3GZ6A

Crystal structure of shewanella oneidensis nrtr complexed with a 27mer dna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
219
structure length
219
Chain Sequence
b'QLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLTQKALYSLVPGFALSEPFTLPELQHVHEVLLGKPIQGKSFRRRVEQADLLIDTGLKRTERGRPANLYCLKPDTASYRFLRNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Dna binding protein/dna
total genus 59
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gz6A02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz6A01
4HX4A 3R0JA 4G94A 2UWMA 5LPGA 5ICFA 4KDPA 3O52A 4KFCA 4WK8F 2LDUA 3IRRA 3MFKA 2GQQA 1LQ1A 2M1BA 3P7NA 5DCFA 2FOKA 1R36A 5F6FA 1V8VA 1KYWA 4D0PA 3DKUA 5JHUA 4CDGA 1ZGJA 1IRFA 3X0KA 1ZYRF 1Q1HA 3K69A 1XSAA 4MQVA 1EH6A 5IT9Z 1A04A 3TDUC 5HS9A 1FY7A 5J8FA 1DP7P 2CGPA 2EA2A 5DCMA 5CFIA 3GG6A 3GUDA 1LJ9A 4CGZA 2HKOA 5LBQA 3WTWC 5L3CA 5CVRA 5LRRA 3E5UA 5C7TA 1YFHA 1ZARA 3OV8A 4G7ZF 3Q91A 3FMRA 2QLZA 1SZ3A 3O61A 4EGYA 3LWFA 5LRSA 2D2WA 4WXHA 2JT1A 3WTVC 3X0PA 1H9TA 2FVVA 2AZWA 2LF8A 1F9NA 2YR2A 5AONA 1G3WA 1PP8F 2XHKA 3LQRA 5CFJA 3COAC 1K78A 2RV8A 3HRSA 1T39A 3F8MA 2BE5F 1GHCA 3ZMTA 1HW2A 4FX4A 3E5XA 4O6JA 1R7JA 1SD5A 3FK9A 3N9UA 3L09A 4QWQA 5H6RA 5J8CA 5ERIA 3E3VA 1IF1A 5ICEA 1IZ1A 3LAPA 5FGMA 4KT5C 1CF7A 2ESHA 2CG4A 1XGMA 1VRLA 3FFUA 1R58A 2NAZA 4A12A 3KP6A 4BHPA 4L0ZB 4ZYHA 1OR7A 4UUVA 2RQPA 2I8UA 2W84A 1V8WA 4S2VA 3QU6A 2VBZA 1U3EM 2V1UA 1PPVA 3Q93A 4RAYA 4A6EA 2MH9A 5LHHA 3DF8A 5FD5A 3CJNA 3ECOA 2DK5A 3RJPA 4M73A 4HDUA 2WV0A 2BV6A 4PDKA 1O7LA 2PQVA 1O3TA 1Y0UA 1V3FA 3JAMZ 3ZR0A 1ZN2A 3HSRA 5D4SA 1L3LA 1Q33A 1XN7A 3HUGA 4ZZLA 3CNGA 5DEQA 3LA2A 2JPBA 1PPWA 4HDVA 4U0WA 3MZYA 2XSQA 1I6XA 2XASA 5ISYA 1IRYA 1SD7A 3BOQA 4I0BA 1XCVA 2ZMEB 1S3JA 3VOEA 2BBYA 4MTDA 4IPAA 3E6DA 3IHUA 3BP8A 1MP2A 4JK1X 3RPUA 1S6LA 2RN7A 4LFUA 4LG0B 2EA4A 5IT9K 3DQVC 4PCQA 4U0VA 1IN6A 2AXLA 3FCMA 5L3FA 2GT2A 2UXNA 1ON2A 2QYOA 3RKYA 4EJVA 1Z9CA 1RYAA 4A5NA 4HQEA 1MJ9A 2F5DA 1W7PA 1S29A 1Z6RA 2HDCA 5KVRA 3WHWA 4UV8A 3R61A 2BEOA 1SFEA 4UVAA 4OIQF 3JW4A 4HYEA 5JVTA 5D8KB 4BYYA 2HR3A 4ENNA 1KA8A 4P96A 4MTEA 2OQGA 1BI0A 5DUKA 3TOBA 2E7WA 4NFXA 1FSHA 1OYWA 1RZ4A 2OAZA 2IRFG 3CDHA 3EDPA 5BOXA 3ISPA 1PUQA 2P5LC 1S8NA 4P55A 5FO5A 1RI7A 3GEZA 4WX9A 1YW7A 4O5VA 3F23A 1K7AA 4M6YA 2FBHA 2H6BA 1KQ0A 3ERED 2HOEA 1GVJA 2VODA 3S2WA 3VFZA 1R1VA 3CUQC 4UV9A 5BONA 3L00A 3BHOA 2AS5F 2PG4A 3L2CA 4AIHA 1ODDA 4MPOA 2MC3A 2KIFA 5L3DA 2O0YA 5D4RA 1C0WA 2V1XA 1MR2A 1VK6A 1E17A 2FMLA 5D6FA 1HKTA 2FU4A 3HTSB 5ANWA 1E2XA 2VBYA 3Q1PA 3MDGA 4EV0A 3WGIA 2YVOA 2DHOA 5LEJA 2A8TA 1G4DA 1BIBA 3IWZA 1P4WA 3FF5A 3V8LA 2FKBA 4LMYA 3KP3A 2P7CB 1B4AA 4IJXA 2DQLA 5DCMB 3V4GA 5D5VB 1SD6A 4NB5A 3KP7A 1I27A 1BOAA 1G0SA 3MGMA 1T0FA 2JRTA 4Y13A 1G6NA 2FNAA 1RIOH 2NS0A 2Z33A 3I7UA 2ZNYA 5EEGA 3H3UA 1OMIA 3EYIA 5EEHA 2IJLA 3JAMK 1YW9A 4YOQA 3EQLF 1IUYA 4MGRA 1G3TA 1JRKA 3V8KA 2ESNA 5FB2A 5BPIA 1ZG3A 5K5RA 3RH7A 3ZMUA 4LLGF 1SOIA 1QPMA 1FP1D 1KU9A 3M7GA 3SXYA 3PQKA 1XMKA 3T1BA 4QLCU 3RYPA 2B0LA 4EJTA 4HQMA 1UB9A 1I1GA 1K78B 3J7AO 4PGHA 5HLGA 2CQKA 1HBXG 2BGCA 1VHZA 2FE3A 1YO5C 5DYMA 3GX4X 2EV6A 2EFNA 4ASNA 4G6DA 2YVMA 1Z1DA 4KIFA 1ONVA 4UNOA 1UHMA 2ISZA 2R7FA 1EH8A 4N9IA 1VCDA 3MWMA 2M30A 3C18A 4AIJA 1R5GA 1CF7B 5FSIA 1BI2A 4KTBA 4M71A 4Y17A 5K5QA 5F64A 1IRGA 1TW2A 2ZCWA 2A8PA 5FSMA 2M5WA 1MGTA 3GYHX 3C1DA 3DFGA 2YVNA 2EFWA 2IT0A 1SMYF 4A5MA 5DDGA 4EJWA 3LA7A 3SFZA 1MJAA 1T98A 4OIPF 3GWZA 4L9VA 1ON1A 3EUHA 1QO0D 2P4WA 3V7SA 2PQ8A 4OINF 4LK0F 1PUNA 1TQPA 3F6VA 4E70A 3DXJF 1W5TA 4N1UA 4N1TA 1ZG1A 3QU3A 1IN4A 1T2KA 2M8EA 4N9HA 1MKMA 4L9TA 4TV7A 5LEKA 2KJCA 1PUEE 3FXUA 1IXSB 2V1DA 2ZKZA 5AIPA 1TNTA 4P5OA 2J8QA 1TTYA 2ZFWA 1J9IA 4I09A 4RAZA 4IHTA 2VBWA 1NFSA 5ILUA 3LSTA 4MHGA 2A68F 1BN5A 4AIKA 4M9SA 4CICA 5CLSA 2I6KA 2EWNA 3MCFA 4HF2A 2JPCA 1WSUA 2HQNA 3MAJA 3ID9A 1XGNA 1USTA 2Y48A 1TW3A 2KKOA 4WXCA 2W25A 3X0QA 3D0SA 3GZ6A 1U6GA 3CUOA 2P7VB 3I71A 4G6QA 3K1MA 1B9NA 3FMQA 3M1EA 3PFIA 1W7PB 4AVPA 5LLQA 1NFZA 5L3EA 3N4MA 2D45A 1ZLJA 2XGXA 2QUFA 1TUMA 3RPQA 3HHGA 4P9UA 4A0ZA 4XSXF 4K6EA 3F21A 2DPUA 3A6SA 1TLHB 4ETSA 4ESFA 4C9XA 2XV4S 2YPRA 3ZMSA 3OOPA 1L0OC 1I1SA 2FF4A 1O3QA 3KEQA 4RGXA 4YIIA 3WTZA 3NQOA 4OMYA 4ENMA 1IW7F 2GZWA 2PBIA 3FM5A 5CVUA 1V8MA 2O03A 4HLXA 3FZVA 2IW5A 3WTXC 2LSOA 1DUXC 2M45A 1K2EA 1QNTA 1P6RA 3RIRA 5JFRA 4ENKA 3KCCA 1QQIA 1R1UA 3RI4A 3KEOA 5LHGA 2XKOA 3BDDA 2E7XA 5ICCA 4ZYGA 1Z7UA 3KETA 5HDGA 4ZG0A 3FJYA 1W7PD 1YYVA 1PVFA 2B06A 2CW0F 4U0YA 2MH2A 3QPHA 5HLHA 4LJZF 2QKMB 4JZUA 3Q2SA 4O3MA 1TQMA 2RGVA 3SHDA 2KDWA 4DQ2A 3MEXA 3E97A 2DLLA 1ZAOA 2O3FA 2VBXA 3JTHA 1OPCA 1V8IA 3ABUA 5K1YA 2E1NA 2CYYA 2HWVA 2EV5A 2STWA 2L02A 3ECHA 1KGSA 4RB2C 3TGNA 2ISYA 1KTGA 1D8KA 3Q9VA 3SQNA 2Z5UA 3R4KA 3KFWX 5LHIA 1D5VA 2P6SA 3C3WA 4BXUA 1B6AA 3E57A 5ANVA 3KZZA 2IA2A 3WGGA 2VNPA 4KIBA 2O6GE 2IP2A 3R0AA 1R23A 2M87A 2VC1A 2A8SA 3QSJA 1BM9A 5BPDA 4I2OA 4XSZF 2DW4A 3GFJA 1QZZA 4XRFA 1TQIA 3CUQA 4EMSA 5IW4A 2BYVE 2OZUA 3I64A 1U5TC 3FHZA 2O5FA 3BWGA 1FNNA 2A3SA 4BAYA 5L3BA 3IKVA 5HVQC 2DTRA 1LDDA 3BAPA 3Q5FA 1P4AA 