4NFXA

Structure and atypical hydrolysis mechanism of the nudix hydrolase orf153 (ymfb) from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
153
structure length
153
Chain Sequence
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAARELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSDIDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTKGVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Nudix hydrolase ymfB
publication title Divalent metal ion-based catalytic mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4nfxA00
2KDWA 1JRKA 5GHNA 2CL3A 3ACAA 1V8UA 4HFQA 2W4EA 5C7TA 3L85A 5FSNA 5FSMA 1Q33A 5CFJA 1JKNA 1V8SA 1V8MA 3ID9A 1V8YA 1V8IA 4DYWA 3F6AA 5ANTA 1IRYA 1Q54A 2I8UA 1VC9A 3FJYA 1V8NA 1PUQA 3FK9A 4KTBA 5GHPA 3SONA 2B0VA 2G73A 2VNQA 1G9QA 1MQWA 2A8PA 4JZSA 2B06A 4HVYA 2ICKA 2O5WA 3U53A 3F13A 3OGAA 1NQZA 3Q91A 4C9XA 5FSLA 3X0NA 3EESA 5DPKA 4ILQA 5FSIA 2VNPA 2I8TA 2DSDA 2YVOA 3R03A 4S2YA 3GZ8A 5GHOA 5GHJA 1SOIA 1U20A 3X0PA 3HHJA 3X0JA 3O61A 2G74A 3A6VA 5DD4A 1XSCA 1HZTA 4KG3A 2YVNA 1V8VA 2PQVA 5ANSA 2J8QA 4IJXA 1QVJA 4ZG0A 1GA7A 4JZVA 2B2KA 2YVMA 3BHOA 3GG6A 1V8TA 3A6TA 3SHDA 2GT2A 3RH7A 1R67A 3Q2SA 4ICKA 2Q9PA 3WHWA 5ISYA 1MQEA 3EF5A 5IW5A 4KYXA 3O69A 3DKUA 3BAPA 4YOQA 3X0KA 3H95A 1PPWA 4S2WA 4C9WA 2A8RA 2DSCA 2FMLA 3GWYA 1SZ3A 1KHZA 2FVVA 5IW4A 1VHGA 5I8UA 3ZR1A 2A8TA 4NFWA 3MDIA 3G0QA 1XSAA 1PUSA 2GT4A 4JZTA 1RYAA 3A6SA 1VCDA 3BM4A 1PVFA 1NFSA 2FKBA 1KT9A 5ANWA 3X0IA 4YPHA 3FSPA 3AC9A 3X0MA 3I7VA 5C7QA 1I9AA 4NFXA 3P5TA 3Q2TA 5DEQA 5HZXA 1XSBA 2KDVA 3X0OA 4YPRA 5ANUA 3Q93A 2GB5A 1K2EA 5ANVA 2YVPA 3P6YA 2XSQA 1X83A 3EEUA 3QSJA 1VIQA 3FCMA 5LPGA 1F3YA 5GHQA 2DHOA 1RRQA 3COUA 4V14A 3GZ6A 5BS6A 2AZWA 3GZ5A 3N9UA 1K26A 1V8LA 2JVBA 3N77A 3EXQA 3O8SA 1X84A 3O6ZA 5BONA 5DDGA 5FSKA 2QKMB 2DUKA 2R5WA 3Q4IA 4JZUA 2QJOA 1KTGA 2A6TA 2RRKA 1VC8A 2DSBA 5C8LA 1RRSA 1NQYA 2A8SA 3X0LA 3GRNA 1VHZA 5FSOA 1PUNA 1MUTA 2I6KA 3A6UA 3Q1PA 1SU2A 2A8QA 2ICJA 3E57A 3SMDA 