4NFXA

Structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Nudix hydrolase ymfB
publication title Divalent metal ion-based catalytic mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 38
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4nfxA00
2FMLA 1VRLA 2DSDA 3A6UA 3BAPA 1VHGA 3ZR0A 4C9XA 5FSIA 3E57A 1PUSA 2DSBA 3I7UA 5ANTA 2O5WA 1MQEA 4KG4A 4NFXA 2KDVA 3OGAA 4KYXA 3GZ6A 1PUNA 1OW2A 1KT9A 3Q2TA 2G74A 3BM4A 5GHPA 5HZXA 5FSNA 3FJYA 1K2EA 2GT4A 3Q1PA 5GHIA 2VNPA 3X0QA 1VHZA 2RRKA 1PUQA 4HFQA 1V8MA 2B06A 1PVFA 3HHJA 2YVPA 1F3YA 2I8TA 1SZ3A 1VC8A 4KG3A 3H95A 1MR2A 1X84A 3X0OA 3X0IA 1V8WA 2FKBA 3MDIA 5GHMA 4JZSA 1XSCA 1JKNA 2A6TA 1SJYA 3FK9A 2DUKA 3SONA 1IRYA 2B2KA 4S2YA 4DYWA 3AC9A 5CFJA 3ACAA 3MCFA 1V8SA 2B0VA 1G9QA 2YYHA 3A6SA 3I7VA 2VNQA 3WHWA 1VIQA 1PPWA 3EEUA 1RYAA 3N77A 3O61A 3R03A 4KTBA 3G0QA 1MP2A 5GHNA 1Q27A 3HYQA 2A8SA 2Q9PA 2JVBA 2QJOA 4S2WA 5BONA 3I9XA 2KDWA 3X0PA 3Q93A 3J7Ye 1V8UA 1V8YA 1X83A 1X51A 2YVOA 1V8NA 3DKUA 3GG6A 4NFWA 5I8UA 5DDGA 2I6KA 5IW5A 4JZVA 1GA7A 3EF5A 2I8UA 3FCMA 1XSBA 1QVJA 1MK1A 1R67A 3CNGA 3RH7A 5C7QA 2FVVA 5DEQA 3F6AA 3U53A 5ANWA 5CFIA 5LPGA 3O52A 1V8VA 3O69A 3FSPA 3P6YA 1G0SA 1Q54A 1PPXA 5DD4A 5DPKA 1NQYA 2R5WA 3QSJA 3GZ5A 2QJTA 3GZ8A 1Q33A 5C7TA 3A6VA 2DSCA 2YVNA 4YPHA 3L85A 4IJXA 3COUA 2A8TA 4YPRA 1K26A 1SOIA 4C9WA 3EXQA 1I9AA 3Q4IA 1VCDA 1SU2A 1TUMA 5FSLA 3X0LA 4MPOA 2G73A 3A6TA 4N1UA 5FSOA 3X0JA 2QKMB 2GT2A 3ZR1A 3F13A 2CL3A 5ANSA 3EESA 3GRNA 5IW4A 4JZTA 4S2XA 3MGMA 3P5TA 3Q2SA 4N1TA 5GHJA 4HVYA 4ZG0A 3SMDA 2ICKA 4K6EA 3BHOA 3Q91A 1KTGA 3O8SA 5C8LA 1HX3A 1XSAA 3X0MA 2A8QA 1RRQA 2YVMA 3X0RA 5FSKA 5FSMA 1MUTA 2A8PA 2PQVA 3N9UA 5BS6A 4JZUA 1VK6A 1KHZA 1U20A 5ANUA 3O6ZA 3X0SA 1RRSA 1NQZA 2DHOA 2A8RA 1MQWA 1NFZA 2PNYA 5GHOA 2W4EA 1V8LA 2J8QA 3DUPA 2GB5A 1JRKA 4YOQA 3X0NA 3ID9A 2O1CA 3GWYA 5GHQA 3KVHA 5ANVA 4ILQA 3SHDA 3X0KA 5ISYA 1V8TA 1V8RA 2O5FA 1HZTA 2AZWA 4ICKA 1VC9A 3MDGA 2XSQA 1VIUA 4V14A 1NFSA 3FFUA 1V8IA 4S2VA 2ICJA 1PPVA