1IN8A 4K2EA 3G73A 2Q2EA 1V8UA 3I59B 3DKWA 3IL2A 4OIRF 1VC8A 3DUPA 1WRJA 1GXQA 1I9AA 2FEZA 3VEPA 1VIQA 2DBBA 1ZRDA 4OIOF 2WC2A 3P9CA 1R22A 1FYKA 4PGGA 3HOTA 4ZZDA 2MA3A 2MLKA 3P9IA 3R6SA 1YTYA 1J75A 1LB2A 3O69A 3SZPA 3GFMA 2XIGA 3WODF 4EM0B 5E1WA 2QJOA 2LNBA 5TJJA 4C9WA 1OYIA 2Z99A 3TOAA 1U8RA 2OU2A 4YG2F 1F4KA 3T0YA 3X0IA 1EH7A 3W6JB 2YVPA 1HZTA 2FBIA 3I0TA 5D6EA 1X3UA 3WTUC 5GHIA 1SD4A 2OA4A 3VB2A 4RB3C 3HYQA 1X84A 4L5IA 5E8GA 4EJOA 1HKSA 1SFUA 1WI9A 2EJRA 4IHSA 5H20A 2DFIA 4WCGA 1V8TA 3P6YA 2VN2A 2K86A 3V8JA 1RUOA 3U53A 3RDIA 3LFKA 3IWFA 4KICA 3F8CA 4UVBA 3H95A 1NHAA 3I9XA 3GF2A 4S2YA 3WTSC 3F22A 2ICKA 1KT9A 3BPXA 1V8NA 3TDZC 4GXOA 1BI3A 5FSLA 3BJOA 4GYIA 2XRNA 2GA1A 1QBJA 1XSBA 4RGRA 4A0YA 5J6XA 3ROUA 3GRNA 3J80Z 4G9YA 4JZTA 2L4MA 4KIGA 5C7QA 1I5ZA 3O6ZA 1P2FA 3ELKA 1XDUA 3GO5A 4R8HA 1JKNA 1QVJA 3X0OA 2YU3A 1U78A 3KLOA 5L3GA 2L3DA 2OZ6A 4GGGA 4NFWA 4NQWA 1Z6TA 5JI6A 1ZH5A 2QQ9A 5ED4A 2ADUA 2Q8KA 2GIVA 1O3SA 5I8UA 3U9GA 1Q54A 1AOYA 3EEUA 2O1CA 2F5FA 3GFIA 2A07F 4BH9A 2STTA 1KQ8A 2DUKA 1RRSA 2X4HA 1XGOA 3TO6A 3KLNA 3HTUA 1XCBA 4I02A 1ZREA 3F6AA 2A6TA 2A6EF 5FSKA 3I54A 1HXDA 4F7ZA 4MQ9F 2DI3A 4L9JA 5ANSA 4UHTA 1MK1A 2UXXA 1ZRCA 3Q2TA 1RNLA 3I4PA 1LVAA 1WKMA 5GHPA 3ZN0A 2D1VA 3FX3A 5K5OA 2DSDA 3U2RA 2FBKA 4WXDA 1J5YA 1K26A 1UCRA 3J7Ye 2PMHA 4ZH4F 2F2EA 4XLNF 2XAJA 2W4EA 2RRKA 1RUNA 3HRMA 2QBYB 2O61A 4GCVA 4M72A 2K7LA 2ZXJA 4S2WA 2DT5A 4A2UA 3CLOA 3N97A 2W24A 1XGSA 3ABTA 1KU7A 1PPXA 1YW8A 1QZYA 3O3KA 2PJPA 2HYFA 4FX0A 4A6DA 4Y15A 1MUTA 3E5QA 3QOPA 5CYVA 4JQFA 4JBAA 1YQAA 4LD5A 2DSBA 4EM1A 1B9MA 2UZKA 1YS7A 4FT8A 1PDNC 3QPTA 4IRIA 1DPRA 5FFZA 3HOSA 5CVVA 1Z91A 3I59A 2NYXA 3A6UA 4EM2A 4HW0A 2DK8A 3X0JA 4RS8A 1KU2A 3BJ6A 1LDKB 3JTGA 2RNJA 1HKQA 5F1RA 1FPQA 1P92A 2HTSA 3QP5A 2FRHA 3WU0A 4ICKA 4YPRA 3DPLC 4ENJA 4JZVA 2HEOA 5IW5A 1EV7A 3RTRA 4I98B 2YX7A 4KUMA 4UVCA 5GHQA 1F1ZA 3CUQB 2DAOA 2LF7A 2XAGA 2E1CA 3BJAA 1NQZA 3K9TA 2IVMA 1R1TA 2IA1A 1NQYA 2QVOA 1UFMA 3FSPA 2B2KA 2PN6A 1OKRA 3GZ8A 1XMAA 3J80K 3BM4A 1XSXA 1ZG5A 1YS6A 4LLLA 2KRFA 4RB1A 2FSWA 1USSA 2QJTA 3O8SA 3X0SA 2QQAA 4HV5A 3A6TA 4U88A 3WTYC 2A6HF 3NRVA 4BHCA 1XSVA 4G7HF 5HOOA 1X83A 2EK5A 3ZN1A 3EF5A 3BROA 4S2XA 2R3SA 4HFQA 3NEUA 2R7DA 3EYYA 5GHJA 2G7HA 1FX7A 3WG9A 4G7OF 5BMZA 5E8IA 2IPQX 1YIOA 5AIQA 4KN7X 4AWXB 4MEYF 4KG3A 2FNPA 3MDIA 4LB6B 1ZRFA 3H92A 1V8RA 3DP7A 2K4JA 2P5KA 2HS5A 2XAFA 4B09A 3CO7C 1HQCA 5LGNA 3WTTC 3HHHA 3M8FA 4BHBA 1FSEA 2PFBA 2H09A 1U5TA 4Q5SF 2YSRA 2V6CA 2DPDA 2F5EA 1BJAA 3HSEA 3GXOA 4FHTA 2VC0A 3GFLA 1VTNC 3K2ZA 2JTVA 2JZYA 2CO5A 1KU3A 2P8TA 4G8XA 4HLYA 1V8SA 3KE2A 2NRAC 3O6BB 2VXZA 1JHFA 1PP7U 1TNSA 2CWEA 1MZBA 2QWWA 4L0YB 2DO7A 4HV6A 3F72A 4AD9A 2XROA 2I8TA 2GB5A 1MDMB 4KYWA 3DV8A 3TKYA 5ICGA 3N77A 1Q27A 3K0LA 4N0BA 3ZQ7A 2V79A 5BQTA 4RGUA 3F8FA 1BI1A 2O8XA 1S7OA 3TO9A 2EFQA 3QP6A 4YPHA 5GHNA 2P5VA 5D5XB 4HX7A 2K27A 1ULYA 3WU1B 3ZMZA 3COUA 2RDPA 1YLFA 4M74A 2QBYA 3I53A 4I7HA 3C7JA 3RYRA 4KMUX 1DPUA 5DD8A 3Q4IA 2WTEA 1FYMA 5E1XA 4HA8A 4RB0A 4HZFA 3KVHA 2KJBA 2HYGD 4KN4X 3FWEA 1H0MA 1J0RA 4ESJA 3AAFA 2GAUA 1K79A 3LQQA 3LA3A 4OMZA 2VT3A 1X51A 3OGAA 2QENA 3W6KB 1JGSA 2V9VA 5D5UB 3FM3A 3M9AA 1XD7A 2OQRA 4OU0A 5C8LA 3MQ0A 4YFXF 4V14A 3I58A 1V8LA 5TRDA 1LEBA 1HW5A 2VT2A 2VE9A 1DDNA 1FOKA 4IVNA 3BPVA 2EV0A 4EQQA 5FFXA 1IXCA 1MJBA 3JSOA 3L85A 1J7KA 3F6OA 3ML6A 4YIFA 4A0XA 2XVCA 5E1ZB 2QQBA 1CGPA 2X0LA 3BZ6A 2RVCA 1RRQA 3EXQA 1F3YA 3EETA 4HF0A 5LGTA 1FBQA 3CTAA 4MEXF 3X0NA 2A5YB 4R1HA 4EGZA 2PEXA 2DQRA 2MLGA 2QM3A 2TDXA 1FLIA 3U1DA 4JZSA 5CJ9A 1O57A 1TBXA 2A61A 5GHOA 4IRHA 2PNYA 5GHMA 3R60A 3ZP5A 5A2QZ 5HS8A 2ZBKA 3ZPLA 2RKHA 3D5LA 1GXPA 1G3YA 2GXGA 2H6CA 1JHHA 1G9QA 2HQRA 1K6OA 1ZGAA 5DPKA 1Z05A 1BBYA 1FC3A 4LB5A 4IXAA 5HDNA 1SAXA 3T5XA 4KG4A 2GXBA 5E17F 3K1NA 2F5CA 3Q9SA 5DUIA 1HSJA 1O7FA 3HRUA 2L54A 2R5WA 3B73A 2CFXA 2DSCA 3HSFA 3M8EA 3MCZA 3DPTA 2KIUA 3E6CC 2DU9A 3P9KA 2H27A 2XAHA 1FWZA 3V7RA 4IF4A 3EESA 3G0QA 4MNUA 3L7WA 4Q4ZF 3X0RA 2ELHA 3GWYA 2NNYA 3ZMDA 4R79A 1T6SA 3TO7A 1O3RA 2G74A 1BIAA 2PMUA 5D5WB 3SMDA 4L18B 2W85A 2KIMA 4CO8A 2IA0A 2K4BA 1VHGA 3I7VA 5CVJA 1XB4A 1KQ9A 3WGHA 2PLYA 4LGWA 4HF1A 2Q9PA 4KNYA 4BNCA 2VE8A 4P9FA 5HS7A 3H3ZA 4Q48A 2B0VA 1MDMA 5HDKA 3F3XA 5ILVA 1YG2A 1WWXA 2VNQA 1IN7A 4ILQA 3REOA 3MZHA 3QRFF 4S05A 2VONA 1D8JA 3J81Z 1MQEA 4HBLA 1T38A 5FLXZ 3LAJA 1H9GA 1FT9A 1VC9A 3FXQA 2HGCA 2J5PA 2Y75A 3GZ5A 1U5TB 2FXAA 3PQJA 2JVBA 2H94A 2EFOA 5ANUA 1SU2A 1IXRC 4CZZA 3IRQA 4IJAA 2FQ3A 3F8BA 1BC8C 2RC4A 2OBPA 1MD0A 4M6XA 1U2WA 4B8XA 5FD6A 3DEUA 1J2XA 3ULQB 4NHJA 2ZO4A 2Z3YA 1FYLA 4KYXA 1W5SA 2HTJA 5BS6A 2KDVA 4ESBA 3RKXA 1JXSA 2Y0MA 2A8QA 3T8RA 4L5JA 1B59A 1S7AA 4KA4A 4S04A 5FSOA 2XAQA 4HVYA 2Z9OA 2HZTA 3E6MA 4RGSA 3P5TA 1QGPA 2ETHA 4YFKF 4GYGA 3X0MA 1HSTA 3A6VA 1W4MA 2D1HA 2HKXA 1LDJA 4HOBA 1V4RA 4ON0A 1P4XA 4EVIA 3TQNA 2JSCA 1VIUA 3SHFA 1LNWA 3HIFA 5A2QK 2C6YA 2NNNA 2COMA 3KP4A 5HLIA 1FP2A 1REPC 3JSPA 4GO1A 2XUBA 1ZLKA 2P6TA 4WF2A 4I0AA 1KHZA 1XSDA 1XSCA 3HYIA 5DD4A 4CXFA 5E18F 3K1PA 4OOIA 2VOOA 3G3ZA 5H6QA 1STZA 5E20A 1F5TA 2A8RA 4M9XA 4I01A 