1VK6A 1G0SA 3X0RA 3O52A 1HX3A 1X51A 1MP2A 3DUPA 3HYQA 4KG4A 1NFZA 1TUMA 3CNGA 3KVHA 4N1TA 5GHMA 1VIUA 3MCFA 4S2XA 3J7Ye 3I7UA 1VRLA 3X0QA 4S2VA 1MK1A 2QJTA 1V8WA 3I9XA 4K6EA 1OW2A 5CFIA 2O1CA 5GHIA 2PNYA 3X0SA 3MDGA 1V8RA 2YYHA 1MR2A 1PPVA 4N1UA 1SJYA 4MPOA 3FFUA 3MGMA 3ZR0A 1PPXA 1Q27A 2O5FA
chains in the Genus database with same CATH superfamily
2KDWA 1JRKA 5GHNA 2CL3A 3ACAA 1V8UA 4HFQA 2W4EA 5C7TA 3L85A 5FSNA 5FSMA 1Q33A 5CFJA 4J7GA 1JKNA 1V8SA 1V8MA 3ID9A 1V8YA 1V8IA 4DYWA 3F6AA 5ANTA 1IRYA 1Q54A 2I8UA 1VC9A 3FJYA 1V8NA 1PUQA 3FK9A 4KTBA 5GHPA 3SONA 2B0VA 2G73A 2VNQA 1G9QA 1MQWA 2A8PA 4JZSA 2B06A 4HVYA 2ICKA 2O5WA 3U53A 3F13A 3OGAA 1NQZA 3Q91A 4C9XA 5FSLA 3X0NA 3EESA 5DPKA 4ILQA 5FSIA 2VNPA 2I8TA 2DSDA 2YVOA 3R03A 4S2YA 3GZ8A 5GHOA 5GHJA 1SOIA 1U20A 3X0PA 3HHJA 3X0JA 3O61A 2G74A 3A6VA 5DD4A 1XSCA 1HZTA 4KG3A 2YVNA 1V8VA 2PQVA 5ANSA 2J8QA 4IJXA 1QVJA 4ZG0A 1GA7A 4JZVA 2B2KA 2YVMA 3BHOA 3GG6A 1V8TA 3A6TA 3SHDA 2GT2A 3RH7A 1R67A 3Q2SA 4ICKA 2Q9PA 3WHWA 5ISYA 1MQEA 3EF5A 5IW5A 4KYXA 3O69A 3DKUA 3BAPA 4YOQA 3X0KA 3H95A 1PPWA 4S2WA 4C9WA 2A8RA 2DSCA 2FMLA 3GWYA 1SZ3A 1KHZA 2FVVA 5IW4A 1VHGA 5I8UA 3ZR1A 2A8TA 4NFWA 3MDIA 3G0QA 1XSAA 1PUSA 2GT4A 4JZTA 1RYAA 3A6SA 1VCDA 3BM4A 1PVFA 1NFSA 2FKBA 1KT9A 5ANWA 3X0IA 4YPHA 3FSPA 3AC9A 3X0MA 3I7VA 5C7QA 1I9AA 4NFXA 3P5TA 3Q2TA 5DEQA 5HZXA 1XSBA 2KDVA 3X0OA 4YPRA 5ANUA 3Q93A 2GB5A 1K2EA 5ANVA 2YVPA 3P6YA 2XSQA 1X83A 3EEUA 3QSJA 1VIQA 3FCMA 5LPGA 1F3YA 5GHQA 2DHOA 1RRQA 3COUA 4V14A 3GZ6A 5BS6A 2AZWA 3GZ5A 3N9UA 1K26A 1V8LA 2JVBA 3N77A 3EXQA 3O8SA 1X84A 3O6ZA 5BONA 5DDGA 5FSKA 2QKMB 2DUKA 2R5WA 3Q4IA 4JZUA 2QJOA 1KTGA 2A6TA 2RRKA 1VC8A 2DSBA 5C8LA 1RRSA 1NQYA 2A8SA 3X0LA 3GRNA 1VHZA 5FSOA 1PUNA 1MUTA 2I6KA 3A6UA 3Q1PA 1SU2A 2A8QA 2ICJA 3E57A 4J7HA 1VK6A 1G0SA 2CZRA 3O52A 3SMDA 3X0RA 1HX3A 1X51A 1MP2A 3DUPA 3HYQA 4KG4A 1NFZA 1TUMA 3CNGA 3KVHA 4N1TA 5GHMA 1VIUA 3MCFA 4S2XA 3J7Ye 3I7UA 1VRLA 3X0QA 4S2VA 1MK1A 2QJTA 1V8WA 3I9XA 4K6EA 1OW2A 5CFIA 2O1CA 5GHIA 2PNYA 3X0SA 3MDGA 1V8RA 2YYHA 1MR2A 1PPVA 4N1UA 1SJYA 4MPOA 3FFUA 3MGMA 3ZR0A 1PPXA 1Q27A 2O5FA
