1IXRC 4P9FA 1PP7U 1XGSA 2GT2A 2QKMB 4NB5A 3HOSA 3E5XA 2P6SA 4MQVA 1Q27A 5FD5A 2VE9A 4O6JA 3FM5A 2C6YA 1R5GA 3K2ZA 4IRIA 3J81Z 2GZWA 2MH2A 3F8FA 1D5VA 3CUQB 1TQMA 4KN7X 1U6GA 1SFXA 3Q2SA 1GVJA 2YVNA 1WQ2A 4JZUA 3F8BA 3RKXA 1FSHA 2F5DA 3HIFA 4HLXA 3HYIA 4PCQA 4Y15A 3BHOA 1G3TA 3V4GA 5ANSA 4LB5A 3N4MA 4EV0A 3I54A 4N1UA 5CFJA 2Q0OA 2A6TA 2DAOA 1L3LA 1DUXC 1T2KA 1RI7A 3HTSB 4L18B 1XSCA 4ETSA 3F6OA 3LA2A 4M73A 3DKWA 4KA4A 1BOAA 2YU3A 1YQAA 2LF7A 1QZZA 4IRHA 5BPDA 3TOBA 3P7NA 4RGXA 2F2EA 3ZMVA 3F8MA 3QOPA 4BHBA 1G3YA 3RI4A 1OYWA 1R1TA 4AIJA 1ON1A 3ABTA 4QLCU 4WCGA 3V8LA 4Z2YA 3R03A 4WWCA 1SMTA 4Q48A 5LHIA 3I5UA 5C8LA 2DSCA 3O8SA 3NQOA 1DDNA 1WWXA 5E18F 1GXPA 1MQWA 3I59B 4S05A 2KDWA 1BC8C 1I1GA 2O5WA 1IN5A 3FMSA 1T38A 1AWCA 5IT9K 4KFCA 1T0FA 4KMUX 2WTEA 5DDGA 1BIBA 1X84A 4MGRA 1SFEA 2COMA 4P96A 1Z9CA 3BAPA 3AC9A 3RJPA 5AIQA 2RQPA 3P9KA 1J7KA 4G94A 4HFQA 1LNWA 5JFRA 3V7RA 4G9YA 5EEHA 2O6GE 4Q47A 1O57A 4ZYHA 1VHZA 4UV9A 4YFNF 2BYVE 1RIOH 3JSPA 1K79A 2A8RA 1Q1HA 2MC3A 4EJVA 4UNOA 3A6UA 3ZMUA 2MH9A 3BZ6A 1UHWA 2UZKA 1R67A 2ZCWA 2J5PA 3E6DA 1G4DA 1MUTA 4LMYA 3ML6A 3Q9VA 4ON0A 3ZR0A 3WODF 2FKBA 5E8GA 3WTWC 2DPDA 4U88A 2ZMEB 2EFNA 5JI6A 3JW4A 1E17A 1R36A 4PDKA 1YG2A 4ESJA 4TV7A 2JPCA 3GFLA 2DW4A 4RGUA 3MZHA 1SFUA 2OA4A 3FFUA 2VE8A 1P4WA 3WTVC 3BPVA 4AVPA 2AXLA 1XGNA 1FP1D 5BONA 3Q91A 5HDGA 3GXOA 1VHGA 2R5WA 1Y0UA 1FYMA 1BM9A 5FFZA 3A6SA 4YPHA 1O3RA 4C9XA 4L5JA 1ZRFA 1STZA 1BIAA 1XSXA 3MDIA 3FWEA 2YX7A 3BY6A 2DT5A 2G9WA 2PN6A 2RN7A 1BJAA 2H94A 1VCDA 4L9VA 1IXSB 4UV8A 3ZPLA 3SHFA 3KP6A 3LAPA 4A6DA 3GVAA 1OW2A 4H0EA 2DK8A 3MCZA 2F5EA 1EH6A 2KIMA 4ZZDA 2M30A 3Q1PA 1W5TA 2BV6A 2FXAA 3X0OA 5D5UB 2BGCA 1V8RA 1OYYA 3RH7A 3WHWA 2DSBA 5ILVA 2IJLA 3U9GA 4IJAA 4IRGA 1ZLJA 1O3TA 1FSEA 3U2RA 1U3EM 3I4PA 4I98B 1TBXA 1QQIA 5FSNA 4K2EA 2XROA 4EGYA 3FHZA 1IUYA 3R60A 4HBLA 5K1YA 1XCVA 2XIGA 3G0QA 1UCRA 3WU0A 3M8EA 2YVPA 1S7AA 2KKOA 3KEQA 3R4KA 2Q2EA 3GZ5A 3O2PE 1R1VA 5L3EA 2QZ8A 4EJOA 4UVAA 5L3CA 1TLHB 3VB2A 5HZXA 4ILQA 3DFGA 5EEGA 2R7FA 3HRUA 4LG0B 4IF4A 4BQAA 4M9ZA 3DPLC 4B09A 3DKUA 3HRMA 1PUQA 1V8MA 1MJ9A 1B9MA 4XSZF 1YS6A 2CSOA 2MD5A 1FWZA 4LK0F 2PQVA 2XKOA 2Z5UA 1W4MA 2B0LA 3SXYA 3N97A 3TDUC 4HF2A 1HKSA 3CLOA 1XGMA 2K86A 1NQZA 1G3SA 3HSRA 4OOIA 4U0WA 5FFXA 1T98A 5TRDA 1TNTA 1XB4A 1XSVA 1V8LA 3ZR1A 3MZYA 1GA7A 1K26A 2XSQA 4MEXF 4LLLA 5FLXZ 3L2CA 3HSEA 4XLPF 2IA1A 4PGHA 1LVAA 4EM2A 5HLGA 4MPOA 2JTVA 3IRRA 1ZG3A 2A8PA 1P92A 2GA1A 4IHTA 3GEZA 1V8WA 1DPUA 2A6HF 1ZGAA 3G73A 3DF8A 3E5UA 2HKXA 3WTUC 1OMIA 5HOOA 4KIGA 2K27A 3GG6A 1J2XA 3H3ZA 2F5FA 3V8JA 3QU3A 5LEKA 5A2QK 2UXXA 2DO7A 1CF7A 2XAHA 3COUA 4ZYDA 1MD0A 2V9VA 1B6AA 3I9XA 3X0JA 3WTSC 4U7DA 1W7PB 2EFPA 5DV5A 2EV5A 3ZMSA 1HW2A 2W4EA 4LJZF 2EB7A 3GYHX 5E1WA 3Q4IA 1W5SA 3WTZA 4G7HF 1I6XA 1X3UA 1OR7A 4I09A 1LEBA 1HKQA 1RRSA 3FMRA 1KQ8A 4KICA 1QPMA 2JPBA 3DV8A 3W6KB 4HX8A 5BMZA 5D6EA 3HYQA 1YLFA 2WWYA 2O3FA 3P6YA 4AWXB 3U53A 2Z99A 1PUNA 2AZWA 3IL2A 4JZTA 2YPRA 3CTAA 3MWMA 3J7AO 1SD6A 4A0YA 2EA4A 2CGPA 1Q54A 4RAYA 2A8SA 1IN7A 2M1BA 1I5ZA 1WSUA 4U7BA 2M5WA 5HS9A 2RC4A 2K7LA 3GFJA 1YFHA 3C1DA 3HUGA 4Y17A 4RB1A 1ZREA 3CNGA 3VOEA 6PAXA 5DD8A 1FT9A 3PQJA 1P2FA 3FXRA 1IAWA 2P7VB 5I8UA 2DHOA 4D0PA 2KJCA 3RDIA 2Q9PA 5CJ9A 3QPTA 3T8TA 1R22A 2EJRA 1SJYA 2ESHA 5LGTA 3F3XA 4S04A 4KTBA 2CYYA 1HQCA 2PFBA 2FBKA 1PUSA 2P6TA 3I0TA 4DQ2A 3E57A 2Z3YA 2I8TA 2NYXA 1P4AA 2XGXA 3L85A 2H09A 1ZHFA 2J8QA 2VNQA 2VN2A 3DPTA 2HQRA 3X0QA 4CO8A 2V1UA 1FYKA 3H3UA 2DU9A 2JRTA 3L09A 4N0BA 2W85A 5CVVA 4BHPA 3Q2TA 1ZN2A 4FX4A 2GB5A 1NQYA 1OYIA 1KTGA 3T5XA 1HBXG 1ZRCA 3A6TA 4IXAA 5LLQA 1YS7A 5ICFA 2KIFA 2B0VA 4RB2C 1MJBA 1SD7A 4P55A 3F8NA 2IP2A 3FF5A 2H27A 1MQEA 4XRFA 2A5YB 4S2XA 3K1MA 1I27A 3GF2A 3ACAA 1K2EA 1GXQA 4NQWA 2QQ9A 2UWMA 3IKVA 1BI3A 5IT3A 3ULQB 3D0SA 4E70A 1MDMA 2VOOA 5H20A 1PVFA 4YIFA 1YYVA 4OU0A 2MA3A 3OOPA 3X0IA 1PPVA 4R79A 4DNCA 3K1PA 1VC8A 2WC2A 4CHUA 4P9UA 4OIQF 4O3MA 2FNPA 2ZKZA 2HQNA 2H6BA 2ELHA 2G73A 4KT5C 5IT9Z 3GWZA 2A8QA 3KETA 3WTTC 3FZVA 1JRKA 2GWRA 2HFHA 1ZG5A 1IW7F 5ILSA 5DEQA 2EK5A 4CZZA 2VBYA 3RKYA 3GW2A 1JHHA 4A6EA 4OIPF 1V4RA 1J75A 1RZ4A 3P9IA 1SMYF 4YPRA 2FE3A 4M71A 1IN4A 3J7Ye 4BXUA 3TO9A 2H6CA 5J6XA 2DQRA 3KEOA 1R5HA 2E1NA 1HX3A 2FVVA 1V8NA 4ZG0A 5DUKA 3ZMDA 4HDVA 3QSJA 4UHTA 4BH9A 2UXNA 4AIKA 4HA8A 4OIOF 1B4AA 4L5IA 5LGNA 3ZMZA 4M9SA 2YX4A 1HSJA 3DXJF 4YG2F 4KN4X 5ERIA 3I58A 2ZXJA 1O3SA 2FRHA 