3B02A 1LEAA 2K02A 5HZXA 3KZYA 2VOPA 4DNCA 3IC7A 4ZYDA 2O5WA 2CL3A 3WE2A 1XDSA 5IT3A 2XKPA 1OYYA 5FSNA 1SJYA 2EB7A 1IAWA 2OD5A 2YYHA 4M9ZA 3CO6C 1V8YA 4UXNA 5LGUA 2L4AA 1UHWA 4H0EA 1FZPB 3SZTA 4PZJA 2J5OA 2FA5A 1HW1A 2ZJ2A 4Z2YA 2G7UA 5DV5A 5KK1A 1PUSA 1SMTA 3HRTA 3ACAA 1ZHFA 3RKWA 1R00A 2HFHA 5D8LB 2A69F 6PAXA 3HHJA 2FMYA 2ZMEA 2MD5A 2MBFA 4IRGA 3WE3A 2WWYA 4LK1F 1OW2A 3J81K 1IN5A 3L9FA 3T8TA 5FLXK 5ANTA 3GLXA 4EJUA 2GA2A 4LG0A 2G73A 5ILSA 4BQAA 4L9NA 3O2PE 3GVAA 1KYZA 4Q47A 2EFPA 4ZYEA 2Q0OA 4DYWA 3VODA 1B1BA 2ICJA 1R67A 4HAMA 1FBUA 1JE8A 3FXRA 1U20A 2W57A 4U7BA 5CVIA 1BC7C 1D3YA 3X0LA 3ZR1A 3KP5A 4CHUA 4KMFA 4YFNF 2LKPA 1HX3A 3ZMVA 1AWCA 3E6BA 1MQWA 4CYDA 5JR3A 4U7DA 3KP2A 2YX4A 2PI0A 3GW2A 3F8NA 2GWRA 3V7CA 3IKTA 3AC9A 2G9WA 3SONA 3F13A 1R5HA 3R03A 3I5UA 1FBSA 3FMSA 4XBFA 1J59A 4LLNA 2L01A 2ACJA 4HX8A 1SFXA 3QAHA 1WQ2A 4XLPF 3BY6A 1GA7A 1G3SA 2ZNZA 2CSOA 4WWCA 2QZ8A 2GT4A
chains in the Genus database with same CATH superfamily
2LMDA 3R0JA 4HX4A 2WBMA 4G94A 2UWMA 5LPGA 5ICFA 4KDPA 3O52A 3CLQA 3TMOA 1U9NA 4KFCA 2HU9A 4WK8F 2LDUA 3OYJA 3IRRA 3MFKA 1JGGA 3OYAA 2GQQA 1ZGWA 1LQ1A 2CMPA 2UV1A 1MSFC 3S1NJ 3H35A 2M1BA 1LE8A 3P7NA 1XC5A 2ZFUA 5DCFA 2FOKA 2ID3A 1R36A 1Z21A 5F6FA 1FEXA 2IS2A 1V8VA 1KYWA 4D0PA 3DKUA 5JHUA 3K4BA 4CDGA 1ZGJA 3RQ4A 1IRFA 3A02A 4IHVA 3X0KA 1ZYRF 1Q1HA 2PMZN 2R7QA 3PUBA 3JRFA 3K69A 1XSAA 4MQVA 1EH6A 5IT9Z 2WV1A 1A04A 3QYFA 3TDUC 5HS9A 1FY7A 5J8FA 1DP7P 4A3KJ 2CGPA 2EA2A 5DCMA 1VQ4I 3I3LA 5CFIA 3RQIA 4FE4A 1SAUA 4RMNA 3GG6A 5FKNA 3GUDA 2ECBA 1EA3A 1LJ9A 4CGZA 1TT0A 5F1JA 2HKOA 3B6AA 5LBQA 3WTWC 1T95A 5L3CA 2K9LA 1MMNA 5CVRA 5LRRA 3JR9A 1KZHA 3E5UA 5C7TA 1Y56A 1YFHA 2BY1A 1ZARA 1V5FA 1SVMA 3OV8A 1W36D 3S1QJ 3RKQA 4G7ZF 3Q91A 3FMRA 2QLZA 2E1MC 1FOXA 1SZ3A 3O61A 4EGYA 2AXTC 1Y8QB 3LWFA 5LRSA 2D2WA 5FLMJ 1P7IA 4WXHA 2JT1A 2B9SA 1K61A 3DCFA 3BT9A 3WTVC 4CCKA 1H88C 5CPRB 2BY3A 4E7ZA 2M34A 1QRYA 3OYKA 3X0PA 1H9TA 2FVVA 1XS9A 1TL8A 1E0EA 2DOFA 4B44A 2AZWA 2KISA 3EUHC 2LF8A 3KYCB 1WJDA 4ZC3A 1F9NA 2YR2A 2DOAA 4HPQA 5AONA 1G3WA 2Y0SA 1PP8F 2XHKA 4LIVA 4AM3A 3LQRA 3QPSA 3OYIA 2FJ1A 5CFJA 2CW7A 2IXSA 2H8RA 3COAC 1K4TA 1K78A 2QCOA 4XRSA 3HC7A 4FTHA 5E79C 2RV8A 3HRSA 1ETWA 1T39A 3D1NI 1UZCA 3QYBA 3F8MA 3CCRI 1BL0A 1K83J 3I55I 2BE5F 1JJ6C 2RREA 1GHCA 1D0YA 3ZMTA 3L2VA 1HW2A 4FX4A 2KHMA 3E5XA 4O6JA 3BLYA 1R7JA 1SD5A 3FK9A 2M0MA 3N9UA 3L09A 1OCTC 2I5UA 3ZR8X 4QWQA 5H6RA 5FKLA 5J8CA 2IGMA 3E3VA 5ERIA 1IF1A 5ICEA 1IZ1A 3LAPA 1XPXA 2B63J 2ZJQF 1HLVA 5FGMA 3OR2C 4KT5C 3W2VA 2JUCA 1CF7A 2ESHA 2CG4A 3G2BA 1JKQC 2DT6A 3BR1A 1XGMA 1VRLA 1HDPA 4C9YA 3FFUA 1RR7A 1R58A 4ABZA 2NAZA 4PJJA 4A12A 1LPQA 3KP6A 1OCOH 4XRSG 4BHPA 4L0ZB 4ZYHA 1OR7A 4UUVA 2RQPA 5EGOA 2I8UA 2W84A 1V8WA 4S2VA 3QU6A 2ELKA 2W1OA 2VBZA 2WAQN 1U3EM 2V1UA 1BA5A 1PPVA 4RAYA 3Q93A 3SEZA 4A6EA 1ERDA 2IS4A 2MH9A 5LHHA 3AL0C 3DF8A 5FD5A 3CJNA 4JX6A 3ECOA 5EEAA 1E3OC 2DK5A 3RJPA 4M73A 4HDUA 1FIAA 2WV0A 4I76A 2BV6A 2K9MA 4C2UA 1JUPA 4PDKA 4BKXA 1X1AA 3PSIA 1O7LA 2MFZA 2PQVA 3Q3SA 3WHBA 1O3TA 4BEHA 1X19A 1Y0UA 1V3FA 3VYUB 3JAMZ 1GV2A 3ZR0A 2KFDA 1ZN2A 3HSRA 5D4SA 5IOZA 3CJRB 1PYVA 1L3LA 1Q33A 1XN7A 2HQ5A 2LRDA 3HUGA 3F0CA 2DDAA 4ZZLA 1R4MB 2W7NA 3CNGA 5DEQA 5K7FA 3HOWJ 2FUG2 5J1YA 3LA2A 2JPBA 5FKMA 1PPWA 3LMMA 4HDVA 2IS1A 4U0WA 3MZYA 2XSQA 1WJBA 1ZQ3P 1I6XA 4BBSJ 1Z67A 2L9VA 2HXIA 5KNLA 2VUMJ 3CCVI 2LBFA 2K3PA 2XASA 5ISYA 1IRYA 1AU7A 2R7WA 1SD7A 3BOQA 4I0BA 1XCVA 3JRGA 2ZMEB 5EDNA 2NVUB 1S3JA 4FQGA 5CKTA 3VOEA 3FBNB 2BBYA 4MTDA 2M3AA 3H5AA 4IPAA 2FOWA 1ZK8A 3E6DA 3IHUA 1ZR2A 2CQ7A 4PUSA 4HNVA 3BP8A 3JRHA 4JK1X 1MP2A 3RPUA 1S6LA 2RN7A 4LFUA 2D5VA 2KZVA 4LG0B 2EA4A 1DQUA 2LOOA 5IT9K 3DQVC 4PCQA 3BG6A 4U0VA 1IN6A 2AXLA 1YJWI 3DTEA 3GCMA 1TP4A 3AG3H 5L3FA 1SC7A 1WJ5A 2UXNA 5B5EC 3L2QA 2GT2A 1ON2A 2QYOA 3RKYA 4EJVA 1Z9CA 1RYAA 4A5NA 4HQEA 1MJ9A 1TWAJ 2F5DA 1W7PA 3GZNB 3QODA 1S29A 1Z6RA 2HDCA 5KVRA 3WHWA 2CUJA 4UV8A 3R61A 2BEOA 1VQ8I 4C2MJ 3CC2I 2DFFA 5DM7F 1SFEA 3BQZA 5IP7J 2Z2SB 4UVAA 4OIQF 3JW4A 3K2AA 4HYEA 5JVTA 5D8KB 3F9KA 4BYYA 3AKZA 3AG2H 4AIDA 2XSJC 2FQ4A 2HR3A 1A35A 4DBQA 4ENNA 5EF6A 2VJJA 3FBIB 1KA8A 1ZKGA 2DXIA 1X1DA 1A6QA 2HQAA 4XOPA 4P96A 4MTEA 2OQGA 4PJMA 1BI0A 2LP0A 5DUKA 3M1CA 5J4YA 3TOBA 2E7WA 2LC2A 4AUXA 3HJEA 4BL0B 2L7FP 4NFXA 4F52A 1IO2A 1OYWA 4HG2A 1RZ4A 1FSHA 2OAZA 3ASOH 1NH3A 4C30A 2IRFG 1S5LC 3CDHA 3EDPA 5JLWA 2F4MB 1R5ID 2ZXHA 1RETA 5BOXA 1TWFJ 2DJNA 4S0HB 4DOZA 3ISPA 5TGTA 1PUQA 2P5LC 1S8NA 1B8IB 4W1UA 2YUSA 4P55A 4DZPA 4XORA 2Y31A 5FO5A 1RI7A 3GEZA 3E1SA 4WX9A 4GFBA 1YW7A 4O5VA 3F23A 1K7AA 5GAHJ 1MBHA 3KX2A 4M6YA 1X1BA 2FBHA 2H6BA 1KQ0A 5HNHA 3ERED 2HOEA 1GVJA 2M4GA 1N77A 3K7AJ 2VODA 2OC6A 1ETYA 3S2WA 3VFZA 1R1VA 3CUQC 4UV9A 5BONA 2HPIA 3L00A 3OMYA 1UG0A 3BHOA 2AS5F 3BR3A 4ITVA 2PG4A 4AIHA 3L2CA 1ODDA 4MPOA 2MC3A 2KIFA 5L3DA 2O0YA 5D4RA 1C0WA 1MIJA 3VYTB 3IV5A 2EBIA 2V1XA 1MR2A 1VK6A 4RAFA 1E17A 3VDXA 4A3JJ 2FMLA 5D6FA 1RPWA 3BG5A 2JUGA 1NG6A 3CP2A 1LE8B 1HKTA 2FU4A 5M5YJ 3HTSB 5ANWA 1E2XA 2VBYA 3Q1PA 3MDGA 4EV0A 3WGIA 2YVOA 2Y9ZA 2DHOA 3PL8A 2O7OA 3CDLA 