chains in the Genus database with same CATH topology
2KDWA 1JRKA 5GHNA 2CL3A 3ACAA 1V8UA 4HFQA 2W4EA 5C7TA 3L85A 5FSNA 5FSMA 1Q33A 5CFJA 4J7GA 1JKNA 1V8SA 1V8MA 3ID9A 1V8YA 1V8IA 4DYWA 3F6AA 5ANTA 1IRYA 1Q54A 2I8UA 1VC9A 3FJYA 1V8NA 1PUQA 3FK9A 4KTBA 5GHPA 3SONA 2B0VA 2G73A 2VNQA 1G9QA 1MQWA 2A8PA 4JZSA 2B06A 4HVYA 2ICKA 2O5WA 3U53A 3F13A 3OGAA 1NQZA 3Q91A 4C9XA 5FSLA 3X0NA 3EESA 5DPKA 4ILQA 5FSIA 2VNPA 2I8TA 2DSDA 2YVOA 3R03A 4S2YA 3GZ8A 5GHOA 5GHJA 1SOIA 1U20A 3X0PA 3HHJA 3X0JA 3O61A 2G74A 3A6VA 5DD4A 1XSCA 1HZTA 4KG3A 2YVNA 1V8VA 2PQVA 5ANSA 2J8QA 4IJXA 1QVJA 4ZG0A 1GA7A 4JZVA 2B2KA 2YVMA 3BHOA 3GG6A 1V8TA 3A6TA 3SHDA 2GT2A 3RH7A 1R67A 3Q2SA 4ICKA 2Q9PA 3WHWA 5ISYA 1MQEA 3EF5A 5IW5A 4KYXA 3O69A 3DKUA 3BAPA 4YOQA 3X0KA 3H95A 1PPWA 4S2WA 4C9WA 2A8RA 2DSCA 2FMLA 3GWYA 1SZ3A 1KHZA 2FVVA 5IW4A 1VHGA 5I8UA 3ZR1A 2A8TA 4NFWA 3MDIA 3G0QA 1XSAA 1PUSA 2GT4A 4JZTA 1RYAA 3A6SA 1VCDA 3BM4A 1PVFA 1NFSA 2FKBA 1KT9A 5ANWA 3X0IA 4YPHA 3FSPA 3AC9A 3X0MA 3I7VA 5C7QA 1I9AA 4NFXA 3P5TA 3Q2TA 5DEQA 5HZXA 1XSBA 2KDVA 3X0OA 4YPRA 5ANUA 3Q93A 2GB5A 1K2EA 5ANVA 2YVPA 3P6YA 2XSQA 1X83A 3EEUA 3QSJA 1VIQA 3FCMA 5LPGA 1F3YA 5GHQA 2DHOA 1RRQA 3COUA 4V14A 3GZ6A 5BS6A 2AZWA 3GZ5A 3N9UA 1K26A 1V8LA 2JVBA 3N77A 3EXQA 3O8SA 1X84A 3O6ZA 5BONA 5DDGA 5FSKA 2QKMB 2DUKA 2R5WA 3Q4IA 4JZUA 2QJOA 1KTGA 2A6TA 2RRKA 1VC8A 2DSBA 5C8LA 1RRSA 1NQYA 2A8SA 3X0LA 3GRNA 1VHZA 5FSOA 1PUNA 1MUTA 2I6KA 3A6UA 3Q1PA 1SU2A 2A8QA 2ICJA 3E57A 4J7HA 1VK6A 1G0SA 2CZRA 3O52A 3SMDA 3X0RA 1HX3A 1X51A 1MP2A 3DUPA 3HYQA 4KG4A 1NFZA 1TUMA 3CNGA 3KVHA 4N1TA 5GHMA 1VIUA 3MCFA 4S2XA 3J7Ye 3I7UA 1VRLA 3X0QA 4S2VA 1MK1A 2QJTA 1V8WA 3I9XA 4K6EA 1OW2A 5CFIA 2O1CA 5GHIA 2PNYA 3X0SA 3MDGA 1V8RA 2YYHA 1MR2A 1PPVA 4N1UA 1SJYA 4MPOA 3FFUA 3MGMA 3ZR0A 1PPXA 1Q27A 2O5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDW A;  1JRK A;  5GHN