2VXZA 1TNSA 3CDHA 5E1XA 3QRFF 4L9TA 3X0SA 1MZBA 1LQ1A 4FHTA 3LA3A 2FBHA 2FF4A 5D5XB 2ZJ2A 1B9NA 3F6VA 1PUEE 4IJXA 2E7XA 2W84A 4A5NA 2B2KA 4IPAA 4CXFA 2RV8A 4HV6A 5C7TA 4CICA 3HTUA 4M74A 4F7ZA 2HDCA 1IRYA 3I53A 1IXCA 3HOTA 1ON2A 5HVQC 1KHZA 2HKOA 3NRVA 1R7JA 3MFKA 4MTEA 2PNYA 3W6JB 1FBUA 2P7CB 5IW5A 3X0PA 4YFKF 5CVUA 3BPXA 5J8CA 1KYZA 5CVIA 3M8FA 3COAC 5DPKA 4LK1F 3WG9A 2IVMA 1PDNC 3K9TA 2DTRA 1FBQA 1WRJA 5CVJA 4HF1A 2FA5A 2O0YA 2GT4A 4LLNA 1FC3A 3G3ZA 3F13A 5E8IA 2DQLA 2ISYA 5CYVA 2BEOA 3KFWX 3H95A 1QVJA 1XD7A 2PI0A 4EM0B 2L02A 1U5TA 3D5LA 3R6SA 2E7WA 1G3WA 5DCMA 1X51A 4RB0A 2P4WA 2FEZA 5FD6A 4KIFA 1TTYA 3IWFA 1V8TA 3KZZA 3EEUA 1LDJA 2K4JA 2R3SA 2IRFG 2VBWA 2W57A 3E6BA 2NRAC 4CGZA 1S29A 2ESNA 1PP8F 5GHIA 4RAZA 3C18A 4HV5A 1CF7B 3VODA 1W7PD 4P5OA 1YIOA 1SAXA 4RGRA 3DUPA 1BI1A 2P8TA 5ANUA 3JTHA 3I64A 3ZQ7A 5D8LB 4I02A 5DCFA 2VT2A 3JAMK 4M6YA 2XRNA 2KIUA 3O61A 3B73A 3SZTA 2L01A 1L0OC 3O6BB 3M1EA 5LPGA 2A68F 4KYXA 5FSIA 2D2WA 1J5YA 3GZ8A 3MQ0A 3CO7C 2BE5F 1FYLA 1J9IA 2GIVA 4UUVA 3FK9A 2YVMA 2IA2A 3F21A 2OBPA 2EWNA 4GGGA 1H0MA 1IF1A 3Q9SA 4RGSA 2IT0A 2QENA 5K5RA 1OPCA 3BJ6A 1YW9A 4LLGF 1SD5A 3ZMTA 5LRSA 2ACJA 3LA7A 4HDUA 1V8SA 3B02A 4L0ZB 5HDNA 3CUOA 4M9XA 5L3DA 3J80K 2V1XA 4ICKA 5GHQA 5FSKA 1Z7UA 3SZPA 4GYGA 4HVYA 1XMKA 5A2QZ
chains in the Genus database with same CATH superfamily
1BA5A 3IWZA 3DEWA 3LSKA 3NEUA 4G6QA 3OYAA 4RS8A 1YJ9I 4V2GA 3PO3J 5K7ZA 2HOEA 3ONQA 3CJNA 2FQ3A 4OINF 3PNTA 2EV6A 5IW4A 1ETWA 1VFCA 2CH0A 5FKOA 3WHBA 1E2XA 3K4CA 3E3VA 4FASD 1QNTA 2CU7A 4BE2A 1V5GA 4QTRA 1RUOA 3N9UA 2XHKA 3BM4A 2MYSA 1HKTA 4M3DA 1U5TC 1MW7A 4EJTA 4E7SA 1XSAA 3MCFA 1MP2A 1PYVA 3K6GA 4BYYA 2DA7A 1TWGJ 4PSXA 4BY7J 2HXIA 2LC2A 3SONA 4HRIA 1MMDA 4A3GJ 4ENMA 3LSPA 5ANVA 2QBYA 2RVCA 4LD5A 5E1ZB 4HEA2 5GTHC 2JVBA 1Z3XA 2NS8A 2TDXA 2LK2A 1FLIA 3HPHA 3I4NJ 4HW0A 1V8VA 3F72A 3SDBA 4IL6C 3JRBA 3CP2A 4NHJA 1ZGJA 2ZXWH 4A3LJ 2FU4A 4RB3C 1H9TA 2PJPA 1RYAA 1V55H 2XAUA 3WHCA 3WGIA 2LKPA 3S1QJ 3O52A 2JK3A 3BTIA 1J09A 4WXDA 5EG0A 2IA0A 2ZNZA 4DGWB 1NFZA 4MQ9F 1PJRA 4E7KA 2KZVA 2ID6A 3M9AA 5F64A 5ICCA 3LSHA 2LDUA 5HDKA 1G9QA 2XAFA 2J5OA 5F0FA 1AHDP 3L2RA 2M7BA 4EJWA 3VFZA 4G7ZF 2GAUA 4F55A 3PQKA 2LR8A 3V42A 3RCOA 1FMWA 3JREA 1MBFA 1MBEA 3VSKA 3CDLA 4BHCA 3PNVA 2CL3A 1VNDA 3J7YJ 1B1BA 4I99C 3JRHA 1WVRA 4XLEA 1FP2A 2RDPA 4JZSA 4B8XA 5FLVA 4NFWA 4N4NB 4OIRF 5JVTA 2Y48A 2A07F 3IRQA 3KLNA 2QYOA 5D5WB 2JA7J 3CMYA 2EA2A 4NQWB 4YFXF 1ULYA 2VKVA 2JSCA 3AG2H 2P5LC 3H3VK 3ZN0A 2ZO4A 3CQZJ 1S7OA 4OMYA 5FRMA 1ETYA 5C3EJ 2Z1DA 4HQMA 2EZKA 1IN6A 5BNGA 1VRLA 2HEOA 5GPAA 3RYPA 4AYBA 2DTZA 2RAEA 2A61A 4LIUA 1MDMB 4S2YA 2WBMA 4K6EA 1ZARA 1T33A 1IRGA 1WHUA 4YOQA 1YW8A 2GXGA 3X0RA 2N8GA 5L3FA 2MLGA 4MHGA 2Y0MA 5FKLA 3F0CA 2DJNA 3VYUB 5EJCA 5ICGA 1HZTA 2BBYA 5ISYA 5ILUA 4BY1J 4ZYGA 2O1CA 5EGOA 3ESWB 2EZIA 3P5JA 5FKKA 1RESA 3RPQA 3JR9A 2L7KA 4CDGA 3S1MJ 2FJ1A 4XICA 1S5LC 2F5CA 2PMZA 3WE2A 2DUKA 3AL0C 2JZYA 2CMPA 4KYWA 1EH7A 2VC1A 3JTGA 3O8GA 4KG3A 2X4HA 1V8UA 3CMAI 1BN5A 2QGUA 3ABMH 4XLNF 1WJCA 1TQIA 5DD4A 4X0GA 1IG7A 2STWA 2DYSH 1N78A 2M87A 3G2BA 2OCEA 4E7JA 3DEEA 4PGGA 2X1DA 3S32A 4S2WA 3I7VA 3CC2I 3LMMA 5C7QA 2KDVA 1XGOA 1K6YA 3HHHA 2R92J 2IW5A 3CJRB 5F1RA 3A0BC 2CUJA 3ZCOA 4BAYA 4D5CA 4RM2A 3KCCA 2OUMA 2QSFX 2X85A 3IAS2 3W2WA 1ZR2A 1X1CA 1I50J 2XV4S 4B44A 5LBQA 3KZYA 5ED4A 4Q4ZF 4MNUA 3W2AA 3DWLE 3GWYA 4PSWA 5BS6A 1JKOC 3QP6A 5E3MA 2KRFA 4NNJA 4ZZLA 3WTYC 5K5OA 1E0EA 2DA6A 3DQVC 2OZ6A 1TUMA 4AIHA 2ZB9A 1KU3A 4DYWA 2PBIA 2XB5A 2XASA 2R93J 5KCMA 4E6KG 1G6NA 5J8FA 4PK4A 2DMQA 2G74A 2VL8A 2Y9ZA 3VPRA 2PEXA 3ECOA 1JE8A 2CW7A 4A3BJ 3VEPA 4Y13A 3P9CA 4R1HA 1NG6A 3CZ6A 1Y1VJ 1T95A 2XF6A 3C7JA 4I2OA 1LVKA 3KLOA 4M72A 2CG4A 5GHNA 5F1JA 5GHOA 3FXMA 3ROUA 4KG4A 2LP0A 2OQGA 4B3AA 5GAEJ 2Y0SN 1LFBA 3V8KA 3K69A 5D4SA 3MKWB 2EV0A 5LEJA 1A5JA 4XMYA 3GRNA 1NHAA 1X4PA 2OD5A 5D8KB 2LSOA 1PPWA 3N77A 2DK5A 3GZNB 3QU6A 4JQFA 3TKYA 4O5VA 4AVZA 2R7UA 1Q33A 2O5FA 1SOIA 4PZJA 1BI0A 1I9AA 1FIAA 3T1BA 2L4MA 1MGTA 2VBZA 2HYGD 3LSTA 4A12A 1WI9A 4UUTA 3JRCA 1T8IA 1DP7P 5FSMA 1XDUA 2EFQA 2LOOA 1FX7A 3MGMA 2HYFA 5J1UA 2X0LA 5BPIA 3BDDA 4H4KC 5FSOA 1CGPA 4A3JJ 2PJRB 2ZBKA 5AIPA 4WF2A 4G6DA 1C0WA 1O7FA 2PLYA 3BROA 5DUIA 1EA3A 2QLZA 2ZC2A 1F5TA 3KE2A 4NUBA 3LQQA 2AS5F 4GCVA 4Y4RA 4JK1X 3FXQA 1K78A 5DYMA 1SZ3A 1IZ1A 3OIQA 4EM1A 1JJ6C 1FOKA 1U78A 3P5TA 5J4VA 1R6RA 4HX7A 5LHGA 5LGUA 2ZJRF 