5LEJA 2A8TA 3JRCA 1X4OA 1G4DA 1BIBA 1WJFA 2HOTA 3IWZA 5J1RA 5IP9J 5BNGA 1P4WA 3FF5A 3V8LA 5FRMA 2FKBA 4LMYA 4GDFA 3KP3A 3A0BC 1K4SA 2CV1A 2P7CB 1B4AA 4IJXA 1FJLA 2DQLA 3QPLA 4DJAA 5DCMB 3V4GA 2IEKA 5D5VB 4QPQA 4RDUA 1SD6A 4NB5A 3KP7A 1I27A 5F08A 1BOAA 1G0SA 2P81A 3MGMA 1T0FA 2JRTA 4Y13A 1G6NA 2FNAA 1RIOH 3ASNH 2NS0A 1S7EA 2Z33A 1JTYA 3I7UA 2ZNYA 1QZEA 5EEGA 3J7YJ 1GVDA 3H3UA 1OMIA 4BU2A 5J4VA 3EYIA 1MMGA 2CUZA 1UELB 4M6VA 5EEHA 3WG7H 2DMPA 2IJLA 3QOEA 3KEYA 4D7MA 3UR3C 3JAMK 1YW9A 2LR8A 2A5WA 3QWLA 4YOQA 1Z77A 3DEEA 3EQLF 3GTPJ 2K40A 1T08B 1IUYA 2E36A 4MGRA 1G3TA 2OTLI 3K4NA 2GM4A 3V8KA 1JRKA 2DA1A 2ESNA 1HCRA 5FB2A 3CD6I 5BPIA 1ZG3A 5EG0A 5K5RA 3RH7A 3ZMUA 4LLGF 1SOIA 1QPMA 4UUSA 2WAQA 2VKVA 1FP1D 1KU9A 1D0ZA 3M7GA 3SXYA 3PQKA 1XMKA 3T1BA 4QLCU 4A69C 2DMTA 1SFKA 3PM1A 5F0HA 3RYPA 1D1AA 2B0LA 4EJTA 1XMXA 4HQMA 1Y6IA 1UB9A 2DA7A 3OS2A 1I1GA 1K78B 3DBRB 2XF7A 3J7AO 4PGHA 2R7UA 1H89C 2DMQA 1T8IA 5HLGA 1TWCJ 2CQKA 4YEJA 1HBXG 5M5XJ 2BGCA 2JVHA 1VHZA 2FE3A 1BR2A 1YO5C 3CCJI 5DYMA 3GX4X 4JX4A 2EV6A 2EFNA 4ASNA 4G6DA 1JI8A 2VLAA 3SFIA 2YVMA 1Z1DA 4KIFA 3K70C 1ONVA 4UNOA 1MMAA 1UHMA 2ISZA 4PJ0C 2R7FA 1EH8A 3H9QA 2OV7A 4N9IA 1VCDA 3TW7A 3MWMA 2M30A 3C18A 4AIJA 1R5GA 1CF7B 5FSIA 1OJLA 1BI2A 4KTBA 2F4IA 2LYCA 1O4XA 4M71A 4Y17A 2ZXIA 5K5QA 1PUFA 2F5VA 5F64A 3KYLA 1ETVA 1IRGA 2WY8Q 1TW2A 2ZCWA 1MNDA 3DLLF 2A8PA 5FSMA 2ZSHB 2M5WA 1MGTA 3GYHX 3C1DA 3DFGA 3H9GA 2XSDC 3FIWA 2YVNA 5EGOB 1F43A 1Y39A 3M8JA 2EFWA 4J01A 2IT0A 4AU7A 3BCAA 1SMYF 4A5MA 2OTJI 5DDGA 4F91B 4EJWA 3LA7A 3SFZA 1MJAA 3Q0VA 1T98A 4C2TA 4OIPF 3GWZA 4L9VA 1J09A 1ON1A 4B47A 1LUJB 2E35A 3EUHA 1QO0D 2P4WA 2AQFA 2OCCH 3DKYA 3MKWB 3OSFA 3V7SA 2JA6J 2PQ8A 2JN6A 2KPMA 3MKLA 4OINF 4LK0F 1PUNA 4B1RA 2Y69H 1TQPA 3F6VA 1DP3A 4X1EA 5IYBJ 4E70A 4Y7NJ 3DXJF 4PSWA 3OYEA 1W5TA 1FOWA 4N1UA 4N1TA 1ZG1A 2CQNA 2L0KA 2LH9A 4BEHB 1N75A 3QU3A 1IG7A 1YX3A 1IN4A 4XNFA 2O8KA 3NWSA 2KP6A 1T2KA 2BVLA 2GOXB 2M8EA 4N9HA 1YI2I 1MKMA 4L9TA 4NNJA 4TV7A 5LEKA 3HUGB 2KJCA 4BQNA 2KLOA 1PUEE 3FXUA 1IXSB 2V1DA 3S16J 1X58A 1IV8A 3WU2C 1VNDA 2ZKZA 2JA5J 5AIPA 1TNTA 4P5OA 2J8QA 1TTYA 2ZFWA 1J9IA 4IOAF 4I09A 4RAZA 4IHTA 2VBWA 1NFSA 5ILUA 2R7XA 3LSTA 3LL7A 4MHGA 2A68F 3S93A 1A5JA 1BN5A 4AIKA 4M9SA 4CICA 2VQGA 4BXFA 1Y1WJ 3MN2A 4J00A 3HKZA 5C4JJ 5CLSA 4E7LA 2I6KA 1RKWA 2EWNA 3W2AA 1NK2P 3MCFA 3SDGA 4HF2A 2CV0A 2JPCA 4P1WA 3NARA 2HQNA 3MAJA 1WSUA 1SANA 3ID9A 1XGNA 1USTA 2DYSH 2EZHA 3LSPA 2Y48A 1TW3A 1S9HA 2KKOA 1AA7A 3E7LA 3PSFA 4WXCA 3NWTA 1W0UA 2W25A 4IL6C 1TZLA 3SJMA 3X0QA 3D0SA 3GZ6A 1U6GA 3CUOA 2P7VB 3I71A 3MKYB 4G6QA 2I10A 4V2GA 3OIQA 3K1MA 4A3DJ 1B9NA 3FMQA 3M1EA 3PFIA 4A3MJ 1W7PB 4AVPA 1QVTA 3FK6A 2MG4A 5LLQA 4RBOA 4CSWA 1NFZA 4Y3OA 4CCNA 4CCOA 5L3EA 3N4MA 2D45A 2EIMH 5GTIC 1ZLJA 2XGXA 2QUFA 1TUMA 2JMWA 1T33A 3RPQA 3HHGA 4IKFA 4P9UA 1WH5A 4A0ZA 3S3MA 4XSXF 2X51A 4K6EA 4IZZA 3F21A 2DPUA 2DA5A 3A6SA 1TLHB 3PIOF 3DEWA 4ETSA 4ESFA 3IP4B 4WWCA 4C9XA 2XV4S 2YPRA 1A36A 2QA4I 3ZMSA 3OOPA 1L0OC 4F55A 5GAGJ 1MMDA 2EIJH 2FF4A 1O3QA 1I1SA 3KEQA 4RGXA 4YIIA 3WTZA 4BY1J 1MH4A 3NQOA 1N25A 5EYRA 4ENMA 4OMYA 1IW7F 2GZWA 3RZOJ 4AYBN 2PBIA 3FM5A 5CVUA 1V8MA 2O03A 3LSIA 2X6YA 4HLXA 3FZVA 3S2HJ 2IW5A 3WTXC 2LSOA 2LLKA 3EUAA 1DUXC 3A2KA 2M45A 2Y2ZA 1QNTA 1P6RA 3RIRA 3RPUD 5JFRA 4ENKA 1K2EA 2CH0A 3KCCA 1QQIA 1R1UA 3RI4A 4E7KA 3KEOA 4OWRB 1MBEA 5LHGA 4XKVA 3MD2A 2VL8A 2XKOA 1R71A 3BDDA 1AKHA 2E7XA 5ICCA 4ZYGA 1Z7UA 3KETA 5HDGA 4M3BA 1YRNA 4ZG0A 2M2EA 3FJYA 3ERMA 1XG1A 1W7PD 2LTPA 1JTXA 1UJ8A 3CESA 1YYVA 4IHXA 2V7FA 1PVFA 2B06A 4F92B 2CW0F 4U0YA 3ZQLA 2MH2A 3QPHA 5HLHA 2KMUA 3BQYA 4LJZF 4B43A 4FE7A 2QKMB 4JZUA 3AFHA 3Q2SA 4O3MA 1TQMA 2RGVA 3SHDA 2KDWA 4DQ2A 3K6GA 3MEXA 3E97A 2N8GA 1U9OA 3Q0UA 5LFAA 2DLLA 1ZAOA 2O3FA 2VBXA 2BZTA 3JTHA 2F6CA 2ME0A 2R7TA 1MBKA 1OPCA 1V8IA 3ABUA 5K1YA 2E1NA 2CYYA 3TBIA 2HWVA 2IGKA 2EV5A 3H3VK 2STWA 2NVTJ 4E7SA 2L02A 2TCTA 3K4JA 3ECHA 1KGSA 1RESA 2IS6A 2NOGA 4RB2C 4BE0A 3TGNA 2ISYA 1KTGA 1D8KA 2A05A 3Q9VA 3SQNA 2HNHA 1ETXA 2Z5UA 2DN0A 3R4KA 3CMAI 3FKIJ 3KFWX 5LHIA 4YRVA 1D5VA 2P6SA 3MZ8A 3C3WA 4BXUA 2XPUA 1G2HA 1B6AA 5TISC 3HGYA 3S8PA 2LG4A 1YIJI 2Z16A 3E57A 5ANVA 2M8GX 3KZZA 2IA2A 3WGGA 4DBRA 2VNPA 4KIBA 2O6GE 2IP2A 2GOMA 1QVUA 1Q1VA 3R0AA 4N4NB 1N78A 2JRMA 1R23A 2M87A 2VC1A 4PJNA 2A8SA 3QSJA 1BM9A 2HOAA 2L2OA 5BPDA 4I2OA 4XSZF 1A6IA 2DW4A 4PFPA 2XRLA 2DCEA 4ZJZA 3GFJA 1QZZA 5DS9A 3J7AY 3CCYA 1R49A 3QQAA 3PNTA 2ICWG 5EG0B 4XRFA 1TQIA 4BE1A 2DOEA 3CUQA 4EMSA 5IW4A 4UUSB 1YITI 4B3AA 2BYVE 3OSGA 2R7RA 2QEXI 2VPRA 1QU3A 2OZUA 3CCUI 3S1MJ 1D1BA 3I64A 1U5TC 1JKOC 3FHZA 2O5FA 2HXOA 3OOUA 3BWGA 1RKTA 2R4GA 3U1KA 2DMUA 2XB5A 3H9JA 1FNNA 2A3SA 2XGEA 1OQYA 4BAYA 5L3BA 3S14J 4RA2A 3IKVA 5HVQC 2IBDA 2DTRA 1LDDA 4D5CA 4E6KG 4E7HA 2KT0A 3Q5FA 1HC8A 3BAPA 2L9SA 3KYDB 1WZ2A 1P4AA 2EZIA 1IN8A 4K2EA 3GTKJ 2IGNA 2LY1A 3G73A 3DU5A 3CC4I 2HDWA 1SVLA 3BTLA 1ZELA 1MNEA 4IO9F 2Q2EA 4BACA 3FK7A 1V8UA 3I59B 3DKWA 3IL2A 4OIRF 1VC8A 2CQXA 4HNUA 4PFOA 1ITYA 3DUPA 1WRJA 1HDDC 4M3EA 1GXQA 2H1KA 2OCEA 5E3MA 1I9AA 2FEZA 3C2GA 3VEPA 1VIQA 2DBBA 