A;  2CL3 A;  3ACA A;  1V8U A;  4HFQ A;  2W4E A;  5C7T A;  3L85 A;  5FSN A;  5FSM A;  1Q33 A;  5CFJ A;  1JKN A;  1V8S A;  1V8M A;  3ID9 A;  1V8Y A;  1V8I A;  4DYW A;  3F6A A;  5ANT A;  1IRY A;  1Q54 A;  2I8U A;  1VC9 A;  3FJY A;  1V8N A;  1PUQ A;  3FK9 A;  4KTB A;  5GHP A;  3SON A;  2B0V A;  2G73 A;  2VNQ A;  1G9Q A;  1MQW A;  2A8P A;  4JZS A;  2B06 A;  4HVY A;  2ICK A;  2O5W A;  3U53 A;  3F13 A;  3OGA A;  1NQZ A;  3Q91 A;  4C9X A;  5FSL A;  3X0N A;  3EES A;  5DPK A;  4ILQ A;  5FSI A;  2VNP A;  2I8T A;  2DSD A;  2YVO A;  3R03 A;  4S2Y A;  3GZ8 A;  5GHO A;  5GHJ A;  1SOI A;  1U20 A;  3X0P A;  3HHJ A;  3X0J A;  3O61 A;  2G74 A;  3A6V A;  5DD4 A;  1XSC A;  1HZT A;  4KG3 A;  2YVN A;  1V8V A;  2PQV A;  5ANS A;  2J8Q A;  4IJX A;  1QVJ A;  4ZG0 A;  1GA7 A;  4JZV A;  2B2K A;  2YVM A;  3BHO A;  3GG6 A;  1V8T A;  3A6T A;  3SHD A;  2GT2 A;  3RH7 A;  1R67 A;  3Q2S A;  4ICK A;  2Q9P A;  3WHW A;  5ISY A;  1MQE A;  3EF5 A;  5IW5 A;  4KYX A;  3O69 A;  3DKU A;  3BAP A;  4YOQ A;  3X0K A;  3H95 A;  1PPW A;  4S2W A;  4C9W A;  2A8R A;  2DSC A;  2FML A;  3GWY A;  1SZ3 A;  1KHZ A;  2FVV A;  5IW4 A;  1VHG A;  5I8U A;  3ZR1 A;  2A8T A;  4NFW A;  3MDI A;  3G0Q A;  1XSA A;  1PUS A;  2GT4 A;  4JZT A;  1RYA A;  3A6S A;  1VCD A;  3BM4 A;  1PVF A;  1NFS A;  2FKB A;  1KT9 A;  5ANW A;  3X0I A;  4YPH A;  3FSP A;  3AC9 A;  3X0M A;  3I7V A;  5C7Q A;  1I9A A;  4NFX A;  3P5T A;  3Q2T A;  5DEQ A;  5HZX A;  1XSB A;  2KDV A;  3X0O A;  4YPR A;  5ANU A;  3Q93 A;  2GB5 A;  1K2E A;  5ANV A;  2YVP A;  3P6Y A;  2XSQ A;  1X83 A;  3EEU A;  3QSJ A;  1VIQ A;  3FCM A;  5LPG A;  1F3Y A;  5GHQ A;  2DHO A;  1RRQ A;  3COU A;  4V14 A;  3GZ6 A;  5BS6 A;  2AZW A;  3GZ5 A;  3N9U A;  1K26 A;  1V8L A;  2JVB A;  3N77 A;  3EXQ A;  3O8S A;  1X84 A;  3O6Z A;  5BON A;  5DDG A;  5FSK A;  2QKM B;  2DUK A;  2R5W A;  3Q4I A;  4JZU A;  2QJO A;  1KTG A;  2A6T A;  2RRK A;  1VC8 A;  2DSB A;  5C8L A;  1RRS A;  1NQY A;  2A8S A;  3X0L A;  3GRN A;  