4B3XA 1YJNI 4CA0A 1HF0A 3A6VA 2W24A 1KYWA 4OMZA 1XSBA 5FO5A 1XCBA 5JHUA 2HTJA 2XVCA 4DYCA 3RZDJ 4EEFG 2HGCA 2OQRA 2VODA 3JSOA 3A01A 2A8TA 3GLXA 1I3QJ 3IH2A 3S93A 2HZTA 2KIQA 2W25A 1KQ9A 3LQRA 4HOBA 4XONA 3L1PA 4V14A 1ZAOA 4I0BA 4J01A 3QAHA 2HOAA 2M45A 2X48A 2NVXJ 4Q5SF 2NAZA 4EGZA 2G7HA 3GTKJ 1DGWY 1RC9A 1UHMA 1UAAA 1MMSA 2FUG2 1M1EB 5FROA 1HOMA 1USTA 2BW3B 5GADJ 1XDSA 2A6EF 2YVOA 1NK2P 1SVOA 4C3JJ 2NVUB 5BOXA 1TC3C 2O03A 3J81K 3RYRA 3EETA 4HSTA 3PIPF 4GO1A 3EUHA 3RKQA 1MSFC 3ZRGA 2DA3A 1Z0XA 3K4BA 3HJEA 4HQEA 5HS8A 3D5RC 3LL7A 5HNHA 3DEUA 3TO7A 4BL0B 4C3IJ 1YIJI 1IDZA 3OGAA 3TW7A 4KNYA 1V5FA 2A3SA 1YO5C 2HI3A 3PSFA 3TO6A 4FX0A 4MTDA 1VQ6I 2RNJA 4AU7A 5KK1A 1VQNI 2CS3A 3HSFA 3DP7A 1KT9A 1JUSA 1X83A 1X1AA 1ZRDA 3E6MA 3K10A 4ZYEA 1Z77A 2R5YA 2DOFA 4ESFA 3TQNA 3DTIA 2VXDA 2HDDA 4ZTFA 3I7UA 2L3DA 1F4KA 3X0KA 4XBFA 2KT0A 4B47A 2BVLA 1D0ZA 3BP8A 2ZXIA 3QYEA 3GZ6A 4FTHA 1ODDA 1QU3A 3DU6A 3X2QH 2D45A 1TW2A 3C3WA 2FX0A 5ANTA 1X19A 1N75A 4B43A 1U5TB 1LUJB 1F9NA 1ETOA 1H89C 2WB1N 2CO5A 4JP0A 2AHQA 4N9HA 3KVHA 4A3IJ 2D1HA 1S8NA 2L54A 3LFKA 1ZYRF 5M3MJ 5D4RA 5DCMB 3L7WA 1R4NB 1YTYA 2FQ4A 1MNDA 2FBIA 3AAFA 1RR8C 4A3KJ 3HHGA 1W5CC 1W1WE 1Z3YA 2XF7A 1MMNA 3ECHA 2A69F 1HW1A 5GAHJ 3G6EI 1ZLKA 2I6KA 2ZFUA 3Q0WA 2OAZA 2E71A 5J47A 1PUFA 1DQUA 2IGMA 4GXOA 1VC9A 1B59A 1ETXA 2ETHA 3ISPA 3TOAA 4BBSJ 1QHGA 2EH3A 1IRFA 2KJBA 3ZQCA 3EYIA 3Q3SA 5B3SH 3ZP5A 2Y9YA 5FB2A 1QVTA 1QA6A 4CZCA 3FBNB 1ORKA 1TW3A 1Y8QB 2JWTA 1H9GA 5E17F 5F27A 2Z9OA 4KDPA 1FOWA 4KJZA 3H92A 5GP9A 3FX3A 3IKTA 1MKMA 2CZRA 3FSPA 4YIIA 1UHSA 5F0HA 3LSGA 2KQRA 3GO5A 2DA1A 2V1DA 4LFUA 2AQFA 4ZDPA 2HR3A 2K4BA 4BNCA 1GHCA 2VT3A 3CUQA 1VQ5I 1SU2A 2L7MP 2QSGX 1EH8A 2CWEA 3ASNH 3S2WA 3SFZA 1Z91A 1B8IA 1D8JA 2L5QA 5GHJA 3HRSA 3CCUI 1DPRA 2MW8A 4N1TA 3QYBA 1XG1A 1LFUP 3EYYA 4N9IA 1ETVA 3EQLF 2VIXA 3TW6A 1P7JA 4J19A 3SJMA 1N77A 3R0AA 4CCMA 1JXSA 1FTTA 3O3KA 1OCZH 3KP2A 2VPRA 2WB1A 3QPHA 1QHHD 2GQQA 3SQNA 3IH4A 4I7HA 2R7XA 3BR1A 1GDTA 5GHPA 3S2HJ 2EQRA 3FDYA 1UB9A 3OOUA 2HPIA 2CQKA 2MLKA 3M7GA 3JRAA 3FCMA 3CCMI 1XPXA 2LYCA 3BR2A 4UB8C 1U2WA 2RKHA 2GA2A 3MAJA 3CCJI 3GTMJ 2X51A 2XAQA 3A1YA 4ESBA 2XAGA 2NNYA 2E1OA 2I8UA 3BZCA 2B06A 2KP6A 3KP7A 3Q5FA 3TP3A 1EV7A 1Z6RA 3ASOH 3KYCB 1PPXA 2QQ8A 3AL0B 2BOLA 1KU7A 1T39A 2PQ8A 1Z1DA 1R00A 2LF8A 1PVEA 3FM3A 1VIUA 3R61A 2EFWA 2H1LA 3TP0A 1TP4A 5C4XJ 3QP5A 4FT8A 5CVRA 2LD5A 2F4IA 1NFSA 2IS6A 1QVUA 3HB9A 2WADA 4UVBA 3F22A 1D3YA 4A0XA 1MK1A 2R7DA 2MGQA 3FMQA 1HA8A 2R7VA 2QM3A 4EVIA 3S17J 2EFOA 3EF5A 3PNYA 1BR1A 1ZKGA 3LAJA 1S3JA 2W48A 1QRYA 4KUMA 1GLNA 3RTRA 3I71A 3I59A 2R7WA 3LSJA 1Y39A 2K40A 2VONA 3O69A 3ABUA 3ABLH 4G8XA 3WU1B 3F9KA 3H36A 4S2VA 1P4XA 1HCRA 3QYFA 2VJJA 3K7AJ 4GYIA 3GFIA 2QJTA 3CCYA 3M1CA 3JAMZ 4EJUA 1CQTA 3E5QA 3BTLA 3TGNA 1QGPA 4XRSA 1ZGWA 1JKRC 2R7SA 4AIDA 1HXDA 1SC7A 1USSA 5H6RA 5KAIC 1DP3A 3DBRB 1U8RA 1BI2A 5KVRA 1KQ0A 4XLFA 1W0UA 1KU9A 5AONA 4WX9A 1W36C 3S3NA 2QBYB 4M3EA 4WK8F 3IAM2 2GLOA 2XGEA 2VBXA 2QVOA 1D8KA 2HWVA 2CW0F 3RPUA 3X0MA 4HYEA 4XK4A 5JLWA 3X0LA 1ONVA 2P5KA 5GHMA 3ZQGA 1P6RA 2CUZA 2XPWA 3ERED 3BG7A 2PMUA 2DLLA 4HX4A 3C2GA 3HHJA 1LJ9A 4A3EJ 1SD4A 2XUBA 4I01A 5EG0B 3LSRA 3GTOJ 1V8YA 2QJOA 2XSJC 4LB6B 2K9LA 3W3CA 1R1UA 2DCEA 2OC6A 3BG9A 3UR3C 3BJAA 4EQQA 2CV2A 1FOYA 4ENJA 1J0RA 2MD0A 5ICEA 2XKPA 4MLOA 3CUQC 4YEJA 1HSTA 1FOXA 2KDZA 2HS5A 3CCQI 3DTKA 3OY9A 3TL4X 1XSDA 2YU9J 1IC8A 3O8HA 2DI3A 2XPVA 3S8PA 3L9FA 4C30A 1BBYA 3J80Z 1UFMA 4IVNA 5L3GA 2ISZA 3H5AA 2VLAA 3R0JA 5HS7A 2IPQX 1NG7A 4L9JA 2DPUA 2ZMEA 5K5QA 2FOKA 3GLLA 4QWQA 4ASNA 4L9NA 1FY7A 2K3PA 1JTYA 5LHHA 1TQPA 1HW5A 3TDZC 4YELA 2FMYA 3EUAA 1JGSA 1E3PA 2R5ZA 1LEAA 3EUKL 3BWGA 4R8HA 4HLYA 1LDKB 4AD9A 2VKEA 1BL0A 2D5VA 2CV0A 3BOQA 2F4OB 3O6ZA 4BKXA 2G7UA 2RREA 2M7AA 4FE7A 5EGOB 2WV0A 3DKXA 1ZK8A 4IHSA 1Z67A 4HF0A 2W4SA 4WXCA 1KGSA 4A3CJ 3BJOA 2MBFA 4A2UA 4IX7A 1RUNA 3QQAA 3RIRA 4G7OF 3EXQA 1VQKI 1LPQA 4A0ZA 1VI0A 2K02A 3HOWJ 3KP3A 5H6QA 1ZH5A 3SYTA 3CO6C 2Z2SB 3HG9A 1XMAA 2DFHA 3ZXSA 2XAJA 1I39A 1R58A 2V9PA 5EYRA 2LY2A 2PMHA 1D0YA 2JA5J 1O7LA 3MEXA 4KISA 3V7CA 3OV8A 4ITVA 3VYTB 1IRXA 4LGWA 4UXNA 2A5WA 1QZYA 3CJTB 4LOCA 2QUFA 4KMFA 3VYRB 4XIDA 1U9NA 4IZZA 4E7IA 2HZDA 2QF7A 2WY8Q 5CPRB 4FCYA 2EILH 1FZPB 3HL2A 3T8RA 2HVSA 1JHFA 2OJED 4MEYF 5LD2C 1FBSA 4BU2A 1JKNA 2ADUA 1A04A 1R23A 3NWTA 3BT9A 2V79A 4HAMA 2R7ZJ 1G0SA 3U1KA 1LB2A 3K70C 4XKWA 4KIBA 1MJAA 4BACA 