1ORKA 4H4KC 3JRAA 1X3WB 1ZRDA 3CP8A 4OIOF 3CMMA 2WC2A 2XB0X 3P9CA 4QSHA 1R22A 5M5WJ 1FYKA 4PGGA 3HOTA 4ZZDA 2MA3A 4IQ4A 2LVSA 2MLKA 3P9IA 1OLTA 3R6SA 1YTYA 1PUFB 3HM5A 3BR0A 1LB2A 1J75A 3SZPA 3HPGA 3O69A 4J7HA 3GFMA 1D1CA 2XIGA 3WODF 1UAAA 4EM0B 1X1CA 5E1WA 2LNBA 1NK3P 2QJOA 2M9HA 5TJJA 2GXAA 3CJQB 3CCSI 4C9WA 2E1MB 1OYIA 2Z99A 3TOAA 1U8RA 3DU6A 2OU2A 4YG2F 3CJTB 3ZQHA 1F4KA 2DT7B 3T0YA 3HOYJ 1EF4A 1EH7A 3X0IA 3W6JB 2YVPA 1H8AC 2BHYA 4F3QA 1GUUA 1HZTA 2FBIA 3I0TA 5D6EA 1IJWC 1X3UA 3WTUC 5GHIA 1SD4A 2OA4A 3VB2A 4RB3C 3HYQA 3BG7A 2VKDA 1X84A 3HOVJ 4L5IA 1PJRA 5E8GA 4EJOA 1HKSA 1WVRA 1SFUA 1WI9A 2EJRA 3LSRA 1LVKA 4IHSA 5H20A 2DFIA 2M7AA 4WCGA 2DMNA 1V8TA 3DBLB 3MKZA 3P6YA 1Z7LA 2K86A 2VN2A 5GPAA 3L2WA 2MGQA 3V8JA 1IV6A 1WJEA 1RUOA 3U53A 4AC0A 3C2BA 1OFCX 2H1LA 3RDIA 3LFKA 3IWFA 4KICA 4BDZA 3F8CA 1CQTA 4UVBA 3H95A 3G1OA 1NHAA 3I9XA 4A93J 3S1RJ 3GF2A 4S2YA 3PFYA 4EATA 4XLCA 3WTSC 4NDLA 3F22A 2PJRA 3S15J 1FMWA 2ICKA 1XTAA 1KT9A 3BPXA 4XKCA 1V8NA 2NOJB 3EPZA 4RM3A 3TDZC 4EEFG 4GXOA 1BI3A 5FSLA 2KRCA 1TC3C 3CCMI 3BJOA 1IRXA 2VJ4A 4GYIA 2XRNA 2QSHX 3CMEI 3HB9A 2PMZA 2E19A 2GA1A 1QBJA 3BZCA 3FXJA 2RAEA 1XSBA 1G59A 4RGRA 1NG7A 2X6OA 4A0YA 5J6XA 3GTMJ 4XMYA 3HOXJ 3ROUA 5M3MJ 3GRNA 3FXKA 2JK3A 1UMQA 3J80Z 4IHWA 4XKBA 4G9YA 2EZLA 4JZTA 4B4CA 2OUMA 2L4MA 4KIGA 5C7QA 1I5ZA 2VJIA 2CV2A 3O6ZA 1OCZH 4KJZA 5HODA 1QA6A 1P2FA 3ELKA 3VYSB 1YE9A 4JYKA 1XDUA 2EZKA 3GO5A 1K6YA 4BUPA 4R8HA 1JKNA 1QVJA 4D5FA 3X0OA 2YU3A 1U78A 3KLOA 4BDYA 1I6HJ 5L3GA 4XICA 2L3DA 2OZ6A 3E0JB 3AL0B 5C3EJ 4GGGA 4NFWA 1JT6A 3HZJA 4NQWA 1Z6TA 5JI6A 1ZH5A 3ONQA 2QQ9A 2E71A 5ED4A 1LFPA 2ADUA 2GIVA 2Q8KA 1O3SA 5I8UA 2MC4A 3U9GA 1Q54A 4M3FA 1APLC 4II2A 1AOYA 2VKHA 3EEUA 2O1CA 2F5FA 4Y4RA 3GFIA 4BH9A 2A07F 2STTA 2ID6A 3HL2A 2DA3A 3CF2A 1KQ8A 2DUKA 2XGCA 1RRSA 2X4HA 1XGOA 1ZR4A 2WB1N 3TO6A 3KLNA 3HTUA 2EIKH 1XCBA 4I02A 1MNMC 1ZREA 3FXLA 3F6AA 2A6EF 3FISA 5FSKA 3I54A 1HXDA 4F7ZA 4MQ9F 2DI3A 4PK4A 4L9JA 5ANSA 4UHTA 1MK1A 2X6WA 2UXXA 3A0HC 1ZRCA 3Q2TA 2M4KA 1RNLA 3I4PA 1LVAA 1WKMA 5GHPA 5J40A 3ZN0A 2B7EA 2D1VA 2R5YA 3FX3A 2EINH 2WADA 5K5OA 1ETOA 2L7MP 2DSDA 3U2RA 2FBKA 3TP3A 4WXDA 1J5YA 1RR8C 1K26A 1RRJA 1UCRA 1AKHB 4DW6A 3J7Ye 1AHDP 1PVEA 1P7JA 4LITA 4NUBA 1YRNB 2PMHA 1WH7A 4ZH4F 2F2EA 3G6EI 3GBGA 4XLNF 3BC8A 2HVRA 2E2HJ 2XAJA 2W4EA 4I99C 4E7JA 3W2WA 2RRKA 2NS7A 5EZHA 3HRMA 4G6TB 3JRIA 1RUNA 2CU7A 2QBYB 2O61A 4GCVA 3DLAA 2X85A 2K7LA 2ZXJA 4M72A 3ZQIA 3VSKA 2XC7A 4S2WA 2DT5A 4A2UA 3FCMA 5CQEA 3CLOA 3N97A 2ME6A 3N05A 2W24A 2YS9A 1EJ9A 3OYFA 1XGSA 3ABTA 1KU7A 1PPXA 3QYEA 1YW8A 2BXYA 3LSMA 5IP6A 3C2HA 1QZYA 2ZSIB 1VFCA 3O3KA 2PJPA 2HYFA 4FX0A 3U21A 2KDZA 2O9LA 4A6DA 4Y15A 1MUTA 4GRIA 3ZQGA 3E5QA 3QOPA 9ANTA 5CYVA 2E2IJ 4JQFA 4JBAA 4CYCA 1YQAA 4LD5A 2DSBA 4EM1A 1B9MA 2UZKA 1YS7A 3BTIA 4FT8A 1PDNC 3QPTA 4XN3A 3HGGA 3OL3A 2DJIA 2VQLA 4CA0A 3LSKA 4IRIA 1DPRA 1YJ9I 3FHNA 2X1CA 5FFZA 3HOSA 3HG9A 5CVVA 3BG9A 3KZIC 1Z91A 2EPFA 2Y0SN 1KONA 3J7ZI 3I59A 2NYXA 3CF5F 3A6UA 4EM2A 2KIQA 4HW0A 2DK8A 1W36C 3X0JA 1LFBA 4RS8A 5LD2C 1KU2A 3BJ6A 2JA8J 2QSGX 1LDKB 2V26A 3JTGA 2JA2A 2RNJA 1HKQA 5F1RA 2W48A 1FPQA 1P92A 4RLFA 2HTSA 3QP5A 2FRHA 3WU0A 4XQFA 4ICKA 4YPRA 1I39A 1R6RA 3DPLC 4ENJA 4JZVA 2E1OA 3JRDA 4FCYA 2HEOA 3CC7I 5IW5A 1QHGA 1EV7A 3RTRA 4BQOA 1S72I 3PNVA 4MO7A 3TW6A 1VQ5I 1GT0C 4HRIA 4I98B 3OS0A 2YX7A 4KUMA 4UVCA 5GP9A 5GHQA 1F1ZA 2QSFX 3CUQB 4QTRA 2DAOA 2LF7A 1WI3A 2XAGA 3K4CA 2E1CA 3BJAA 2BXZA 1GV5A 3RZDJ 1NQZA 1SFOJ 3K9TA 2IVMA 3PJRA 3ZQCA 1R1TA 2IA1A 1NQYA 2QF7A 2QVOA 1UFMA 5F0CA 3FSPA 2B2KA 2PN6A 2M0CA 3K4LA 1OKRA 2LKSA 3GZ8A 1XMAA 3J80K 2CRGA 3BM4A 1XSXA 1ZG5A 3HEFA 1YS6A 3IH3A 3G1LA 1OISA 4LLLA 1VQNI 3SZGA 2KRFA 4RB1A 1U8BA 2FSWA 1USSA 2QJTA 3O8SA 4N4OB 3OYHA 3X0SA 2QQAA 2Q2EB 1V55H 4HV5A 3A6TA 4FETA 4U88A 4C3HJ 2A6HF 3WTYC 4A3LJ 3L2RA 3CDIA 3NRVA 4BHCA 3DTIA 2X1DA 1XSVA 4G7HF 5HOOA 3ESWB 1X83A 4W97A 2EK5A 3ZN1A 5K7ZA 2GLOA 3EF5A 3BROA 4XLHA 4S2XA 2R3SA 4BJ5C 4HFQA 3NEUA 2NXNB 2R7DA 3EYYA 5GHJA 2G7HA 2DTZA 1JJ8C 1FX7A 3I4MJ 1BJZA 1Z3YA 4MIMA 3O8GA 4HNTA 3WG9A 2V9KA 2JWTA 4G7OF 4XN0A 5BMZA 1YX5A 2IPQX 5E8IA 1YIOA 3KPHA 3OYCA 5AIQA 1R9TJ 2DFEA 4U87A 4KN7X 4AWXB 2HI3A 4MEYF 4KG3A 2FNPA 2CQQA 4UUTA 3MDIA 1Y0NA 2AHQA 4LB6B 1ZRFA 3A01A 3H92A 4IX7A 3TEDA 1DU0A 1V8RA 4NC6A 2L7KA 3DP7A 2BOLA 2K4JA 2P5KA 2RQQA 2HS5A 3B6CA 3SYTA 3GTGJ 2XAFA 4B09A 1VZ0A 3CO7C 1HQCA 5LGNA 3LSJA 2K9QA 3HXLA 3WTTC 3HHHA 1UHSA 3M8FA 4BHBA 1FSEA 4IEJA 2PFBA 2H09A 2GIZA 4HSTA 1U5TA 3IH2A 4Q5SF 1WJCA 2YSRA 2PX9A 2V6CA 2K9SA 2MW8A 3AG4H 4XOTA 2DPDA 4BBRJ 4XLEA 2R93J 2F5EA 2WAFA 2GBYA 2HPMA 4F93B 1BJAA 5IPAA 4UY8I 3HSEA 3GXOA 4FHTA 2VC0A 3VSLA 3GFLA 3O8HA 5GAEJ 1FTTA 3ZGKA 1BOBA 1VTNC 1X4PA 2X48A 3K2ZA 3OIOA 3VYRB 1TWGJ 4CH7A 1FOYA 3GTJJ 4DIQA 1Z0XA 2JTVA 1DU6A 2JZYA 2OJED 4LOCA 2PJRB 2CO5A 1KU3A 3MVPA 2P8TA 4G8XA 4HLYA 1TT5B 2ZC2A 2BY0A 3HPHA 4JX5A 4NBQA 1V8SA 3KE2A 1EKEA 2NRAC 3O6BB 2K9NA 5IYCJ 2VXZA 2WB1A 1JHFA 4HSRA 2RNGA 1PP7U 1TNSA 5B1AH 4V19K 2CWEA 1MZBA 4MFEA 2QWWA 5B3SH 4L0YB 2DO7A 4HV6A 3F72A 4AD9A 2XROA 2I8TA 2GB5A 1MDMB 4KYWA 