chains in the Genus database with same CATH superfamily
2FMLA 1VRLA 2DSDA 3A6UA 3BAPA 1VHGA 3ZR0A 4C9XA 5FSIA 3E57A 1PUSA 2DSBA 3I7UA 5ANTA 2O5WA 1MQEA 4KG4A 4NFXA 2KDVA 3OGAA 4KYXA 3GZ6A 1PUNA 1OW2A 1KT9A 3Q2TA 2G74A 3BM4A 5GHPA 5HZXA 5FSNA 3FJYA 1K2EA 2GT4A 3Q1PA 5GHIA 2VNPA 3X0QA 1VHZA 2RRKA 1PUQA 4HFQA 1V8MA 2B06A 1PVFA 3HHJA 2YVPA 1F3YA 2I8TA 1SZ3A 1VC8A 4KG3A 3H95A 1MR2A 1X84A 3X0OA 3X0IA 1V8WA 2FKBA 3MDIA 5GHMA 4JZSA 1XSCA 1JKNA 2A6TA 1SJYA 3FK9A 2DUKA 3SONA 1IRYA 2B2KA 4S2YA 4DYWA 3AC9A 5CFJA 3ACAA 3MCFA 1V8SA 2B0VA 1G9QA 2YYHA 3A6SA 2CZRA 3I7VA 2VNQA 3WHWA 1VIQA 1PPWA 3EEUA 1RYAA 3N77A 3O61A 3R03A 4KTBA 3G0QA 1MP2A 4J7HA 1Q27A 3HYQA 5GHNA 2A8SA 2Q9PA 2JVBA 2QJOA 4S2WA 5BONA 3I9XA 2KDWA 3X0PA 3Q93A 3J7Ye 1V8UA 1V8YA 1X83A 1X51A 2YVOA 1V8NA 3DKUA 3GG6A 4NFWA 5I8UA 5DDGA 2I6KA 5IW5A 4JZVA 1GA7A 3EF5A 2I8UA 3FCMA 1XSBA 1QVJA 1MK1A 1R67A 3CNGA 3RH7A 5C7QA 2FVVA 5DEQA 3F6AA 3U53A 5ANWA 5CFIA 5LPGA 3O52A 1V8VA 3O69A 3FSPA 3P6YA 1G0SA 1Q54A 1PPXA 5DD4A 5DPKA 1NQYA 2R5WA 3QSJA 4J7GA 3GZ5A 2QJTA 3GZ8A 1Q33A 5C7TA 3A6VA 2DSCA 2YVNA 4YPHA 3L85A 4IJXA 3COUA 2A8TA 4YPRA 1K26A 1SOIA 4C9WA 3EXQA 1I9AA 3Q4IA 1VCDA 1SU2A 1TUMA 5FSLA 3X0LA 4MPOA 2G73A 3A6TA 4N1UA 5FSOA 3X0JA 2QKMB 2GT2A 3ZR1A 3F13A 2CL3A 5ANSA 3EESA 3GRNA 5IW4A 4JZTA 4S2XA 3MGMA 3P5TA 3Q2SA 4N1TA 5GHJA 4HVYA 4ZG0A 3SMDA 2ICKA 4K6EA 3BHOA 3Q91A 1KTGA 3O8SA 5C8LA 1HX3A 1XSAA 3X0MA 2A8QA 1RRQA 2YVMA 3X0RA 5FSKA 5FSMA 1MUTA 2A8PA 2PQVA 3N9UA 5BS6A 4JZUA 1VK6A 1KHZA 1U20A 5ANUA 3O6ZA 3X0SA 1RRSA 1NQZA 2DHOA 2A8RA 1MQWA 1NFZA 2PNYA 5GHOA 2W4EA 1V8LA 2J8QA 3DUPA 2GB5A 1JRKA 4YOQA 3X0NA 3ID9A 2O1CA 3GWYA 5GHQA 3KVHA 5ANVA 4ILQA 3SHDA 3X0KA 5ISYA 1V8TA 1V8RA 2O5FA 1HZTA 2AZWA 4ICKA 1VC9A 3MDGA 2XSQA 1VIUA 4V14A 1NFSA 3FFUA 1V8IA 4S2VA 2ICJA 1PPVA
chains in the Genus database with same CATH topology