3PO2J 4I0AA 4UVCA 3PJRA 1X3ZB 3EDPA 1ZG1A 5L3BA 2NNNA 1TWFJ 3KZIC 1WH5A 4BJ6C 2E5NA 3G71I 2B63J 5E20A 2LBFA 5DTDA 2QQBA 4BQQA 5D5VB 2Q8KA 1Y1WJ 1VQ9I 1V8IA 2FSWA 3F23A 3BTCA 1EKEA 3K0LA 4EMSA 2OV7A 5JR3A 3WTXC 1WKMA 3ID9A 1W36D 5FLXK 4IKFA 1KA8A 4JX4A 4ENNA 2YYHA 2DT7B 1MBKA 1KU2A 4UUSA 3OR2C 1QBJA 3F6AA 1R9TJ 5FLMJ 3X0NA 1HC8A 3K1NA 1S6LA 3OYFA 2WAFA 3OL4A 1IDYA 2HDWA 4BJTA 3ZQLA 4RDUA 2JA6J 3IC7A 1LDDA 4XSXF 2Y30A 3W2VA 2JN6A 4DBQA 3WGGA 4ZC3A 5CLSA 1VIQA 3I4MJ 3ZQHA 2BY2A 2D1VA 3KP4A 3L00A 4DIQA 1XN7A 5F0CA 4E7ZA 3HZJA 5TJJA 2FMLA 1RRJA 4L0YB 4NFXA 2EBIA 2HQ5A 1IN8A 3V7SA 1FNNA 2VJ5A 3MDGA 1G2HA 3HRTA 3MZ8A 3ZOBA 2DFIA 3MN2A 2F6CA 1RRQA 2BHYA 4C9WA 1Q1VA 5LRRA 1VK6A 3F8CA 3Q93A 2OCCH 4ZH4F 1B72A 2HXOA 3FXUA 1Y8RB 3H9QA 4U0VA 1K78B 2HTSA 2RRKA 3M07A 1IUFA 2I5UA 3BQZA 5D6FA 3WGHA 4XRSG 1ETQA 4LG0A 2E34A 2PG4A 2YUSA 4PJNA 5FGMA 3EESA 2ICJA 2XF5A 2OU2A 2ZMEC 5HLIA 1YRNA 4A5MA 2VNPA 1Z05A 2L4AA 1VF9A 5HLHA 4U0YA 3C2HA 1VTNC 5FSLA 2M8EA 1K6OA 1O3QA 2ZFWA 3A01B 3I55I 4XL9A 4M6XA 2E2IJ 1WZ2A 2ME6A 3GX4X 2Z33A 3ERMA 1K7AA 3WG7H 2RGVA 4C3HJ 4XRMA 4F93B 2M0CA 3A2KA 2FNAA 1U20A 1Z6TA 1F1ZA 1VQMI 1F3YA 2X9DA 4ABZA 1OKRA 2EINH 1HDDC 3NWSA 3SHDA 1RNLA 2E5ZA 4WXHA 4HZFA 1AOYA 3IHUA 3REOA 2YSRA 1MBHA 2DBBA 3LWFA 1U0JA 1YW7A 4CYDA 5FKMA 2KDOA 1T6SA 1TL8A 3T0YA 1MR2A 4Y3OA 1WI3A 5ANWA 3GFMA 2WAQN 2VC0A 3KP5A 1OCTC 3ZN1A 4FETA 2QQAA 1IV6A 2CV1A 1V3FA 4ENKA 1MIJA 1Y0NA 4OAZA 4BE1A 2YR2A 3K4MA 2L9NA 4IOCF 1REPC 3I9V2 1BC7C 4JZVA 1YE9A 3G1LA 4PFOA 1J59A 1RKWA 1QO0D 1T08B 5CFIA 3QPSA 1QZEA 3GTGJ 3A02A 3JCUC 2IBDA 3S3OA 5F6FA 2VUMJ 1MMGA 2E1CA 2ZNYA 3BR0A 3VSLA 1BW5A 3E6CC 5KHDA 2CFXA 2E60A 2ICKA 2JT1A 3KYDB 3WE3A 3OR1C 2X6OA 5J1RA 1Z7LA 4JBAA 5KNLA 2BZTA 1A31A 4P1WA 2RQQA 2QWWA 2STTA 5E79C 1VQ4I 2K9NA 2DDBA 2O8XA 3PFIA 4F52A 1H8AC 2IS4A 2VOPA 1I1SA 3K70D 2NS0A 1SVMA 1FPQA 1ZELA 4IHVA 3FJYA 2GXBA 1ITYA 1DU0A 3E97A 3OL3A 1WPKA 2OZUA 4S0HB 2O61A 3DBLB 2MG4A 1A6QA 2JRMA 2Y75A 3BG6A 3E0JB 5EF6A 3U1DA 2DSDA 3GUDA 2V6CA 3RKWA 4II2A 5BQTA 1PUFB 2P5VA 2LNBA 4B1RA 3FKJA 5IP9J 1W7PA 2TRTA 4E7LA 3RPUD 1IXRC 4DYQA 4P9FA 2LKSA 1PP7U 1IGNA 1XGSA 5EDNA 4W97A 2LH9A 2GT2A 2QKMB 2WAQA 4NB5A 3E5XA 3HOSA 2LKXA 1XS9A 2P6SA 4MQVA 2JSPA 3S16J 1Q27A 2WAEA 5FD5A 2VE9A 4D1QA 4O6JA 1MMAA 3K4KA 4HSRA 3FM5A 2C6YA 1R5GA 3K2ZA 4IRIA 3SEQA 3DLAA 3QODA 3J81Z 3CCRI 2GZWA 2MH2A 2V1NA 4B48A 4BGDA 3F8FA 1D5VA 4IQ4A 3CUQB 1TQMA 1TZLA 4GYGA 4KN7X 1U6GA 1XMKA 2MC4A 1B8IB 4JX6A 4J7GA 1SFXA 5H2FC 3Q2SA 2COBA 1GVJA 2YVNA 1WQ2A 3OYHA 4JZUA 3F8BA 3I3LA 3RKXA 3BZKA 2F5DA 1FSHA 3HIFA 4HLXA 4A3DJ 3HYIA 3A4CA 2Y0SA 1HDPA 4PCQA 4Y15A 2ID3A 3BHOA 4IHWA 1G3TA 3V4GA 5ANSA 4LB5A 2KISA 3N4MA 3BLYA 2TCTA 4EV0A 3I54A 4N1UA 5CFJA 1G8XA 2Y69H 3NAUA 2A6TA 2Q0OA 4C9YA 2QA4I 2DAOA 4PFPA 1L3LA 3H0DA 1DUXC 4NC6A 5JLXA 2HOSA 1T2KA 1RI7A 3M4OJ 3UNGC 3HTSB 3PUFA 4L18B 1XSCA 4ETSA 3F6OA 3LA2A 2LREA 4IHYA 4M73A 3DKWA 4KA4A 4DZJA 1UG0A 1BOAA 1GV2A 2YU3A 1YQAA 2NVTJ 3FHNA 2K5CA 2LF7A 3BTJA 2KLOA 2VKDA 3MMYB 3CCVI 1QZZA 4IRHA 5BPDA 9ANTA 3TOBA 3P7NA 4OAYA 4RGXA 2F2EA 4XN3A 3ZMVA 3F8MA 3QOPA 4U87A 4BHBA 4A3FJ 1G3YA 1MBJA 3RI4A 1OYWA 1R1TA 4AIJA 5CQEA 2GOXB 1WH7A 2CQXA 1ON1A 3CCSI 3ABTA 4QLCU 4WCGA 3V8LA 4Z2YA 3KEYA 4GFBA 3R03A 2W00A 5DM7F 4WWCA 1V54H 1SMTA 4GDFA 4Q48A 5LHIA 3I5UA 5C8LA 2H1KA 2NXNB 3FISA 2DSCA 1SAUA 3O8SA 3NQOA 1DDNA 1WWXA 5E18F 3B6AA 1GXPA 4BEHA 1MQWA 3I59B 4S05A 2KDWA 4RBOA 3SEZA 1BC8C 1I1GA 3K4NA 5HNFA 1FTZA 2O5WA 1IN5A 3AG1H 3FMSA 1T38A 2HU9A 2CUEA 1AWCA 5IT9K 3H5RA 1T0FA 4DYRA 4KFCA 3FXLA 1D1AA 4KMUX 1N25A 2WTEA 2ZSHB 5DDGA 1R71A 1XC5A 2DFFA 1BIBA 5HODA 1X84A 3H9GA 4MGRA 4HG2A 1SFEA 2COMA 4MIMA 4P96A 1Z9CA 3BAPA 4A69C 1FEXA 3AC9A 3RJPA 4Y33A 5AIQA 2RQPA 3SDGA 3P9KA 1J7KA 1P7IA 4F91B 4JOMA 1I6HJ 4G94A 5GTIC 4HFQA 1LNWA 5JFRA 3BCBA 2LY9A 4G9YA 4PJMA 3V7RA 2L9SA 5EEHA 2O6GE 4Q47A 4XKCA 1O57A 1HLVA 1I3AA 4ZYHA 1VHZA 4BQNA 5E3NA 4UV9A 3HBLA 2OTLI 4YFNF 3W6VA 2QKLB 2BYVE 1DU6A 1RIOH 3S2DJ 3JSPA 1K79A 2A8RA 1Q1HA 1WJBA 2KL4A 1VZ0A 2MC3A 4EJVA 4UNOA 4C2TA 4NC8A 3N05A 2X1EA 1XTAA 5F04A 2DMNA 2QEXI 3A6UA 3ZMUA 2MH9A 3OS2A 2XB0X 3BZ6A 1UHWA 1KZHA 1O4XA 3HKZN 2UZKA 2L0KA 4EATA 1R67A 1SEUA 2ZCWA 2IS2A 2J5PA 3E6DA 1X2NA 1JUMA 4D7MA 1G4DA 3I56I 1MUTA 3ZQIA 4LMYA 2L9RA 3ML6A 3Q9VA 2NS7A 4ON0A 5HLTA 3ZR0A 3WODF 2FKBA 1T56A 5E8GA 3WTWC 2DPDA 3LSMA 4U88A 4UB6C 1X1DA 2ZMEB 5M5YJ 2EFNA 5JI6A 3JW4A 