3DV8A 3TKYA 5ICGA 3OYNA 3N77A 1Q27A 2XF6A 3BTCA 4BS9A 3PO2J 1TWHJ 3K0LA 4J19A 3GTLJ 2NS8A 4N0BA 3ZQ7A 3IUOA 3CMYA 2V79A 5BQTA 4OAZA 4RGUA 3F8FA 1BI1A 3DPUA 2OPTA 2R7VA 2O8XA 2AQEA 2ELJA 4RM2A 5FJ8J 1S7OA 3TO9A 5HNFA 2EFQA 3QP6A 2HZDA 4FISA 4YPHA 3DWLE 1Y8RB 4D7NA 5GHNA 2XPVA 4ANJA 4B3XA 4NC7A 3BCBA 1VQ9I 2P5VA 3DBHB 1BR1A 5D5XB 4HX7A 2K27A 2Z1DA 1ULYA 4NQWB 3WU1B 1HA8A 3ZMZA 3D5SC 4JOMA 1VQOI 2VXDA 2ECCA 3COUA 2RDPA 5KAFC 1YLFA 4M74A 2QBYA 3I53A 4I7HA 4X0GA 1HOMA 3C7JA 3RYRA 2VQCA 4KMUX 1DPUA 3IAS2 5DD8A 3L2UA 1I3AA 4LG3A 3Q4IA 4DYCA 3A1YA 3OYDA 3K70D 2WTEA 2ZMEC 3V42A 2W4SA 2W82A 1FYMA 5E1XA 2EILH 4HA8A 4RB0A 2MSYA 3K4KA 4HZFA 1Z3XA 3KVHA 1V54H 1JUSA 2KJBA 3HDDA 2HYGD 1X3ZB 4KN4X 3FWEA 3WHCA 1MH3A 1MSEC 1H0MA 3BTJA 4IHYA 1J0RA 4ESJA 3AAFA 2GAUA 1K79A 3I4NJ 3M4OJ 3LQQA 3P5JA 5J47A 2CUFA 3LA3A 4OMZA 2VT3A 2R5YB 2MABA 5E3LA 1IGNA 1X51A 3OGAA 2QENA 3W6KB 2KL4A 2HDDA 1JGSA 1G8XA 2QQ8A 2V9VA 4XLAA 5D5UB 3FM3A 3M9AA 1XD7A 4E4HA 4IQJA 2OQRA 2R5ZA 4OU0A 5C8LA 3I56I 2HVQA 3W3CA 3MQ0A 5FRNA 4YFXF 1GLNA 4V14A 3I58A 1V8LA 5TRDA 2K85A 1LEBA 1HW5A 2VT2A 2QKLB 2VE9A 1DDNA 3OR1C 4IVNA 1FOKA 5M3FJ 2CS3A 3BPVA 2JQ7A 2EV0A 4KT6A 2KQRA 4EQQA 5FFXA 1IXCA 1MJBA 1ETKA 2E34A 3JSOA 4DZJA 3M3YJ 3L85A 3AG1H 1J7KA 1YHQI 3F6OA 2NVXJ 2JJ7A 2IAIA 2OF7A 3ML6A 4YIFA 3OYGA 3DKXA 4A0XA 3LNQA 2XVCA 5E1ZB 2FX0A 4A3EJ 2QQBA 5FKOA 1CGPA 1X1PA 1P9QC 4UB8C 2X0LA 3BZ6A 2RVCA 2V6EA 1RRQA 2VASA 3EXQA 1I50J 3EETA 1F3YA 3OYMA 4CYCB 4HF0A 5LGTA 1FBQA 3CTAA 5JVGF 5EJCA 2K5CA 4MEXF 2MYSA 3X0NA 2A5YB 4R1HA 2LY9A 2PEXA 4EGZA 2DQRA 2MLGA 4B48A 2QM3A 2TDXA 5J3LA 1FLIA 3U1DA 4JZSA 5CJ9A 1O57A 5E3OA 1SEUA 1TBXA 1E3HA 1VI0A 2A61A 2M7BA 5GHOA 3S3NA 4IRHA 2BW3A 2PNYA 5GHMA 3R60A 3ZP5A 2VPLA 5A2QZ 5HS8A 2ZBKA 3ZPLA 2ZXWH 1D5YA 2RKHA 3D5LA 1GXPA 4E7IA 1G3YA 2GXGA 2H6CA 1JHHA 3HBLA 4QPOA 3ZOBA 3D5RC 3JRBA 4UB6C 1G9QA 2HQRA 1K6OA 1ZGAA 4A3IJ 1F36A 4D1QA 3G1MA 5DPKA 1Z05A 1BBYA 1FC3A 4LB5A 4IXAA 2ZJRF 5HDNA 1SAXA 3T5XA 4KG4A 3CCQI 2GXBA 5E17F 2DA6A 4PJLA 5HLTA 3K1NA 2F5CA 3Q9SA 5DUIA 4CZCA 2KZGA 3OIPA 1HSJA 1V5GA 1O7FA 3HRUA 2L54A 3LFUA 3OWTA 2V9PA 4CCJA 4BJ6C 3DTKA 2R5WA 3JCUC 3B73A 2CFXA 3OS1A 3HSFA 3M8EA 5F27A 2DSCA 1B72A 3MCZA 3OYBA 4ZDLA 1YOVB 3DPTA 1HF0A 2KIUA 3E6CC 3JREA 2K3FA 2DU9A 2ZJPF 3P9KA 4AVZA 3W6VA 2H27A 2G0EA 2XAHA 3PIPF 1FWZA 1VQ6I 3V7RA 5GPCA 4IF4A 3EESA 3G0QA 4MNUA 2LFBA 3L7WA 4Q4ZF 3X0RA 2ELHA 3GWYA 2NNYA 1IUFA 3S2DJ 2R7ZJ 3ZMDA 4R79A 1T6SA 3TO7A 1O3RA 4RAGA 2G74A 1BIAA 2PMUA 5D5WB 1MMSA 3SMDA 2QGUA 4L18B 4A3BJ 2W85A 2KIMA 2XGDA 4CO8A 2CFOA 1OCCH 4CCLA 4BXXJ 2IA0A 2XF5A 3EUKL 4ZTJA 2CZRA 2K4BA 1WPKA 1VHGA 3I7VA 5CVJA 1XB4A 1KQ9A 3GTQJ 3WGHA 2PLYA 4LGWA 1RC9A 4HF1A 2Q9PA 2WA0A 4KNYA 4BNCA 2V1NA 2VE8A 3HOUJ 4ZYAA 4P9FA 5HS7A 2R7OA 1MBFA 3H3ZA 4Q48A 4DYQA 4AYBA 5C4XJ 4PSXA 2B0VA 1MDMA 5HDKA 2YU9J 3F3XA 3ZCOA 2DA2A 5ILVA 3H5RA 5F0FA 1YG2A 1WWXA 2XPWA 2VNQA 2KDOA 3X2QH 1IN7A 4XR6A 4J7GA 3A01B 1W1WE 4ILQA 3REOA 3ABLH 1BW6A 3MZHA 1MW7A 1OCPA 1VF9A 4S05A 3QRFF 2VONA 2NVQJ 4JP0A 4A3GJ 1D8JA 3J81Z 1IRZA 1MQEA 2Y9YA 4HBLA 2R0QC 1T38A 4M3DA 5FLXZ 3LAJA 1H9GA 3PUFA 4XLFA 1GDTA 1FT9A 5JLXA 2O5RA 1VQKI 2JVGA 4Y33A 2Q1ZB 3FXQA 4IOCF 1VC9A 2HGCA 2J5PA 2Y75A 3GZ5A 2BY2A 1U5TB 1MBGA 2FXAA 3PQJA 5E3NA 2JVBA 2H94A 2EFOA 1QHHD 3BR6A 3HKZN 2FD5A 5ANUA 1SU2A 2X9DA 1IXRC 4CZZA 3IRQA 4ZDPA 3H36A 4IJAA 2VJ5A 2FQ3A 3F8BA 1BC8C 2RC4A 3VWBA 2OBPA 1MD0A 4M6XA 1U2WA 4B8XA 4BE2A 5FD6A 3DEUA 2VI6A 1J2XA 1NTCA 1Y1VJ 2CUEA 3ULQB 4NHJA 2ZO4A 2HVSA 3ZQQA 2Z3YA 1FYLA 4KYXA 3FKJA 1W5SA 3IAM2 2HTJA 5BS6A 1OCRH 2KDVA 4ESBA 2AO9A 1OR7C 5F04A 3RKXA 2E5ZA 2L5QA 2CJJA 1JXSA 1WHUA 2Y0MA 3ABKH 3TP0A 2A8QA 3T8RA 3L1PA 4L5JA 1B59A 1S7AA 3OL4A 3BG3A 1JKPC 1IDZA 4KA4A 4YELA 4S04A 2XAQA 5FSOA 4CUGA 3HOZJ 5H2FC 2NVYJ 3ZQFA 2E2JJ 4HVYA 4V2FA 2Z9OA 1I3QJ 2HZTA 2VIXA 3BZKA 4QIWN 1X2NA 3E6MA 4RGSA 1POGA 3P5TA 3H1CA 5EZGA 1LKXA 1QGPA 2DDBA 1U0JA 2ETHA 4YFKF 4L5EA 2LY2A 3FXMA 4BY7J 2F4OB 3CQZJ 4GYGA 4DYRA 3X0MA 1BR4A 1X2MA 3G4SI 1HSTA 3A6VA 2VKEA 1W4MA 4Z6YA 4A3FJ 2D1HA 1IDYA 2DODA 3SEQA 2HKXA 1LDJA 1VQMI 2IGOA 3PNYA 4HOBA 1V4RA 4XKWA 1VQPI 4ON0A 1P4XA 4EVIA 3TQNA 3TL4X 2WY7Q 2JSCA 1ACIA 1VIUA 2EQRA 1VQLI 3SHFA 1LNWA 3HIFA 5A2QK 2C6YA 3PO3J 3H0GJ 2NNNA 2COMA 3KP4A 1JUMA 5HLIA 1JKRC 1UG2A 3GTOJ 4DGWB 4G12A 1FP2A 1REPC 3JSPA 4GO1A 2XUBA 1ZLKA 3M07A 2P6TA 4WF2A 4I0AA 1KHZA 3K4MA 1VQ7I 5DTDA 1XSDA 3VPRA 4KITB 1ENHA 1XSCA 3HYIA 5DD4A 3S32A 4CXFA 1WJAA 3LOCA 5E18F 2LK2A 5FLVA 3I9V2 3K1PA 5C44J 3RSNA 2V4JC 4BGDA 3OY9A 3UNGC 3GLLA 2E5NA 4OOIA 3G3ZA 5H6QA 1STZA 4XK4A 5E20A 3RCOA 1F5TA 2VOOA 2A8RA 4M9XA 4ZDOA 4Y52J 2COBA 3K10A 4I01A 3B02A 4MFDA 1LEAA 4XRMA 3S3OA 2K02A 5HZXA 3KZYA 4LIUA 2VOPA 1WFXA 4DNCA 4X6AJ 3IC7A 5KCMA 4ZYDA 2O5WA 2LD5A 2CL3A 3WE2A 2DYRH 2BVMA 1XDSA 2R92J 3IH4A 4XONA 2R5ZB 1DGWY 5IT3A 2HYJA 2L9NA 2XKPA 1OYYA 2P0WA 3FDYA 2R7SA 2WAEA 5FSNA 2X1EA 1SJYA 2EB7A 1IAWA 2Y30A 2OD5A 3FXOA 4NC8A 2YYHA 2LREA 5KHDA 3GMEA 4M9ZA 4BQQA 3CO6C 1V8YA 3ZRGA 1D0XA 4UXNA 5LGUA 2L4AA 1UHWA 3Q0WA 4H0EA 1FZPB 3SZTA 5B1BH 3OYLA 2XAUA 4PZJA 2J5OA 