2FMLA 1VRLA 2DSDA 3A6UA 3BAPA 1VHGA 3ZR0A 4C9XA 5FSIA 3E57A 1PUSA 2DSBA 3I7UA 5ANTA 2O5WA 1MQEA 4KG4A 4NFXA 2KDVA 3OGAA 4KYXA 3GZ6A 1PUNA 1OW2A 1KT9A 3Q2TA 2G74A 3BM4A 5GHPA 5HZXA 5FSNA 3FJYA 1K2EA 2GT4A 3Q1PA 5GHIA 2VNPA 3X0QA 1VHZA 2RRKA 1PUQA 4HFQA 1V8MA 2B06A 1PVFA 3HHJA 2YVPA 1F3YA 2I8TA 1SZ3A 1VC8A 4KG3A 3H95A 1MR2A 1X84A 3X0OA 3X0IA 1V8WA 2FKBA 3MDIA 5GHMA 4JZSA 1XSCA 1JKNA 2A6TA 1SJYA 3FK9A 2DUKA 3SONA 1IRYA 2B2KA 4S2YA 4DYWA 3AC9A 5CFJA 3ACAA 3MCFA 1V8SA 2B0VA 1G9QA 2YYHA 3A6SA 2CZRA 3I7VA 2VNQA 3WHWA 1VIQA 1PPWA 3EEUA 1RYAA 3N77A 3O61A 3R03A 4KTBA 3G0QA 1MP2A 4J7HA 1Q27A 3HYQA 5GHNA 2A8SA 2Q9PA 2JVBA 2QJOA 4S2WA 5BONA 3I9XA 2KDWA 3X0PA 3Q93A 3J7Ye 1V8UA 1V8YA 1X83A 1X51A 2YVOA 1V8NA 3DKUA 3GG6A 4NFWA 5I8UA 5DDGA 2I6KA 5IW5A 4JZVA 1GA7A 3EF5A 2I8UA 3FCMA 1XSBA 1QVJA 1MK1A 1R67A 3CNGA 3RH7A 5C7QA 2FVVA 5DEQA 3F6AA 3U53A 5ANWA 5CFIA 5LPGA 3O52A 1V8VA 3O69A 3FSPA 3P6YA 1G0SA 1Q54A 1PPXA 5DD4A 5DPKA 1NQYA 2R5WA 3QSJA 4J7GA 3GZ5A 2QJTA 3GZ8A 1Q33A 5C7TA 3A6VA 2DSCA 2YVNA 4YPHA 3L85A 4IJXA 3COUA 2A8TA 4YPRA 1K26A 1SOIA 4C9WA 3EXQA 1I9AA 3Q4IA 1VCDA 1SU2A 1TUMA 5FSLA 3X0LA 4MPOA 2G73A 3A6TA 4N1UA 5FSOA 3X0JA 2QKMB 2GT2A 3ZR1A 3F13A 2CL3A 5ANSA 3EESA 3GRNA 5IW4A 4JZTA 4S2XA 3MGMA 3P5TA 3Q2SA 4N1TA 5GHJA 4HVYA 4ZG0A 3SMDA 2ICKA 4K6EA 3BHOA 3Q91A 1KTGA 3O8SA 5C8LA 1HX3A 1XSAA 3X0MA 2A8QA 1RRQA 2YVMA 3X0RA 5FSKA 5FSMA 1MUTA 2A8PA 2PQVA 3N9UA 5BS6A 4JZUA 1VK6A 1KHZA 1U20A 5ANUA 3O6ZA 3X0SA 1RRSA 1NQZA 2DHOA 2A8RA 1MQWA 1NFZA 2PNYA 5GHOA 2W4EA 1V8LA 2J8QA 3DUPA 2GB5A 1JRKA 4YOQA 3X0NA 3ID9A 2O1CA 3GWYA 5GHQA 3KVHA 5ANVA 4ILQA 3SHDA 3X0KA 5ISYA 1V8TA 1V8RA 2O5FA 1HZTA 2AZWA 4ICKA 1VC9A 3MDGA 2XSQA 1VIUA 4V14A 1NFSA 3FFUA 1V8IA 4S2VA 2ICJA 1PPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FML A;  1VRL A;  2DSD A;  3A6U A;  3BAP A;  1VHG A;  3ZR0 A;  4C9X A;  5FSI A;  3E57 A;  1PUS A;  2DSB A;  3I7U A;  5ANT A;  2O5W A;  1MQE A;  4KG4 A;  4NFX A;  2KDV A;  3OGA A;  4KYX