1VHZ A;  5FSO A;  1PUN A;  1MUT A;  2I6K A;  3A6U A;  3Q1P A;  1SU2 A;  2A8Q A;  2ICJ A;  3E57 A;  3SMD A;  1VK6 A;  1G0S A;  3X0R A;  3O52 A;  1HX3 A;  1X51 A;  1MP2 A;  3DUP A;  3HYQ A;  4KG4 A;  1NFZ A;  1TUM A;  3CNG A;  3KVH A;  4N1T A;  5GHM A;  1VIU A;  3MCF A;  4S2X A;  3J7Y e;  3I7U A;  1VRL A;  3X0Q A;  4S2V A;  1MK1 A;  2QJT A;  1V8W A;  3I9X A;  4K6E A;  1OW2 A;  5CFI A;  2O1C A;  5GHI A;  2PNY A;  3X0S A;  3MDG A;  1V8R A;  2YYH A;  1MR2 A;  1PPV A;  4N1U A;  1SJY A;  4MPO A;  3FFU A;  3MGM A;  3ZR0 A;  1PPX A;  1Q27 A;  2O5F A; 
#chains in the Genus database with same CATH topology
 2KDW A;  1JRK A;  5GHN A;  2CL3 A;  3ACA A;  1V8U A;  4HFQ A;  2W4E A;  5C7T A;  3L85 A;  5FSN A;  5FSM A;  1Q33 A;  5CFJ A;  4J7G A;  1JKN A;  1V8S A;  1V8M A;  3ID9 A;  1V8Y A;  1V8I A;  4DYW A;  3F6A A;  5ANT A;  1IRY A;  1Q54 A;  2I8U A;  1VC9 A;  3FJY A;  1V8N A;  1PUQ A;  3FK9 A;  4KTB A;  5GHP A;  3SON A;  2B0V A;  2G73 A;  2VNQ A;  1G9Q A;  1MQW A;  2A8P A;  4JZS A;  2B06 A;  4HVY A;  2ICK A;  2O5W A;  3U53 A;  3F13 A;  3OGA A;  1NQZ A;  3Q91 A;  4C9X A;  5FSL A;  3X0N A;  3EES A;  5DPK A;  4ILQ A;  5FSI A;  2VNP A;  2I8T A;  2DSD A;  2YVO A;  3R03 A;  4S2Y A;  3GZ8 A;  5GHO A;  5GHJ A;  1SOI A;  1U20 A;  3X0P A;  3HHJ A;  3X0J A;  3O61 A;  2G74 A;  3A6V A;  5DD4 A;  1XSC A;  1HZT A;  4KG3 A;  2YVN A;  1V8V A;  2PQV A;  5ANS A;  2J8Q A;  4IJX A;  1QVJ A;  4ZG0 A;  1GA7 A;  4JZV A;  2B2K A;  2YVM A;  3BHO A;  3GG6 A;  1V8T A;  3A6T A;  3SHD A;  2GT2 A;  3RH7 A;  1R67 A;  3Q2S A;  4ICK A;  2Q9P A;  3WHW A;  5ISY A;  1MQE A;  3EF5 A;  5IW5 A;  4KYX A;  3O69 A;  3DKU A;  3BAP A;  4YOQ A;  3X0K A;  3H95 A;  1PPW A;  4S2W A;  4C9W A;  2A8R A;  2DSC A;  2FML A;  3GWY A;  1SZ3 A;  1KHZ A;  2FVV A;  5IW4 A;  1VHG A;  5I8U A;  3ZR1 A;  2A8T A;  4NFW A;  3MDI A;  3G0Q A;  1XSA A;  1PUS A;  2GT4 A;  4JZT A;  1RYA A;  3A6S A;  1VCD A;  3BM4 A;  1PVF A;  1NFS A;  2FKB A;  1KT9 A;  5ANW A;  3X0I A;  4YPH A;  3FSP A;  3AC9 A;  3X0M A;  3I7V A;  5C7Q A;  1I9A A;  4NFX A;  3P5T A;  3Q2T A;  5DEQ A;  5HZX A;  1XSB A;  2KDV A;  3X0O A;  4YPR A;  5ANU A;  3Q93 A;  2GB5 A;  1K2E A;  5ANV A;  2YVP A;  3P6Y A;  2XSQ A;  1X83 A;  3EEU A;  3QSJ A;  1VIQ A;  3FCM A;  5LPG A;  1F3Y A;  5GHQ A;  2DHO A;  1RRQ A;  3COU A;  4V14 A;  3GZ6 A;  5BS6 A;  2AZW A;  3GZ5 A;  3N9U A;  1K26 A;  1V8L A;  2JVB A;  3N77 A;  3EXQ A;  3O8S A;  1X84 A;  3O6Z A;  5BON A;  5DDG A;  5FSK A;  2QKM B;  2DUK A;  2R5W A;  3Q4I A;  4JZU A;  2QJO A;  1KTG A;  2A6T A;  2RRK A;  1VC8 A;  2DSB A;  5C8L A;  1RRS A;  1NQY A;  2A8S A;  3X0L A;  3GRN A;  1VHZ A;  5FSO A;  1PUN A;  1MUT A;  2I6K A;  3A6U A;  3Q1P A;  1SU2 A;  2A8Q A;  2ICJ A;  3E57 A;  4J7H A;  1VK6 A;  1G0S A;  2CZR A;  3O52 A;  3SMD A;  3X0R A;  1HX3 A;  1X51 A;  1MP2 A;  3DUP A;  3HYQ A;  4KG4 A;  1NFZ A;  1TUM A;  3CNG A;  3KVH A;  4N1T A;  5GHM A;  1VIU A;  3MCF A;  4S2X A;  3J7Y e;  3I7U A;  1VRL A;  3X0Q A;  4S2V A;  1MK1 A;  2QJT A;  1V8W A;  3I9X A;  4K6E A;  1OW2 A;  5CFI A;  2O1C A;  5GHI A;  2PNY A;  3X0S A;  3MDG A;  1V8R A;  2YYH A;  1MR2 A;  1PPV A;  4N1U A;  1SJY A;  4MPO A;  3FFU A;  3MGM A;  3ZR0 A;  1PPX A;  1Q27 A;  2O5F A; 
#chains in the Genus database with same CATH homology
 2KDW A;  1JRK A;  5GHN A;  2CL3 A;  3ACA A;  1V8U A;  4HFQ A;  2W4E A;  5C7T A;  3L85 A;  5FSN A;  5FSM A;  1Q33 A;  5CFJ A;  4J7G A;  1JKN A;  1V8S A;  1V8M A;  3ID9 A;  1V8Y A;  1V8I A;  4DYW A;  3F6A A;  5ANT A;  1IRY A;  1Q54 A;  2I8U A;  1VC9 A;  3FJY A;  1V8N A;  1PUQ A;  3FK9 A;  4KTB A;  5GHP A;  3SON A;  2B0V A;  2G73 A;  2VNQ A;  1G9Q A;  1MQW A;  2A8P A;  4JZS A;  2B06 A;  4HVY A;  2ICK A;  2O5W A;  3U53 A;  3F13 A;  3OGA A;  1NQZ A;  3Q91 A;  4C9X A;  5FSL A;  3X0N A;  3EES A;  5DPK A;  4ILQ A;  5FSI A;  2VNP A;  2I8T A;  2DSD A;  2YVO A;  3R03 A;  4S2Y A;  3GZ8 A;  5GHO A;  5GHJ A;  1SOI A;  1U20 A;  3X0P A;  3HHJ A;  3X0J A;  