3G71I 2FA5A 1HW1A 4KISA 2ZJ2A 4Z2YA 4D9JA 2G7UA 5DV5A 5KK1A 4C3JJ 1PUSA 4HEA2 1SMTA 1FTZA 5IY5H 1W5CC 3HRTA 1BW5A 2L9RA 3ACAA 1ZHFA 3RKWA 1R00A 2HFHA 2XDVA 2DA4A 2A69F 3SDBA 2X6XA 5D8LB 6PAXA 3HHJA 2FMYA 4M3GA 2LKXA 5FROA 2ZMEA 2MD5A 1FIPA 1W0TA 1T56A 2CW8A 2DFHA 2MBFA 3MMYB 4IRGA 3WE3A 2F48A 2TRTA 4I6ZA 3ZXSA 2WWYA 4LK1F 1OW2A 3J81K 1IN5A 1JT0A 3L9FA 3T8TA 2BW3B 5FLXK 5ANTA 3GLXA 4EJUA 3NAUA 2GA2A 2UUZA 3H5NA 3LSGA 4LG0A 2W00A 5B66C 2G73A 5ILSA 3S17J 2I8DA 1M1EB 4BJTA 4BQAA 4L9NA 4XM3A 4RLQA 3O2PE 2MD0A 3GVAA 1KYZA 1IC8A 2KRHA 4Q47A 2EFPA 4CCMA 4XL9A 2Q0OA 4FASD 4ZYEA 3VODA 4DYWA 1B1BA 2ICJA 1R67A 4HAMA 1FBUA 5K7HA 5J1UA 3FXRA 1JE8A 2VB6A 1U20A 2HOSA 4A3CJ 1ETQA 1FMVA 2W57A 5GTHC 3KIOA 1DGRM 5IYDJ 4YIRX 2BHZA 2JA7J 4XIDA 4U7BA 5CVIA 1B72B 4OAYA 1R4NB 4ZTFA 1BC7C 1D3YA 1E3PA 3UKGA 3X0LA 3ZR1A 3LSHA 3KP5A 4CHUA 5DM6F 3BR2A 2VQHA 2JSPA 2LBFB 4KMFA 4YFNF 3CZ6A 2LKPA 2EH3A 1HX3A 3ZMVA 1AWCA 1T0FC 5IOYA 3E6BA 1MQWA 4CYDA 1ZTRA 5JR3A 4U7DA 3KP2A 1LFUP 1V5EA 2YX4A 2PI0A 5KAIC 2ZB9A 3GW2A 3F8NA 3A4CA 1A31A 1YJNI 2GWRA 3V7CA 3IKTA 3CCLI 3AC9A 2G9WA 2H8WA 2E60A 2L7ZA 1B8IA 3SONA 3CCEI 5GADJ 3ABMH 1R5HA 3F13A 3H0DA 3BR5A 3R03A 1QPIA 3I5UA 1FBSA 5CQGA 1WCMJ 3FMSA 4XBFA 1J59A 4II3A 4LLNA 2L01A 2ACJA 5JHFA 4HX8A 1WGXA 4C3IJ 3A03A 1XX5A 1SVOA 1SFXA 4MLOA 3QAHA 1WQ2A 4XLPF 5FKKA 3BY6A 1GA7A 1G3SA 2ZNZA 1MBJA 2CSOA 2A6TA 2QZ8A 2GT4A
chains in the Genus database with same CATH topology
4HX4A 3R0JA 4G94A 2UWMA 5LPGA 5ICFA 4KDPA 3O52A 4KFCA 4WK8F 2LDUA 3IRRA 3MFKA 2GQQA 1LQ1A 2M1BA 3P7NA 5DCFA 2FOKA 1R36A 5F6FA 1V8VA 1KYWA 4D0PA 3DKUA 5JHUA 4CDGA 1ZGJA 1IRFA 3X0KA 1ZYRF 1Q1HA 3K69A 1XSAA 4MQVA 1EH6A 5IT9Z 1A04A 3TDUC 5HS9A 1FY7A 5J8FA 1DP7P 2CGPA 2EA2A 5DCMA 5CFIA 3GG6A 3GUDA 1LJ9A 4CGZA 2HKOA 5LBQA 3WTWC 5L3CA 5CVRA 5LRRA 3E5UA 5C7TA 1YFHA 1ZARA 3OV8A 4G7ZF 3Q91A 3FMRA 2QLZA 1SZ3A 3O61A 4EGYA 3LWFA 5LRSA 2D2WA 4WXHA 2JT1A 3WTVC 3X0PA 1H9TA 2FVVA 2AZWA 2LF8A 1F9NA 2YR2A 5AONA 1G3WA 1PP8F 2XHKA 3LQRA 5CFJA 3COAC 1K78A 2RV8A 3HRSA 1T39A 3F8MA 2BE5F 1GHCA 3ZMTA 1HW2A 4FX4A 3E5XA 4O6JA 1R7JA 1SD5A 3FK9A 3N9UA 3L09A 4QWQA 5H6RA 5J8CA 5ERIA 3E3VA 1IF1A 5ICEA 1IZ1A 3LAPA 5FGMA 4KT5C 1CF7A 2ESHA 2CG4A 1XGMA 1VRLA 3FFUA 1R58A 2NAZA 4A12A 3KP6A 4BHPA 4L0ZB 4ZYHA 1OR7A 4UUVA 2RQPA 2I8UA 2W84A 1V8WA 4S2VA 3QU6A 2VBZA 1U3EM 2V1UA 1PPVA 3Q93A 4RAYA 4A6EA 2MH9A 5LHHA 3DF8A 5FD5A 3CJNA 3ECOA 2DK5A 3RJPA 4M73A 4HDUA 2WV0A 2BV6A 4PDKA 1O7LA 2PQVA 1O3TA 1Y0UA 1V3FA 3JAMZ 3ZR0A 1ZN2A 3HSRA 5D4SA 1L3LA 1Q33A 1XN7A 3HUGA 4ZZLA 3CNGA 5DEQA 3LA2A 2JPBA 1PPWA 4HDVA 4U0WA 3MZYA 2XSQA 1I6XA 2XASA 5ISYA 1IRYA 1SD7A 3BOQA 4I0BA 1XCVA 2ZMEB 1S3JA 3VOEA 2BBYA 4MTDA 4IPAA 3E6DA 3IHUA 3BP8A 1MP2A 4JK1X 3RPUA 1S6LA 2RN7A 4LFUA 4LG0B 2EA4A 5IT9K 3DQVC 4PCQA 4U0VA 1IN6A 2AXLA 3FCMA 5L3FA 2GT2A 2UXNA 1ON2A 2QYOA 3RKYA 4EJVA 1Z9CA 1RYAA 4A5NA 4HQEA 1MJ9A 2F5DA 1W7PA 1S29A 1Z6RA 2HDCA 5KVRA 3WHWA 4UV8A 3R61A 2BEOA 1SFEA 4UVAA 4OIQF 3JW4A 4HYEA 5JVTA 5D8KB 4BYYA 2HR3A 4ENNA 1KA8A 4P96A 4MTEA 2OQGA 1BI0A 5DUKA 3TOBA 2E7WA 4NFXA 1FSHA 1OYWA 1RZ4A 2OAZA 2IRFG 3CDHA 3EDPA 5BOXA 3ISPA 1PUQA 2P5LC 1S8NA 4P55A 5FO5A 1RI7A 3GEZA 4WX9A 1YW7A 4O5VA 3F23A 1K7AA 4M6YA 2FBHA 2H6BA 1KQ0A 3ERED 2HOEA 1GVJA 2VODA 3S2WA 3VFZA 1R1VA 3CUQC 4UV9A 5BONA 3L00A 3BHOA 2AS5F 2PG4A 3L2CA 4AIHA 1ODDA 4MPOA 2MC3A 2KIFA 5L3DA 2O0YA 5D4RA 1C0WA 2V1XA 1MR2A 1VK6A 1E17A 2FMLA 5D6FA 1HKTA 2FU4A 3HTSB 5ANWA 1E2XA 2VBYA 3Q1PA 3MDGA 4EV0A 3WGIA 2YVOA 2DHOA 5LEJA 2A8TA 1G4DA 1BIBA 3IWZA 1P4WA 3FF5A 3V8LA 2FKBA 4LMYA 3KP3A 2P7CB 1B4AA 4IJXA 2DQLA 5DCMB 3V4GA 5D5VB 1SD6A 4NB5A 3KP7A 1I27A 1BOAA 1G0SA 3MGMA 1T0FA 2JRTA 4Y13A 1G6NA 2FNAA 1RIOH 2NS0A 2Z33A 3I7UA 2ZNYA 5EEGA 3H3UA 1OMIA 3EYIA 5EEHA 2IJLA 3JAMK 1YW9A 4YOQA 3EQLF 1IUYA 4MGRA 1G3TA 1JRKA 3V8KA 2ESNA 5FB2A 5BPIA 1ZG3A 5K5RA 3RH7A 3ZMUA 4LLGF 1SOIA 1QPMA 1FP1D 1KU9A 3M7GA 3SXYA 3PQKA 1XMKA 3T1BA 4QLCU 3RYPA 2B0LA 4EJTA 4HQMA 1UB9A 1I1GA 1K78B 3J7AO 4PGHA 5HLGA 2CQKA 1HBXG 2BGCA 1VHZA 2FE3A 1YO5C 5DYMA 3GX4X 2EV6A 2EFNA 4ASNA 4G6DA 2YVMA 1Z1DA 4KIFA 1ONVA 4UNOA 1UHMA 2ISZA 2R7FA 1EH8A 4N9IA 1VCDA 3MWMA 2M30A 3C18A 4AIJA 1R5GA 1CF7B 5FSIA 1BI2A 4KTBA 4M71A 4Y17A 5K5QA 5F64A 1IRGA 1TW2A 2ZCWA 2A8PA 5FSMA 2M5WA 1MGTA 3GYHX 3C1DA 3DFGA 2YVNA 2EFWA 2IT0A 1SMYF 4A5MA 5DDGA 4EJWA 3LA7A 3SFZA 1MJAA 1T98A 4OIPF 3GWZA 4L9VA 1ON1A 3EUHA 1QO0D 2P4WA 3V7SA 2PQ8A 4OINF 4LK0F 1PUNA 1TQPA 3F6VA 4E70A 3DXJF 1W5TA 4N1UA 4N1TA 1ZG1A 3QU3A 1IN4A 1T2KA 2M8EA 4N9HA 1MKMA 4L9TA 4TV7A 5LEKA 2KJCA 1PUEE 3FXUA 1IXSB 2V1DA 2ZKZA 5AIPA 1TNTA 4P5OA 2J8QA 1TTYA 2ZFWA 1J9IA 4I09A 4RAZA 4IHTA 2VBWA 1NFSA 5ILUA 3LSTA 4MHGA 2A68F 1BN5A 4AIKA 4M9SA 4CICA 5CLSA 2I6KA 2EWNA 3MCFA 4HF2A 2JPCA 1WSUA 2HQNA 3MAJA 3ID9A 1XGNA 1USTA 2Y48A 1TW3A 2KKOA 4WXCA 2W25A 3X0QA 3D0SA 3GZ6A 1U6GA 3CUOA 2P7VB 3I71A 4G6QA 3K1MA 1B9NA 3FMQA 3M1EA 3PFIA 1W7PB 4AVPA 5LLQA 1NFZA 5L3EA 3N4MA 2D45A 1ZLJA 2XGXA 2QUFA 1TUMA 3RPQA 3HHGA 4P9UA 4A0ZA 4XSXF 4K6EA 3F21A 2DPUA 3A6SA 1TLHB 4ETSA 4ESFA 4C9XA 2XV4S 2YPRA 3ZMSA 3OOPA 1L0OC 