A;  3GZ6 A;  1PUN A;  1OW2 A;  1KT9 A;  3Q2T A;  2G74 A;  3BM4 A;  5GHP A;  5HZX A;  5FSN A;  3FJY A;  1K2E A;  2GT4 A;  3Q1P A;  5GHI A;  2VNP A;  3X0Q A;  1VHZ A;  2RRK A;  1PUQ A;  4HFQ A;  1V8M A;  2B06 A;  1PVF A;  3HHJ A;  2YVP A;  1F3Y A;  2I8T A;  1SZ3 A;  1VC8 A;  4KG3 A;  3H95 A;  1MR2 A;  1X84 A;  3X0O A;  3X0I A;  1V8W A;  2FKB A;  3MDI A;  5GHM A;  4JZS A;  1XSC A;  1JKN A;  2A6T A;  1SJY A;  3FK9 A;  2DUK A;  3SON A;  1IRY A;  2B2K A;  4S2Y A;  4DYW A;  3AC9 A;  5CFJ A;  3ACA A;  3MCF A;  1V8S A;  2B0V A;  1G9Q A;  2YYH A;  3A6S A;  3I7V A;  2VNQ A;  3WHW A;  1VIQ A;  1PPW A;  3EEU A;  1RYA A;  3N77 A;  3O61 A;  3R03 A;  4KTB A;  3G0Q A;  1MP2 A;  5GHN A;  1Q27 A;  3HYQ A;  2A8S A;  2Q9P A;  2JVB A;  2QJO A;  4S2W A;  5BON A;  3I9X A;  2KDW A;  3X0P A;  3Q93 A;  3J7Y e;  1V8U A;  1V8Y A;  1X83 A;  1X51 A;  2YVO A;  1V8N A;  3DKU A;  3GG6 A;  4NFW A;  5I8U A;  5DDG A;  2I6K A;  5IW5 A;  4JZV A;  1GA7 A;  3EF5 A;  2I8U A;  3FCM A;  1XSB A;  1QVJ A;  1MK1 A;  1R67 A;  3CNG A;  3RH7 A;  5C7Q A;  2FVV A;  5DEQ A;  3F6A A;  3U53 A;  5ANW A;  5CFI A;  5LPG A;  3O52 A;  1V8V A;  3O69 A;  3FSP A;  3P6Y A;  1G0S A;  1Q54 A;  1PPX A;  5DD4 A;  5DPK A;  1NQY A;  2R5W A;  3QSJ A;  3GZ5 A;  2QJT A;  3GZ8 A;  1Q33 A;  5C7T A;  3A6V A;  2DSC A;  2YVN A;  4YPH A;  3L85 A;  4IJX A;  3COU A;  2A8T A;  4YPR A;  1K26 A;  1SOI A;  4C9W A;  3EXQ A;  1I9A A;  3Q4I A;  1VCD A;  1SU2 A;  1TUM A;  5FSL A;  3X0L A;  4MPO A;  2G73 A;  3A6T A;  4N1U A;  5FSO A;  3X0J A;  2QKM B;  2GT2 A;  3ZR1 A;  3F13 A;  2CL3 A;  5ANS A;  3EES A;  3GRN A;  5IW4 A;  4JZT A;  4S2X A;  3MGM A;  3P5T A;  3Q2S A;  4N1T A;  5GHJ A;  4HVY A;  4ZG0 A;  3SMD A;  2ICK A;  4K6E A;  3BHO A;  3Q91 A;  1KTG A;  3O8S A;  5C8L A;  1HX3 A;  1XSA A;  3X0M A;  2A8Q A;  1RRQ A;  2YVM A;  3X0R A;  5FSK A;  5FSM A;  1MUT A;  2A8P A;  2PQV A;  3N9U A;  5BS6 A;  4JZU A;  1VK6 A;  1KHZ A;  1U20 A;  5ANU A;  3O6Z A;  3X0S A;  1RRS A;  1NQZ A;  2DHO A;  2A8R A;  1MQW A;  1NFZ A;  2PNY A;  5GHO A;  2W4E A;  1V8L A;  2J8Q A;  3DUP A;  2GB5 A;  1JRK A;  4YOQ A;  3X0N A;  3ID9 A;  2O1C A;  3GWY A;  5GHQ A;  3KVH A;  5ANV A;  4ILQ A;  3SHD A;  3X0K A;  5ISY A;  1V8T A;  1V8R A;  2O5F A;  1HZT A;  2AZW A;  4ICK A;  1VC9 A;  3MDG A;  2XSQ A;  1VIU A;  4V14 A;  1NFS A;  3FFU A;  1V8I A;  4S2V A;  2ICJ A;  1PPV A; 
#chains in the Genus database with same CATH topology
 2FML A;  1VRL A;  2DSD A;  3A6U A;  3BAP A;  1VHG A;  3ZR0 A;  4C9X A;  5FSI A;  3E57 A;  1PUS A;  2DSB A;  3I7U A;  5ANT A;  2O5W A;  1MQE A;  4KG4 A;  4NFX A;  2KDV A;  3OGA A;  4KYX A;  3GZ6 A;  1PUN A;  1OW2 A;  1KT9 A;  3Q2T A;  2G74 A;  3BM4 A;  5GHP A;  5HZX A;  5FSN A;  3FJY A;  1K2E A;  2GT4 A;  3Q1P A;  5GHI A;  2VNP A;  3X0Q A;  1VHZ A;  2RRK A;  1PUQ A;  4HFQ A;  1V8M A;  2B06 A;  1PVF A;  3HHJ A;  2YVP A;  1F3Y A;  2I8T A;  1SZ3 A;  1VC8 A;  4KG3 A;  3H95 A;  1MR2 A;  1X84 A;  3X0O A;  3X0I A;  1V8W A;  2FKB A;  3MDI A;  5GHM A;  4JZS A;  1XSC A;  1JKN A;  2A6T A;  1SJY A;  3FK9 A;  2DUK A;  3SON A;  1IRY A;  2B2K A;  4S2Y A;  4DYW A;  3AC9 A;  5CFJ A;  3ACA A;  3MCF A;  1V8S A;  2B0V A;  1G9Q A;  2YYH A;  3A6S A;  2CZR A;  3I7V A;  2VNQ A;  3WHW A;  1VIQ A;  1PPW A;  3EEU A;  1RYA A;  3N77 A;  3O61 A;  3R03 A;  4KTB A;  3G0Q A;  1MP2 A;  4J7H A;  1Q27 A;  3HYQ A;  5GHN A;  2A8S A;  2Q9P A;  2JVB A;  2QJO A;  4S2W A;  5BON A;  3I9X A;  2KDW A;  3X0P A;  3Q93 A;  3J7Y e;  1V8U A;  1V8Y A;  1X83 A;  1X51 A;  2YVO A;  1V8N A;  3DKU A;  3GG6 A;  4NFW A;  5I8U A;  5DDG A;  2I6K A;  5IW5 A;  4JZV A;  1GA7 A;  3EF5 A;  2I8U A;  3FCM A;  1XSB A;  1QVJ A;  1MK1 A;  1R67 A;  3CNG A;  3RH7 A;  5C7Q A;  2FVV A;  5DEQ A;  3F6A A;  3U53 A;  5ANW A;  5CFI A;  5LPG A;  3O52 A;  1V8V A;  3O69 A;  3FSP A;  3P6Y A;  1G0S A;  1Q54 A;  1PPX A;  5DD4 A;  5DPK A;  1NQY