1E17A 1R36A 3K4LA 4PDKA 1YG2A 4ESJA 4TV7A 2KRHA 4XORA 2JPCA 2X1CA 1OCOH 3GFLA 3OIOA 2DW4A 4RGUA 3MZHA 3TEDA 1SFUA 2OA4A 3JRGA 1E3HA 3FFUA 1POGA 2VE8A 1P4WA 2KPMA 3EUHC 3WTVC 2XRLA 3BPVA 4AVPA 2AXLA 1XGNA 1FP1D 4KT6A 4RAFA 2E35A 5BONA 1NH3A 3Q91A 3DBHB 5HDGA 3GXOA 1VHGA 2V6EA 5IYBJ 2R5WA 1Y0UA 1FYMA 1BM9A 5FFZA 3A6SA 4XLCA 2ME0A 4YPHA 2O7OA 4FISA 1O3RA 4C9XA 4L5JA 1ZRFA 1STZA 1BIAA 1XSXA 2E36A 3FWEA 3MDIA 2YX7A 3BY6A 2DT5A 1YI2I 1R5ID 4I6ZA 3CMEI 2G9WA 2PN6A 2WY7Q 4NC7A 2RN7A 1BJAA 4L5EA 2XDVA 2H94A 1VCDA 3D1NI 3A0HC 1E3OC 4L9VA 1F43A 3HKZA 4D9JA 1IXSB 4UV8A 3ZPLA 4ZTJA 3BG3A 2BY1A 3G4SI 3SHFA 3KP6A 3OYBA 3H9JA 3LAPA 1ZR4A 3HOVJ 4A6DA 3OYGA 3GVAA 1OW2A 1Z21A 1FJLA 1JT6A 1SVLA 4H0EA 2DK8A 4DJAA 3GBGA 1T0FC 3LNQA 3MCZA 1RR7A 1WFXA 2F5EA 1EH6A 2KIMA 1GVDA 2M30A 4ZZDA 3Q1PA 1W5TA 4BBRJ 2BV6A 2FXAA 4DZPA 3FXKA 3X0OA 3OIPA 2OPTA 1MH3A 3G1OA 5D5UB 1UG2A 2Q1ZB 2BGCA 3PL8A 1JJ8C 1V8RA 1OYYA 3CD6I 2ELJA 3RH7A 3ABKH 2DDAA 2DSBA 2GXAA 3WHWA 3B6CA 5ILVA 2CW8A 2IJLA 3HXLA 3OYIA 2KMUA 2F4MB 4RAGA 2LBFB 3U9GA 4IJAA 3H5NA 1ZLJA 4IRGA 1UELB 3RQ4A 1O3TA 4X6AJ 1FSEA 3U2RA 1U3EM 3I4PA 1X2MA 5CQGA 4UUSB 4I98B 1TBXA 1UJ8A 5B5EC 1YHQI 2I10A 2VKHA 1WJAA 5C44J 1QQIA 3H0GJ 2HPMA 2B7EA 4LIVA 5FSNA 2K9MA 3H1CA 1FMVA 3LSIA 4K2EA 3SZGA 2OTJI 2JJ7A 2XROA 4EGYA 3HOUJ 2GIZA 3FHZA 2DFEA 1IUYA 2F48A 2Y2ZA 3R60A 4HBLA 2FOWA 4M3GA 5K1YA 3OS0A 1XCVA 2XIGA 3G0QA 1UCRA 3WU0A 3M8EA 2CFOA 1MBGA 2YVPA 2I8DA 1S7AA 2KKOA 2WV1A 3CLQA 3KEQA 3R4KA 2IGKA 3OYDA 2Q2EA 3GZ5A 3O2PE 1R1VA 5L3EA 1JKPC 3L2VA 5F08A 2QZ8A 4EJOA 4UVAA 1OJLA 2P81A 4CSWA 5L3CA 3E7LA 1TLHB 3VB2A 1GT0C 5HZXA 2E19A 4ILQA 3DFGA 5EEGA 2R7FA 3HRUA 3OYEA 4LG0B 4NBQA 2VJ4A 4BXFA 4IF4A 3HGYA 3NARA 3OYLA 1YRNB 4M6VA 4M9ZA 3DPLC 4AC0A 4B09A 3HRMA 4BQAA 1PUQA 3DKUA 3CP8A 1V8MA 3HGGA 1YJWI 3RQIA 3BG5A 4CCNA 1MJ9A 1UMQA 5E3OA 1B9MA 4XSZF 4LITA 1YS6A 5M5XJ 2CSOA 2MD5A 1OISA 3D5SC 1FWZA 4IO9F 4LK0F 2PQVA 2A05A 2XKOA 3DKYA 3MKLA 2Z5UA 2Z16A 2FD5A 4HVYA 1W4MA 2B0LA 4Y7NJ 3SXYA 5EZHA 3TDUC 3N97A 1HKSA 4HF2A 3QOEA 3CLOA 1XGMA 2K86A 3AG3H 4C2UA 1NQZA 4CUGA 1G3SA 3HSRA 3VDXA 2GBYA 1JGGA 3FK6A 2O8KA 4OOIA 4U0WA 5FFXA 1T98A 5TRDA 1TNTA 1XB4A 2CQNA 1XSVA 3GTQJ 4XKBA 1V8LA 3ZR1A 4PJ0C 5IYDJ 4G12A 3MZYA 1AKHA 1GA7A 1K26A 2XSQA 4MEXF 3E1SA 4LLLA 5FLXZ 3L2CA 2R7TA 3HSEA 4XLPF 2GOMA 2IA1A 2XPUA 4PGHA 1LVAA 5J3LA 1W0TA 3TMOA 3M3YJ 3Q0VA 4RLQA 1MNEA 4EM2A 5HLGA 2JUCA 3LFUA 4MPOA 2JTVA 3IRRA 1ZG3A 2X6YA 2OF7A 2E2JJ 2A8PA 1P92A 2DYRH 2GA1A 4BDYA 2EIKH 2DMTA 4IHTA 2M8GX 3OYMA 2E1MC 2R4GA 4D7NA 3GEZA 2M4KA 1V8WA 4BXXJ 1DPUA 2A6HF 2H8RA 1ZGAA 3G73A 3S3MA 2KFDA 4BE0A 3DF8A 3E5UA 2VASA 2HKXA 4IOAF 2M0MA 3WTUC 2CJJA 1OMIA 5HOOA 4AYBN 4KIGA 1OCPA 2K27A 3GG6A 1J2XA 1X4OA 2F5FA 2NOGA 3H3ZA 3QU3A 3V8JA 3M8JA 5LEKA 5A2QK 2DMUA 2UXXA 4CCKA 2DO7A 1CF7A 2XAHA 3COUA 1WJEA 3G1MA 4ZYDA 1MD0A 2LMDA 2VB6A 2V9VA 2YS9A 5KAFC 1B6AA 3I9XA 3GTLJ 3X0JA 1LE8A 5JHFA 2PMZN 3WTSC 4U7DA 1D1BA 1W7PB 2EFPA 5DV5A 1IRZA 2EV5A 5IOYA 5E3LA 2BY3A 5CKTA 1OCRH 3K4JA 3ZMSA 1VQPI 1HW2A 2W4EA 4CYCA 4LJZF 2EB7A 4RLFA 3GYHX 2KRCA 5E1WA 3SFIA 1K61A 1TWAJ 2O5RA 4YIRX 3Q4IA 1W5SA 3WTZA 4G7HF 1I6XA 2JQ7A 3ZGKA 1X3UA 1OR7A 4I09A 4IQJA 1D1CA 1LEBA 1HKQA 4PUSA 2ZJPF 1RRSA 3FMRA 1KQ8A 4KICA 1GUUA 3WU2C 1IV8A 1WJ5A 1QPMA 2JPBA 3DV8A 1D0XA 2IGNA 3W6KB 2K85A 1YX5A 2IGOA 3IH3A 4HX8A 5BMZA 5D6EA 3HYQA 1YLFA 2WWYA 2O3FA 2L9VA 2B9SA 3P6YA 4AWXB 3U53A 2XGDA 2ELKA 2V26A 2Z99A 1GV5A 1SANA 1VQ7I 2IAIA 2LVSA 1PUNA 2AZWA 2VQHA 3IL2A 4JZTA 2YPRA 2W82A 3CTAA 4FE4A 3MWMA 3J7AO 3IV5A 3UKGA 1SD6A 2UV1A 4A0YA 2EA4A 2CGPA 3GTJJ 1Q54A 2JA8J 2Y31A 4RAYA 2A8SA 4I76A 1IN7A 2M1BA 1I5ZA 1WSUA 4U7BA 2M5WA 5HS9A 2RC4A 1NK3P 2K7LA 3GFJA 1YFHA 1BJZA 3C1DA 3HUGA 4Y17A 2JMWA 4RB1A 3SMDA 1ZREA 4DOZA 4MO7A 3RZOJ 3CNGA 4XR6A 2BVMA 3HEFA 3VOEA 6PAXA 5DD8A 3HOXJ 1FT9A 3BR6A 2GM4A 4D5FA 3PQJA 1KONA 1P2FA 2JA2A 2EZLA 3FXRA 1JKQC 1IAWA 3OYJA 1V5EA 3CJQB 2P7VB 5I8UA 2DHOA 2ICWG 4XOPA 2HVRA 3MKYB 4D0PA 3ZR8X 4Z6YA 2L7FP 2M4GA 2KJCA 4CCJA 3RDIA 2Q9PA 3IP4B 5CJ9A 3QPTA 4J7HA 4BDZA 3T8TA 3S1RJ 1R22A 2EJRA 2QCOA 1SJYA 2ESHA 2ZSIB 5LGTA 3F3XA 4S04A 3FIWA 4KTBA 2CYYA 3CCEI 4AM3A 4BQOA 1HQCA 2R5YB 2PFBA 4IEJA 2FBKA 3GCMA 3U21A 3OS1A 1PUSA 2P6TA 2ECCA 2WA0A 3I0TA 2BY0A 4DQ2A 3E57A 2Z3YA 1A36A 2I8TA 2NYXA 1VQ8I 3L2WA 1P4AA 1WGXA 2XGXA 3L85A 2H09A 1ZHFA 2J8QA 2ZJQF 2VNQA 2MFZA 2VN2A 3DPTA 3KYLA 2HVQA 2HQRA 4BEHB 