1I1SA 2FF4A 1O3QA 3KEQA 4RGXA 4YIIA 3WTZA 3NQOA 4OMYA 4ENMA 1IW7F 2GZWA 2PBIA 3FM5A 5CVUA 1V8MA 2O03A 4HLXA 3FZVA 2IW5A 3WTXC 2LSOA 1DUXC 2M45A 1K2EA 1QNTA 1P6RA 3RIRA 5JFRA 4ENKA 3KCCA 1QQIA 1R1UA 3RI4A 3KEOA 5LHGA 2XKOA 3BDDA 2E7XA 5ICCA 4ZYGA 1Z7UA 3KETA 5HDGA 4ZG0A 3FJYA 1W7PD 1YYVA 1PVFA 2B06A 2CW0F 4U0YA 2MH2A 3QPHA 5HLHA 4LJZF 2QKMB 4JZUA 3Q2SA 4O3MA 1TQMA 2RGVA 3SHDA 2KDWA 4DQ2A 3MEXA 3E97A 2DLLA 1ZAOA 2O3FA 2VBXA 3JTHA 1OPCA 1V8IA 3ABUA 5K1YA 2E1NA 2CYYA 2HWVA 2EV5A 2STWA 2L02A 3ECHA 1KGSA 4RB2C 3TGNA 2ISYA 1KTGA 1D8KA 3Q9VA 3SQNA 2Z5UA 3R4KA 3KFWX 5LHIA 1D5VA 2P6SA 3C3WA 4BXUA 1B6AA 3E57A 5ANVA 3KZZA 2IA2A 3WGGA 2VNPA 4KIBA 2O6GE 2IP2A 3R0AA 1R23A 2M87A 2VC1A 2A8SA 3QSJA 1BM9A 5BPDA 4I2OA 4XSZF 2DW4A 3GFJA 1QZZA 4XRFA 1TQIA 3CUQA 4EMSA 5IW4A 2BYVE 2OZUA 3I64A 1U5TC 3FHZA 2O5FA 3BWGA 1FNNA 2A3SA 4BAYA 5L3BA 3IKVA 5HVQC 2DTRA 1LDDA 3BAPA 3Q5FA 1P4AA 1IN8A 4K2EA 3G73A 2Q2EA 1V8UA 3I59B 3DKWA 3IL2A 4OIRF 1VC8A 3DUPA 1WRJA 1GXQA 1I9AA 2FEZA 3VEPA 1VIQA 2DBBA 1ZRDA 4OIOF 2WC2A 3P9CA 1R22A 1FYKA 4PGGA 3HOTA 4ZZDA 2MA3A 2MLKA 3P9IA 3R6SA 1YTYA 1J75A 1LB2A 3O69A 4J7HA 3SZPA 3GFMA 2XIGA 3WODF 4EM0B 5E1WA 2QJOA 2LNBA 5TJJA 4C9WA 1OYIA 2Z99A 3TOAA 1U8RA 2OU2A 4YG2F 1F4KA 3T0YA 3X0IA 1EH7A 3W6JB 2YVPA 1HZTA 2FBIA 3I0TA 5D6EA 1X3UA 3WTUC 5GHIA 1SD4A 2OA4A 3VB2A 4RB3C 3HYQA 1X84A 4L5IA 5E8GA 4EJOA 1HKSA 1SFUA 1WI9A 2EJRA 4IHSA 5H20A 2DFIA 4WCGA 1V8TA 3P6YA 2VN2A 2K86A 3V8JA 1RUOA 3U53A 3RDIA 3LFKA 3IWFA 4KICA 3F8CA 4UVBA 3H95A 1NHAA 3I9XA 3GF2A 4S2YA 3WTSC 3F22A 2ICKA 1KT9A 3BPXA 1V8NA 3TDZC 4GXOA 1BI3A 5FSLA 3BJOA 4GYIA 2XRNA 2GA1A 1QBJA 1XSBA 4RGRA 4A0YA 5J6XA 3ROUA 3GRNA 3J80Z 4G9YA 4JZTA 2L4MA 4KIGA 5C7QA 1I5ZA 3O6ZA 1P2FA 3ELKA 1XDUA 3GO5A 4R8HA 1JKNA 1QVJA 3X0OA 2YU3A 1U78A 3KLOA 5L3GA 2L3DA 2OZ6A 4GGGA 4NFWA 4NQWA 1Z6TA 5JI6A 1ZH5A 2QQ9A 5ED4A 2ADUA 2Q8KA 2GIVA 1O3SA 5I8UA 3U9GA 1Q54A 1AOYA 3EEUA 2O1CA 2F5FA 3GFIA 2A07F 4BH9A 2STTA 1KQ8A 2DUKA 1RRSA 2X4HA 1XGOA 3TO6A 3KLNA 3HTUA 1XCBA 4I02A 1ZREA 3F6AA 2A6TA 2A6EF 5FSKA 3I54A 1HXDA 4F7ZA 4MQ9F 2DI3A 4L9JA 5ANSA 4UHTA 1MK1A 2UXXA 1ZRCA 3Q2TA 1RNLA 3I4PA 1LVAA 1WKMA 5GHPA 3ZN0A 2D1VA 3FX3A 5K5OA 2DSDA 3U2RA 2FBKA 4WXDA 1J5YA 1K26A 1UCRA 3J7Ye 2PMHA 4ZH4F 2F2EA 4XLNF 2XAJA 2W4EA 2RRKA 1RUNA 3HRMA 2QBYB 2O61A 4GCVA 4M72A 2K7LA 2ZXJA 4S2WA 2DT5A 4A2UA 3CLOA 3N97A 2W24A 1XGSA 3ABTA 1KU7A 1PPXA 1YW8A 1QZYA 3O3KA 2PJPA 2HYFA 4FX0A 4A6DA 4Y15A 1MUTA 3E5QA 3QOPA 5CYVA 4JQFA 4JBAA 1YQAA 4LD5A 2DSBA 4EM1A 1B9MA 2UZKA 1YS7A 4FT8A 1PDNC 3QPTA 4IRIA 1DPRA 5FFZA 3HOSA 5CVVA 1Z91A 3I59A 2NYXA 3A6UA 4EM2A 4HW0A 2DK8A 3X0JA 4RS8A 1KU2A 3BJ6A 1LDKB 3JTGA 2RNJA 1HKQA 5F1RA 1FPQA 1P92A 2HTSA 3QP5A 2FRHA 3WU0A 4ICKA 4YPRA 3DPLC 4ENJA 4JZVA 2HEOA 5IW5A 1EV7A 3RTRA 4I98B 2YX7A 4KUMA 4UVCA 5GHQA 1F1ZA 3CUQB 2DAOA 2LF7A 2XAGA 2E1CA 3BJAA 1NQZA 3K9TA 2IVMA 1R1TA 2IA1A 1NQYA 2QVOA 1UFMA 3FSPA 2B2KA 2PN6A 1OKRA 3GZ8A 1XMAA 3J80K 3BM4A 1XSXA 1ZG5A 1YS6A 4LLLA 2KRFA 4RB1A 2FSWA 1USSA 2QJTA 3O8SA 3X0SA 2QQAA 4HV5A 3A6TA 4U88A 3WTYC 2A6HF 3NRVA 4BHCA 1XSVA 4G7HF 5HOOA 1X83A 2EK5A 3ZN1A 3EF5A 3BROA 4S2XA 2R3SA 4HFQA 3NEUA 2R7DA 3EYYA 5GHJA 2G7HA 1FX7A 3WG9A 4G7OF 5BMZA 5E8IA 2IPQX 1YIOA 5AIQA 4KN7X 4AWXB 4MEYF 4KG3A 2FNPA 3MDIA 4LB6B 1ZRFA 3H92A 1V8RA 3DP7A 2K4JA 2P5KA 2HS5A 2XAFA 4B09A 3CO7C 1HQCA 5LGNA 3WTTC 3HHHA 3M8FA 4BHBA 1FSEA 2PFBA 2H09A 1U5TA 4Q5SF 2YSRA 2V6CA 2DPDA 2F5EA 1BJAA 3HSEA 3GXOA 4FHTA 2VC0A 3GFLA 1VTNC 3K2ZA 2JTVA 2JZYA 2CO5A 1KU3A 2P8TA 4G8XA 4HLYA 1V8SA 3KE2A 2NRAC 3O6BB 2VXZA 1JHFA 1PP7U 1TNSA 2CWEA 1MZBA 2QWWA 4L0YB 2DO7A 4HV6A 3F72A 4AD9A 2XROA 2I8TA 2GB5A 1MDMB 4KYWA 3DV8A 3TKYA 5ICGA 3N77A 1Q27A 3K0LA 4N0BA 3ZQ7A 2V79A 5BQTA 4RGUA 3F8FA 1BI1A 2O8XA 1S7OA 3TO9A 2EFQA 3QP6A 4YPHA 5GHNA 2P5VA 5D5XB 4HX7A 2K27A 1ULYA 3WU1B 3ZMZA 3COUA 2RDPA 1YLFA 4M74A 2QBYA 3I53A 4I7HA 3C7JA 3RYRA 4KMUX 1DPUA 5DD8A 3Q4IA 2WTEA 1FYMA 5E1XA 4HA8A 4RB0A 4HZFA 3KVHA 2KJBA 2HYGD 4KN4X 3FWEA 1H0MA 1J0RA 4ESJA 3AAFA 2GAUA 1K79A 3LQQA 3LA3A 4OMZA 2VT3A 1X51A 3OGAA 2QENA 3W6KB 1JGSA 2V9VA 5D5UB 3FM3A 3M9AA 1XD7A 2OQRA 4OU0A 5C8LA 3MQ0A 4YFXF 4V14A 3I58A 1V8LA 5TRDA 1LEBA 1HW5A 2VT2A 2VE9A 1DDNA 1FOKA 4IVNA 3BPVA 2EV0A 4EQQA 5FFXA 1IXCA 1MJBA 3JSOA 3L85A 1J7KA 3F6OA 3ML6A 4YIFA 4A0XA 2XVCA 5E1ZB 2QQBA 1CGPA 2X0LA 3BZ6A 2RVCA 1RRQA 3EXQA 1F3YA 3EETA 4HF0A 5LGTA 1FBQA 3CTAA 4MEXF 3X0NA 2A5YB 4R1HA 4EGZA 2PEXA 2DQRA 2MLGA 2QM3A 2TDXA 1FLIA 3U1DA 4JZSA 5CJ9A 1O57A 1TBXA 2A61A 5GHOA 4IRHA 2PNYA 5GHMA 3R60A 3ZP5A 5A2QZ 5HS8A 2ZBKA 3ZPLA 2RKHA 3D5LA 1GXPA 1G3YA 2GXGA 2H6CA 1JHHA 1G9QA 2HQRA 1K6OA 1ZGAA 5DPKA 1Z05A 1BBYA 1FC3A 4LB5A 4IXAA 5HDNA 1SAXA 3T5XA 4KG4A 2GXBA 5E17F 3K1NA 2F5CA 3Q9SA 5DUIA 1HSJA 1O7FA 3HRUA 2L54A 2R5WA 3B73A 2CFXA 2DSCA 3HSFA 3M8EA 3MCZA 3DPTA 2KIUA 3E6CC 2DU9A 3P9KA 2H27A 2XAHA 1FWZA 3V7RA 4IF4A 3EESA 3G0QA 4MNUA 3L7WA 4Q4ZF 3X0RA 2ELHA 3GWYA 2NNYA 3ZMDA 4R79A 1T6SA 3TO7A 1O3RA 2G74A 1BIAA 2PMUA 5D5WB 3SMDA 4L18B 2W85A 2KIMA 4CO8A 2IA0A 2CZRA 2K4BA 1VHGA 3I7VA 5CVJA 1XB4A 1KQ9A 3WGHA 2PLYA 4LGWA