A;  2R5W A;  3QSJ A;  4J7G A;  3GZ5 A;  2QJT A;  3GZ8 A;  1Q33 A;  5C7T A;  3A6V A;  2DSC A;  2YVN A;  4YPH A;  3L85 A;  4IJX A;  3COU A;  2A8T A;  4YPR A;  1K26 A;  1SOI A;  4C9W A;  3EXQ A;  1I9A A;  3Q4I A;  1VCD A;  1SU2 A;  1TUM A;  5FSL A;  3X0L A;  4MPO A;  2G73 A;  3A6T A;  4N1U A;  5FSO A;  3X0J A;  2QKM B;  2GT2 A;  3ZR1 A;  3F13 A;  2CL3 A;  5ANS A;  3EES A;  3GRN A;  5IW4 A;  4JZT A;  4S2X A;  3MGM A;  3P5T A;  3Q2S A;  4N1T A;  5GHJ A;  4HVY A;  4ZG0 A;  3SMD A;  2ICK A;  4K6E A;  3BHO A;  3Q91 A;  1KTG A;  3O8S A;  5C8L A;  1HX3 A;  1XSA A;  3X0M A;  2A8Q A;  1RRQ A;  2YVM A;  3X0R A;  5FSK A;  5FSM A;  1MUT A;  2A8P A;  2PQV A;  3N9U A;  5BS6 A;  4JZU A;  1VK6 A;  1KHZ A;  1U20 A;  5ANU A;  3O6Z A;  3X0S A;  1RRS A;  1NQZ A;  2DHO A;  2A8R A;  1MQW A;  1NFZ A;  2PNY A;  5GHO A;  2W4E A;  1V8L A;  2J8Q A;  3DUP A;  2GB5 A;  1JRK A;  4YOQ A;  3X0N A;  3ID9 A;  2O1C A;  3GWY A;  5GHQ A;  3KVH A;  5ANV A;  4ILQ A;  3SHD A;  3X0K A;  5ISY A;  1V8T A;  1V8R A;  2O5F A;  1HZT A;  2AZW A;  4ICK A;  1VC9 A;  3MDG A;  2XSQ A;  1VIU A;  4V14 A;  1NFS A;  3FFU A;  1V8I A;  4S2V A;  2ICJ A;  1PPV A; 
#chains in the Genus database with same CATH homology
 2FML A;  1VRL A;  2DSD A;  3A6U A;  3BAP A;  1VHG A;  3ZR0 A;  4C9X A;  5FSI A;  3E57 A;  1PUS A;  2DSB A;  3I7U A;  5ANT A;  2O5W A;  1MQE A;  4KG4 A;  4NFX A;  2KDV A;  3OGA A;  4KYX A;  3GZ6 A;  1PUN A;  1OW2 A;  1KT9 A;  3Q2T A;  2G74 A;  3BM4 A;  5GHP A;  5HZX A;  5FSN A;  3FJY A;  1K2E A;  2GT4 A;  3Q1P A;  5GHI A;  2VNP A;  3X0Q A;  1VHZ A;  2RRK A;  1PUQ A;  4HFQ A;  1V8M A;  2B06 A;  1PVF A;  3HHJ A;  2YVP A;  1F3Y A;  2I8T A;  1SZ3 A;  1VC8 A;  4KG3 A;  3H95 A;  1MR2 A;  1X84 A;  3X0O A;  3X0I A;  1V8W A;  2FKB A;  3MDI A;  5GHM A;  4JZS A;  1XSC A;  1JKN A;  2A6T A;  1SJY A;  3FK9 A;  2DUK A;  3SON A;  1IRY A;  2B2K A;  4S2Y A;  4DYW A;  3AC9 A;  5CFJ A;  3ACA A;  3MCF