3X0QA 2ECBA 4CO8A 2V1UA 1FYKA 2VQGA 2BHZA 3H3UA 2DU9A 2JRTA 2V7FA 3L09A 4N0BA 4MFDA 2ZXHA 2DXIA 4G6TB 5B66C 2W85A 2IS1A 3OYKA 4QPQA 2L7ZA 5CVVA 4BHPA 3Q2TA 1VQOI 1BOBA 1ZN2A 4FX4A 2GB5A 1NQYA 4DBRA 1OYIA 1KTGA 3T5XA 2EPFA 1HBXG 4BUPA 1YITI 2EIJH 2HQAA 2LRDA 3BQYA 4M3FA 2M9HA 1SFOJ 1ETKA 4HNVA 1ZRCA 2H8WA 3A6TA 4F92B 4C2MJ 4IXAA 5FJ8J 5LLQA 1YS7A 2XC7A 1MH4A 1MNMC 3FXOA 3IUOA 5ICFA 2RNGA 2KIFA 2B0VA 4RB2C 1MJBA 1SD7A 3FK7A 3GMEA 4FQGA 4P55A 3HOYJ 1H88C 3F8NA 2IP2A 3FF5A 3FXJA 2H27A 1MQEA 4XRFA 3VYSB 2A5YB 4S2XA 1X3WB 3A03A 3K1MA 3CC7I 1I27A 3GF2A 5J4YA 3FBIB 3ACAA 2R7OA 1K2EA 1X58A 1GXQA 1OR7C 1WCMJ 4NQWA 2QQ9A 3K2AA 2UWMA 3H35A 5M3FJ 3IKVA 1BI3A 4B4CA 5IT3A 2M34A 2W1OA 2K9QA 3ULQB 3J7AY 1G59A 3C2BA 3D0SA 1WJDA 4E70A 3JRIA 1MDMA 5H20A 2VOOA 3S1NJ 1PVFA 4QSHA 1BR4A 3PFYA 3GTPJ 5IP7J 4YIFA 1YYVA 4XLHA 5FKNA 2LG4A 4OU0A 2MA3A 3OOPA 3X0IA 5JVGF 1PPVA 4R79A 4DNCA 3K1PA 1VC8A 5GAGJ 2WC2A 4CHUA 1S7EA 1QPIA 2JUGA 4P9UA 2QSHX 4OIQF 3OMYA 4O3MA 2XGCA 2FNPA 1OQYA 4II3A 3JRFA 2ZKZA 2HQNA 2H6BA 2ELHA 1R4MB 5M5WJ 2G73A 4KT5C 1IJWC 5IT9Z 3GWZA 2A8QA 3KETA 2CUFA 3WTTC 2DOEA 4ZDLA 3FZVA 2W7NA 4YRVA 1JRKA 2GWRA 2HFHA 1FIPA 5J40A 1ZG5A 1IW7F 5TGTA 5ILSA 5DEQA 2EK5A 4CH7A 4CZZA 2VBYA 3RKYA 3GW2A 3BR5A 1WJFA 1K4SA 1JHHA 2LLKA 3KPHA 4A6EA 4OIPF 4XM3A 1SFKA 4J00A 1V4RA 3L2QA 1J75A 1RZ4A 2KHMA 2IXSA 3P9IA 5IY5H 1SMYF 1YX3A 4GRIA 3OYNA 4YPRA 2FE3A 1S72I 4M71A 5K7HA 1IN4A 3PIOF 2DN0A 2EZHA 3ZQFA 3OYCA 3J7Ye 1TT0A 5GPCA 4M3BA 4PJLA 4BXUA 1JT0A 3DPUA 3TO9A 2H6CA 5J6XA 2DQRA 3KEOA 1R5HA 1APLC 2CRGA 2DA4A 2E1NA 1LKXA 2VQLA 3FKIJ 3HPGA 1HX3A 2FVVA 1V8NA 2BXYA 4ZG0A 5DUKA 3ZMDA 4HDVA 3QSJA 4UHTA 4BH9A 5K7FA 4MFEA 2UXNA 2UUZA 3QPLA 4AIKA 3MVPA 4HA8A 4OIOF 2E1MB 1B4AA 1X1PA 4L5IA 3EPZA 5LGNA 4ZYAA 2K3FA 1TWCJ 3ZMZA 2R0QC 4M9SA 4E4HA 2YX4A 1HSJA 3DXJF 4HPQA 4JX5A 4YG2F 4KN4X 4KITB 5ERIA 3BC8A 3I58A 1OLTA 4ANJA 2HOTA 1UZCA 2DA5A 2ZXJA 1JI8A 1O3SA 1K4TA 2FRHA 2VXZA 3OSGA 5B1AH 1TNSA 2HYJA 2MABA 1BW6A 3CDHA 5E1XA 4LG3A 3QRFF 4L9TA 3X0SA 1MZBA 3PM1A 1LQ1A 4FHTA 3LA3A 2FBHA 2DMPA 2X6WA 4N4OB 2FF4A 5D5XB 4XKVA 2ZJ2A 1B9NA 2PJRA 4XLAA 2KZGA 4OWRB 1OFCX 5EZGA 5IOZA 3BCAA 3F6VA 4XOTA 4RA2A 1PUEE 4IJXA 3MD2A 5EEAA 2E7XA 2W84A 4A5NA 2VQCA 2L2OA 2AXTC 2DODA 2B2KA 4IPAA 3TBIA 4CXFA 1EJ9A 2RV8A 4HV6A 5C7TA 4CICA 3HTUA 4M74A 5IYCJ 2Q2EB 1XMXA 2DA2A 4F7ZA 4E7HA 2HDCA 1U8BA 1IRYA 1Y56A 2CQQA 2K9SA 1IXCA 1K83J 3I53A 3PUBA 3HOTA 1ON2A 5FRNA 5HVQC 3QWLA 1XX5A 1DGRM 1KHZA 1ZQ3P 5DM6F 3VWBA 3CDIA 5IPAA 2HKOA 3NRVA 2R5ZB 1OCCH 1R7JA 3CMMA 2BW3A 2AQEA 4CCLA 4MTEA 3MFKA 2PNYA 2F5VA 2VJIA 3W6JB 4UY8I 1FBUA 2P7CB 5IW5A 3LOCA 5TISC 3HOZJ 3X0PA 1P9QC 4YFKF 5CVUA 2BXZA 3BPXA 5J8CA 2G0EA 5LFAA 1KYZA 3HC7A 5B1BH 5CVIA 3M8FA 3MKZA 3COAC 5DPKA 4LK1F 4PJJA 1F36A 3WG9A 2IVMA 1PDNC 3K9TA 2DTRA 3OWTA 1FBQA 1WRJA 5CVJA 5C4JJ 3HDDA 2NVQJ 4HF1A 4HNTA 3CF5F 2FA5A 2O0YA 2GT4A 1TT5B 4BS9A 1AU7A 1Y6IA 4LLNA 5IP6A 1IO2A 1LFPA 1FC3A 3G3ZA 3F13A 2DJIA 5E8IA 1AKHB 2R7RA 4A3MJ 2DQLA 2ISYA 1JTXA 5CYVA 2BEOA 4NDLA 4IHXA 3KFWX 3H95A 4A93J 2VI6A 3AG4H 3DTEA 1QVJA 1XD7A 2PI0A 4EM0B 1EF4A 2L02A 1U5TA 3D5LA 3R6SA 2AO9A 4QPOA 2E7WA 1G3WA 5DCMA 1X51A 4RB0A 2CQ7A 2P4WA 2FEZA 4F3QA 5FD6A 1RETA 2JVHA 1TTYA 3IWFA 4KIFA 3ZQQA 1V8TA 3KZZA 2LFBA 3CCLI 4ZJZA 3EEUA 1LDJA 2K4JA 2R3SA 3J7ZI 2IRFG 2VBWA 2W57A 3E6BA 2NRAC 4CGZA 3CESA 1S29A 2ESNA 1X1BA 2P0WA 3DCFA 4XNFA 2R7QA 1PP8F 5GHIA 4RAZA 3C18A 3CF2A 2E2HJ 5J1YA 4HV5A 1CF7B 3VODA 1W7PD 1U9OA 4P5OA 1YIOA 1SAXA 4RMNA 3OSFA 4RGRA 3DUPA 1BI1A 2P8TA 1ERDA 4RM3A 2DT6A 5ANUA 3JTHA 3I64A 1VQLI 4ZDOA 3ZQ7A 3S14J 5D8LB 1LE8B 4I02A 5DCFA 3RSNA 2VT2A 3JAMK 4M6YA 2XRNA 4CCOA 2KIUA 3CC4I 3O61A 3B73A 3SZTA 3S15J 2L01A 4CYCB 1L0OC 2XSDC 3JRDA 3O6BB 2MSYA 3M1EA 3DLLF 2A68F 4KYXA 2V4JC 4JYKA 5LPGA 5FSIA 3AKZA 3HM5A 2D2WA 1B72B 2M3AA 1J5YA 3GZ8A 1RKTA 3Q0UA 1A6IA 1BR2A 4W1UA 3MQ0A 3CO7C 2BE5F 2LY1A 1FYLA 1J9IA 2GIVA 3AFHA 4UUVA 5DS9A 4HNUA 1ENHA 4XQFA 2IEKA 3FK9A 4V2FA 1JUPA 2YVMA 2IA2A 4QIWN 2OBPA 3F21A 4V19K 3KIOA 2EWNA 4GGGA 1H0MA 1AA7A 1IF1A 1RPWA 2JVGA 3Q9SA 4RGSA 2IT0A 1A35A 1TWHJ 2NVYJ 2QENA 4Y52J 5K5RA 4X1EA 1ZTRA 3DU5A 1OPCA 3BJ6A 2DOAA 1YW9A 4LLGF 1SD5A 2O9LA 4BJ5C 3ZMTA 2M2EA 2X6XA 1MSEC 5LRSA 3HUGB 2ACJA 1S9HA 3LA7A 4HDUA 3PSIA 2PX9A 4DW6A 1V8SA 1NTCA 3B02A 1D5YA 4L0ZB 3BR3A 1ACIA 1YOVB 5HDNA 3CUOA 4M9XA 3L2UA 5L3DA 3KX2A 3J80K 1R49A 2V1XA 4ICKA 5GHQA 2LTPA 2NOJB 4AUXA 5FSKA 2HNHA 4XN0A 1Z7UA 2VPLA 3SZPA 3ELKA 2V9KA 2EIMH 5A2QZ