3O61 A;  2G74 A;  3A6V A;  5DD4 A;  1XSC A;  1HZT A;  4KG3 A;  2YVN A;  1V8V A;  2PQV A;  5ANS A;  2J8Q A;  4IJX A;  1QVJ A;  4ZG0 A;  1GA7 A;  4JZV A;  2B2K A;  2YVM A;  3BHO A;  3GG6 A;  1V8T A;  3A6T A;  3SHD A;  2GT2 A;  3RH7 A;  1R67 A;  3Q2S A;  4ICK A;  2Q9P A;  3WHW A;  5ISY A;  1MQE A;  3EF5 A;  5IW5 A;  4KYX A;  3O69 A;  3DKU A;  3BAP A;  4YOQ A;  3X0K A;  3H95 A;  1PPW A;  4S2W A;  4C9W A;  2A8R A;  2DSC A;  2FML A;  3GWY A;  1SZ3 A;  1KHZ A;  2FVV A;  5IW4 A;  1VHG A;  5I8U A;  3ZR1 A;  2A8T A;  4NFW A;  3MDI A;  3G0Q A;  1XSA A;  1PUS A;  2GT4 A;  4JZT A;  1RYA A;  3A6S A;  1VCD A;  3BM4 A;  1PVF A;  1NFS A;  2FKB A;  1KT9 A;  5ANW A;  3X0I A;  4YPH A;  3FSP A;  3AC9 A;  3X0M A;  3I7V A;  5C7Q A;  1I9A A;  4NFX A;  3P5T A;  3Q2T A;  5DEQ A;  5HZX A;  1XSB A;  2KDV A;  3X0O A;  4YPR A;  5ANU A;  3Q93 A;  2GB5 A;  1K2E A;  5ANV A;  2YVP A;  3P6Y A;  2XSQ A;  1X83 A;  3EEU A;  3QSJ A;  1VIQ A;  3FCM A;  5LPG A;  1F3Y A;  5GHQ A;  2DHO A;  1RRQ A;  3COU A;  4V14 A;  3GZ6 A;  5BS6 A;  2AZW A;  3GZ5 A;  3N9U A;  1K26 A;  1V8L A;  2JVB A;  3N77 A;  3EXQ A;  3O8S A;  1X84 A;  3O6Z A;  5BON A;  5DDG A;  5FSK A;  2QKM B;  2DUK A;  2R5W A;  3Q4I A;  4JZU A;  2QJO A;  1KTG A;  2A6T A;  2RRK A;  1VC8 A;  2DSB A;  5C8L A;  1RRS A;  1NQY A;  2A8S A;  3X0L A;  3GRN A;  1VHZ A;  5FSO A;  1PUN A;  1MUT A;  2I6K A;  3A6U A;  3Q1P A;  1SU2 A;  2A8Q A;  2ICJ A;  3E57 A;  4J7H A;  1VK6 A;  1G0S A;  2CZR A;  3O52 A;  3SMD A;  3X0R A;  1HX3 A;  1X51 A;  1MP2 A;  3DUP A;  3HYQ A;  4KG4 A;  1NFZ A;  1TUM A;  3CNG A;  3KVH A;  4N1T A;  5GHM A;  1VIU A;  3MCF A;  4S2X A;  3J7Y e;  3I7U A;  1VRL A;  3X0Q A;  4S2V A;  1MK1 A;  2QJT A;  1V8W A;  3I9X A;  4K6E A;  1OW2 A;  5CFI A;  2O1C A;  5GHI A;  2PNY A;  3X0S A;  3MDG A;  1V8R A;  2YYH A;  1MR2 A;  1PPV A;  4N1U A;  1SJY A;  4MPO A;  3FFU A;  3MGM A;  3ZR0 A;  1PPX A;  1Q27 A;  2O5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...