A;  1V8S A;  2B0V A;  1G9Q A;  2YYH A;  3A6S A;  2CZR A;  3I7V A;  2VNQ A;  3WHW A;  1VIQ A;  1PPW A;  3EEU A;  1RYA A;  3N77 A;  3O61 A;  3R03 A;  4KTB A;  3G0Q A;  1MP2 A;  4J7H A;  1Q27 A;  3HYQ A;  5GHN A;  2A8S A;  2Q9P A;  2JVB A;  2QJO A;  4S2W A;  5BON A;  3I9X A;  2KDW A;  3X0P A;  3Q93 A;  3J7Y e;  1V8U A;  1V8Y A;  1X83 A;  1X51 A;  2YVO A;  1V8N A;  3DKU A;  3GG6 A;  4NFW A;  5I8U A;  5DDG A;  2I6K A;  5IW5 A;  4JZV A;  1GA7 A;  3EF5 A;  2I8U A;  3FCM A;  1XSB A;  1QVJ A;  1MK1 A;  1R67 A;  3CNG A;  3RH7 A;  5C7Q A;  2FVV A;  5DEQ A;  3F6A A;  3U53 A;  5ANW A;  5CFI A;  5LPG A;  3O52 A;  1V8V A;  3O69 A;  3FSP A;  3P6Y A;  1G0S A;  1Q54 A;  1PPX A;  5DD4 A;  5DPK A;  1NQY A;  2R5W A;  3QSJ A;  4J7G A;  3GZ5 A;  2QJT A;  3GZ8 A;  1Q33 A;  5C7T A;  3A6V A;  2DSC A;  2YVN A;  4YPH A;  3L85 A;  4IJX A;  3COU A;  2A8T A;  4YPR A;  1K26 A;  1SOI A;  4C9W A;  3EXQ A;  1I9A A;  3Q4I A;  1VCD A;  1SU2 A;  1TUM A;  5FSL A;  3X0L A;  4MPO A;  2G73 A;  3A6T A;  4N1U A;  5FSO A;  3X0J A;  2QKM B;  2GT2 A;  3ZR1 A;  3F13 A;  2CL3 A;  5ANS A;  3EES A;  3GRN A;  5IW4 A;  4JZT A;  4S2X A;  3MGM A;  3P5T A;  3Q2S A;  4N1T A;  5GHJ A;  4HVY A;  4ZG0 A;  3SMD A;  2ICK A;  4K6E A;  3BHO A;  3Q91 A;  1KTG A;  3O8S A;  5C8L A;  1HX3 A;  1XSA A;  3X0M A;  2A8Q A;  1RRQ A;  2YVM A;  3X0R A;  5FSK A;  5FSM A;  1MUT A;  2A8P A;  2PQV A;  3N9U A;  5BS6 A;  4JZU A;  1VK6 A;  1KHZ A;  1U20 A;  5ANU A;  3O6Z A;  3X0S A;  1RRS A;  1NQZ A;  2DHO A;  2A8R A;  1MQW A;  1NFZ A;  2PNY A;  5GHO A;  2W4E A;  1V8L A;  2J8Q A;  3DUP A;  2GB5 A;  1JRK A;  4YOQ A;  3X0N A;  3ID9 A;  2O1C A;  3GWY A;  5GHQ A;  3KVH A;  5ANV A;  4ILQ A;  3SHD A;  3X0K A;  5ISY A;  1V8T A;  1V8R A;  2O5F A;  1HZT A;  2AZW A;  4ICK A;  1VC9 A;  3MDG A;  2XSQ A;  1VIU A;  4V14 A;  1NFS A;  3FFU A;  1V8I A;  4S2V A;  2ICJ A;  1PPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...