chains in the Genus database with same CATH topology
3IWZA 3NEUA 4G6QA 4RS8A 2HOEA 3CJNA 2FQ3A 4OINF 2EV6A 5IW4A 1E2XA 3E3VA 1QNTA 1RUOA 3N9UA 2XHKA 3BM4A 1HKTA 1U5TC 4EJTA 1XSAA 3MCFA 1MP2A 4BYYA 3SONA 4ENMA 5ANVA 2QBYA 2RVCA 4LD5A 5E1ZB 2JVBA 2TDXA 1FLIA 1V8VA 4HW0A 3F72A 4NHJA 1ZGJA 2FU4A 4RB3C 1H9TA 2PJPA 1RYAA 3ELKA 3WGIA 2LKPA 3O52A 4WXDA 2IA0A 2ZNZA 1NFZA 4MQ9F 5ICCA 3M9AA 5F64A 5HDKA 2LDUA 1G9QA 2XAFA 2J5OA 4EJWA 3VFZA 4G7ZF 2GAUA 3PQKA 4BHCA 2CL3A 1B1BA 1FP2A 2RDPA 4JZSA 4B8XA 4NFWA 4OIRF 5JVTA 2A07F 2Y48A 3IRQA 3KLNA 2QYOA 5D5WB 2EA2A 4YFXF 1ULYA 2JSCA 2P5LC 3ZN0A 2ZO4A 1S7OA 4OMYA 4HQMA 1IN6A 1VRLA 2HEOA 3RYPA 2A61A 1MDMB 4S2YA 4K6EA 1ZARA 1IRGA 4YOQA 1YW8A 2GXGA 3X0RA 5L3FA 2MLGA 4MHGA 2Y0MA 5ICGA 1HZTA 5ISYA 2BBYA 5ILUA 4ZYGA 2O1CA 3RPQA 4CDGA 2F5CA 2DUKA 3WE2A 2JZYA 4KYWA 1EH7A 2VC1A 3JTGA 4KG3A 2X4HA 1V8UA 1BN5A 4XLNF 5DD4A 1TQIA 2STWA 2M87A 4PGGA 4S2WA 3I7VA 5C7QA 2KDVA 1XGOA 3HHHA 2IW5A 5F1RA 4BAYA 3KCCA 2XV4S 5LBQA 3KZYA 5ED4A 4Q4ZF 4MNUA 3GWYA 5BS6A 3QP6A 2KRFA 4ZZLA 3WTYC 5K5OA 3DQVC 2OZ6A 1TUMA 4AIHA 4DYWA 1KU3A 2PBIA 2XASA 1G6NA 5J8FA 2G74A 2PEXA 3ECOA 1JE8A 3VEPA 4Y13A 3P9CA 4R1HA 3C7JA 4I2OA 3KLOA 4M72A 2CG4A 5GHNA 5GHOA 3ROUA 4KG4A 2OQGA 3V8KA 3K69A 5D4SA 2EV0A 5LEJA 3GRNA 1NHAA 2OD5A 5D8KB 2LSOA 1PPWA 3N77A 2DK5A 3QU6A 3TKYA 4JQFA 1Q33A 4O5VA 2O5FA 1SOIA 4PZJA 1BI0A 1I9AA 3T1BA 2L4MA 1MGTA 2VBZA 2HYGD 3LSTA 4A12A 1WI9A 1DP7P 5FSMA 1XDUA 2EFQA 1FX7A 3MGMA 2HYFA 2X0LA 5BPIA 3BDDA 5FSOA 1CGPA 2ZBKA 5AIPA 4WF2A 4G6DA 1C0WA 1O7FA 2PLYA 3BROA 5DUIA 2QLZA 1F5TA 3KE2A 3LQQA 2AS5F 4GCVA 4JK1X 3FXQA 1K78A 5DYMA 1SZ3A 1IZ1A 4EM1A 1FOKA 1U78A 3P5TA 4HX7A 5LHGA 5LGUA 3A6VA 2W24A 1KYWA 4OMZA 1XSBA 5FO5A 1XCBA 5JHUA 2HTJA 2XVCA 2HGCA 2OQRA 2VODA 3JSOA 2A8TA 3GLXA 2HZTA 2W25A 1KQ9A 3LQRA 4HOBA 4V14A 1ZAOA 4I0BA 3QAHA 2M45A 4Q5SF 2NAZA 4EGZA 2G7HA 1UHMA 1USTA 1XDSA 2A6EF 2YVOA 5BOXA 2O03A 3J81K 3RYRA 3EETA 4GO1A 3EUHA 4HQEA 5HS8A 3OGAA 3DEUA 3TO7A 4KNYA 2A3SA 1YO5C 4MTDA 3TO6A 4FX0A 2RNJA 5KK1A 3HSFA 3DP7A 1KT9A 1X83A 1ZRDA 3E6MA 4ZYEA 4ESFA 3TQNA 3I7UA 2L3DA 1F4KA 3X0KA 4XBFA 3BP8A 3GZ6A 1ODDA 2D45A 1TW2A 3C3WA 5ANTA 1U5TB 1F9NA 2CO5A 4N9HA 3KVHA 2D1HA 1S8NA 2L54A 3LFKA 1ZYRF 5D4RA 5DCMB 3L7WA 1YTYA 2FBIA 3AAFA 3HHGA 3ECHA 1ZLKA 2I6KA 2A69F 1HW1A 2OAZA 4GXOA 1VC9A 1B59A 2ETHA 3ISPA 3TOAA 1IRFA 2KJBA 3EYIA 3ZP5A 5FB2A 1TW3A 1H9GA 5E17F 2Z9OA 4KDPA 3H92A 3IKTA 3FX3A 1MKMA 2CZRA 3FSPA 4YIIA 3GO5A 2V1DA 4LFUA 2HR3A 2K4BA 4BNCA 1GHCA 2VT3A 3CUQA 1SU2A 1EH8A 2CWEA 3S2WA 3SFZA 1Z91A 1D8JA 5GHJA 3HRSA 4N1TA 1DPRA 3EYYA 4N9IA 3EQLF 3R0AA 1JXSA 3O3KA 3KP2A 3QPHA 2GQQA 3SQNA 5GHPA 4I7HA 1UB9A 2CQKA 2MLKA 3M7GA 3FCMA 1U2WA 2RKHA 2GA2A 3MAJA 2XAQA 4ESBA 2XAGA 2NNYA 2I8UA 2B06A 3KP7A 3Q5FA 1EV7A 1Z6RA 1PPXA 1KU7A 1T39A 2PQ8A 1Z1DA 1R00A 2LF8A 1VIUA 3FM3A 3R61A 2EFWA 3QP5A 4FT8A 5CVRA 1NFSA 3F22A 4UVBA 1D3YA 4A0XA 1MK1A 2R7DA 3FMQA 2QM3A 4EVIA 2EFOA 3EF5A 3LAJA 1S3JA 4KUMA 3RTRA 3I71A 3I59A 2VONA 3O69A 3ABUA 4G8XA 3WU1B 4S2VA 1P4XA 4GYIA 3GFIA 2QJTA 3JAMZ 4EJUA 3E5QA 3TGNA 1QGPA 1HXDA 1USSA 5H6RA 1U8RA 1BI2A 5KVRA 1KQ0A 1KU9A 5AONA 4WX9A 2QBYB 4WK8F 2VBXA 2QVOA 1D8KA 2HWVA 2CW0F 3RPUA 3X0MA 4HYEA 3X0LA 1ONVA 2P5KA 5GHMA 1P6RA 3ERED 2PMUA 2DLLA 4HX4A 3HHJA 1LJ9A 1V8YA 1SD4A 2XUBA 4I01A 2QJOA 4LB6B 1R1UA 3BJAA 4EQQA 4ENJA 1J0RA 5ICEA 2XKPA 3CUQC 1HSTA 2HS5A 1XSDA 2DI3A 3L9FA 1BBYA 3J80Z 1UFMA 4IVNA 5L3GA 2ISZA 3R0JA 5HS7A 2IPQX 4L9JA 2DPUA 2ZMEA 5K5QA 2FOKA 4QWQA 4ASNA 4L9NA 1FY7A 5LHHA 1TQPA 1HW5A 3TDZC 2FMYA 1JGSA 1LEAA 3BWGA 4R8HA 4HLYA 1LDKB 4AD9A 3BOQA 3O6ZA 2G7UA 2WV0A 4IHSA 4HF0A 4WXCA 1KGSA 3BJOA 2MBFA 4A2UA 1RUNA 3RIRA 4G7OF 3EXQA 4A0ZA 2K02A 3KP3A 5H6QA 1ZH5A 3CO6C 1XMAA 2XAJA 1R58A 2PMHA 1O7LA 3MEXA 3V7CA 3OV8A 4LGWA 4UXNA 1QZYA 2QUFA 4KMFA 1FZPB 3T8RA 1JHFA 4MEYF 1FBSA 1JKNA 2ADUA 1A04A 1R23A 2V79A 4HAMA 1G0SA 1LB2A 4KIBA 1MJAA 4I0AA 4UVCA 1ZG1A 3EDPA 5L3BA 2NNNA 5E20A 2QQBA 5D5VB 2Q8KA 1V8IA 2FSWA 3F23A 4EMSA 3K0LA 3WTXC 5JR3A 1WKMA 3ID9A 5FLXK 1KA8A 4ENNA 2YYHA 1KU2A 1QBJA 3F6AA 3X0NA 3K1NA 1S6LA 3IC7A 1LDDA 4XSXF 3WGGA 5CLSA 1VIQA 2D1VA 3KP4A 3L00A 1XN7A 4L0YB 5TJJA 4NFXA 2FMLA 3V7SA 1IN8A 1FNNA 3MDGA 3HRTA 2DFIA 1RRQA 4C9WA 5LRRA 1VK6A 3F8CA 3Q93A 4ZH4F 3FXUA 4U0VA 1K78B 2HTSA 2RRKA 5D6FA 3WGHA 4LG0A 2PG4A 5FGMA 3EESA 2ICJA 2OU2A 5HLIA 4A5MA 2VNPA 1Z05A 2L4AA 5HLHA 4U0YA 1VTNC 5FSLA 2M8EA 1K6OA 1O3QA 2ZFWA 4M6XA 3GX4X 2Z33A 1K7AA 2RGVA 2FNAA 1U20A 1Z6TA 1F1ZA 1F3YA 1OKRA 3SHDA 1RNLA 4WXHA 4HZFA 1AOYA 3IHUA 3REOA 2YSRA 2DBBA 3LWFA 1YW7A 4CYDA 1T6SA 3T0YA 1MR2A 5ANWA 3GFMA 2VC0A 3KP5A 3ZN1A 2QQAA 1V3FA 4ENKA 2YR2A 1REPC 1BC7C 4JZVA 1J59A 1QO0D 5CFIA 5F6FA 2E1CA 2ZNYA 3E6CC 2CFXA 2ICKA 2JT1A 3WE3A 4JBAA 2QWWA 2STTA 2O8XA 3PFIA 2VOPA 1I1SA 2NS0A 1FPQA 3FJYA 2GXBA 3E97A 2OZUA 3SMDA 2O61A 2Y75A 2DSDA 3U1DA 3GUDA 2V6CA 3RKWA 5BQTA 2P5VA 2LNBA 1W7PA 1IXRC 4P9FA 1PP7U 1XGSA 2GT2A 2QKMB 4NB5A 3HOSA 3E5XA 2P6SA 4MQVA 1Q27A 5FD5A 2VE9A 4O6JA 3FM5A 2C6YA 1R5GA 3K2ZA 4IRIA 3J81Z 2GZWA 2MH2A 3F8FA 1D5VA 3CUQB 1TQMA 4KN7X 1U6GA 4J7GA 1SFXA 3Q2SA 1GVJA 2YVNA 1WQ2A 4JZUA 3F8BA 3RKXA 1FSHA 2F5DA 3HIFA 4HLXA 3HYIA 4PCQA 4Y15A 3BHOA 1G3TA 3V4GA 5ANSA 4LB5A 3N4MA 4EV0A 3I54A 4N1UA 5CFJA 2Q0OA 2A6TA 2DAOA 1L3LA 1DUXC 1T2KA 1RI7A 3HTSB 4L18B 1XSCA 4ETSA 3F6OA 3LA2A 4M73A 3DKWA 4KA4A 1BOAA 2YU3A 1YQAA 2LF7A 1QZZA 4IRHA 5BPDA 3TOBA 3P7NA 4RGXA 2F2EA 3ZMVA 3F8MA 3QOPA 4BHBA 1G3YA 3RI4A 1OYWA 1R1TA 4AIJA 1ON1A 3ABTA 4QLCU 4WCGA 3V8LA 4Z2YA 3R03A 4WWCA 1SMTA 4Q48A 5LHIA 3I5UA 5C8LA 2DSCA 3O8SA 3NQOA 1DDNA 1WWXA 5E18F 1GXPA 1MQWA 3I59B 4S05A 2KDWA 1BC8C 1I1GA 2O5WA 1IN5A 3FMSA 1T38A 1AWCA 5IT9K 4KFCA 1T0FA 4KMUX 2WTEA 5DDGA 1BIBA 1X84A 4MGRA 1SFEA 2COMA 4P96A 1Z9CA 3BAPA 3AC9A 3RJPA 5AIQA 2RQPA 3P9KA 1J7KA 4G94A 4HFQA 1LNWA 5JFRA 3V7RA 4G9YA 5EEHA 2O6GE 4Q47A 1O57A 4ZYHA 1VHZA 4UV9A 4YFNF 2BYVE 1RIOH 3JSPA 1K79A 2A8RA 1Q1HA 2MC3A 4EJVA 4UNOA 3A6UA 3ZMUA 2MH9A 3BZ6A 1UHWA 2UZKA 1R67A 2ZCWA 2J5PA 3E6DA 1G4DA 1MUTA 4LMYA 3ML6A 3Q9VA 4ON0A 3ZR0A 3WODF 2FKBA 5E8GA 3WTWC 2DPDA 4U88A 2ZMEB 2EFNA 5JI6A 3JW4A 1E17A 1R36A 4PDKA 1YG2A 4ESJA 4TV7A 2JPCA 3GFLA 2DW4A 4RGUA 3MZHA 1SFUA 2OA4A 3FFUA 2VE8A 1P4WA 3WTVC 3BPVA 4AVPA 2AXLA 1XGNA 1FP1D 5BONA 3Q91A 5HDGA 3GXOA 1VHGA 2R5WA 1Y0UA 1FYMA 1BM9A 5FFZA 3A6SA 4YPHA 1O3RA 4C9XA 4L5JA 1ZRFA 1STZA 1BIAA 1XSXA 3MDIA 3FWEA 2YX7A 3BY6A 2DT5A 2G9WA 2PN6A 2RN7A 1BJAA 2H94A 1VCDA 4L9VA 1IXSB 4UV8A 3ZPLA 3SHFA 3KP6A 3LAPA 4A6DA 3GVAA 1OW2A 4H0EA 2DK8A 3MCZA 2F5EA 1EH6A 2KIMA 4ZZDA 2M30A 3Q1PA 1W5TA 2BV6A 2FXAA 3X0OA 5D5UB 2BGCA 1V8RA 1OYYA 3RH7A 3WHWA 2DSBA 5ILVA 2IJLA 3U9GA 4IJAA 4IRGA 1ZLJA 1O3TA 1FSEA 3U2RA 1U3EM 3I4PA 4I98B 1TBXA 1QQIA 5FSNA 4K2EA 2XROA 4EGYA 3FHZA 1IUYA 3R60A 4HBLA 5K1YA 1XCVA 2XIGA 3G0QA 1UCRA 3WU0A 3M8EA 2YVPA 1S7AA 2KKOA 3KEQA 3R4KA 2Q2EA 3GZ5A 3O2PE 1R1VA 5L3EA 2QZ8A 4EJOA 4UVAA 5L3CA 1TLHB 3VB2A 5HZXA 4ILQA 3DFGA 5EEGA 2R7FA 3HRUA 4LG0B 4IF4A 4BQAA 4M9ZA 3DPLC 4B09A 3DKUA 3HRMA 1PUQA 1V8MA 1MJ9A 1B9MA 4XSZF 1YS6A 2CSOA 2MD5A 1FWZA 4LK0F 2PQVA 2XKOA 2Z5UA 1W4MA 2B0LA 3SXYA 3N97A 3TDUC 4HF2A 1HKSA 3CLOA 1XGMA 2K86A 1NQZA 1G3SA 3HSRA 4OOIA 4U0WA 5FFXA 1T98A 5TRDA 1TNTA 1XB4A 1XSVA 1V8LA 3ZR1A 3MZYA 1GA7A 1K26A 2XSQA 4MEXF 4LLLA 5FLXZ 3L2CA 3HSEA 4XLPF 2IA1A 4PGHA 1LVAA 4EM2A 5HLGA 4MPOA 2JTVA 3IRRA 1ZG3A 2A8PA 1P92A 2GA1A 4IHTA 3GEZA 1V8WA 1DPUA 2A6HF 1ZGAA 3G73A 3DF8A 3E5UA 2HKXA 3WTUC 1OMIA 5HOOA 4KIGA 2K27A 3GG6A 1J2XA 3H3ZA 2F5FA 3V8JA 3QU3A 5LEKA 5A2QK 2UXXA 2DO7A 1CF7A 2XAHA 3COUA 4ZYDA 1MD0A 2V9VA 1B6AA 3I9XA 3X0JA 3WTSC 4U7DA 1W7PB 2EFPA 5DV5A 2EV5A 3ZMSA 1HW2A 2W4EA 4LJZF 2EB7A 3GYHX 5E1WA 3Q4IA 1W5SA 3WTZA 4G7HF 1I6XA 1X3UA 1OR7A 4I09A 1LEBA 1HKQA 1RRSA 3FMRA 1KQ8A 4KICA 1QPMA 2JPBA 3DV8A 3W6KB 4HX8A 5BMZA 5D6EA 3HYQA 1YLFA 2WWYA 2O3FA 3P6YA 4AWXB 3U53A 2Z99A 1PUNA 2AZWA 3IL2A 4JZTA 2YPRA 3CTAA 3MWMA 3J7AO 1SD6A 4A0YA 2EA4A 2CGPA 1Q54A 4RAYA 2A8SA 1IN7A 2M1BA 1I5ZA 1WSUA 4U7BA 2M5WA 5HS9A 2RC4A 2K7LA 3GFJA 1YFHA 3C1DA 3HUGA 4Y17A 4RB1A 1ZREA 3CNGA 3VOEA 6PAXA 5DD8A 1FT9A 3PQJA 1P2FA 3FXRA 1IAWA 2P7VB 5I8UA 2DHOA 4D0PA 2KJCA 3RDIA 2Q9PA 5CJ9A 3QPTA 4J7HA 3T8TA 1R22A 2EJRA 1SJYA 2ESHA 5LGTA 3F3XA 4S04A 4KTBA 2CYYA 1HQCA 2PFBA 2FBKA 1PUSA 2P6TA 3I0TA 4DQ2A 3E57A 2Z3YA 2I8TA 2NYXA 1P4AA 2XGXA 3L85A 2H09A 1ZHFA 2J8QA 2VNQA 2VN2A 3DPTA 2HQRA 3X0QA 4CO8A 2V1UA 1FYKA 3H3UA 2DU9A 2JRTA 3L09A 4N0BA 2W85A 5CVVA 4BHPA 3Q2TA 1ZN2A 4FX4A 2GB5A 1NQYA 1OYIA 1KTGA 3T5XA 1HBXG 1ZRCA 3A6TA 4IXAA 5LLQA 1YS7A 5ICFA 2KIFA 2B0VA 4RB2C 1MJBA 1SD7A 4P55A 3F8NA 2IP2A 3FF5A 2H27A 1MQEA 4XRFA 2A5YB 4S2XA 3K1MA 1I27A 3GF2A 3ACAA 1K2EA 1GXQA 4NQWA 2QQ9A 2UWMA 3IKVA 1BI3A 5IT3A 3ULQB 3D0SA 4E70A 1MDMA 2VOOA 5H20A 1PVFA 4YIFA 1YYVA