1KTGA

Crystal structure of a c. elegans ap4a hydrolase binary complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
VVKAAGLVIYRKLAGKIEFLLLQASYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLFYEAKGKPKSVKYWLAKLNNPDDVQLSHEHQNWKWCELEDAIKIADYAEMGSLLRKFSAFLAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Diadenosine Tetraphosphate Hydrolase
publication title The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 36
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2002-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1ktgA00
2KDWA 3MGMA 2FMLA 3A6UA 2CL3A 2DHOA 4S2WA 3BM4A 5FSKA 3Q2TA 4N1TA 3FK9A 1X51A 5GHJA 1V8LA 3BHOA 2I6KA 5GHPA 3HYQA 1X83A 1K26A 5I8UA 3F6AA 5CFJA 1X84A 3OGAA 1MP2A 1MQEA 3X0MA 3E57A 3O8SA 2VNQA 1VRLA 1PPXA 4ICKA 4K6EA 3A6TA 1OW2A 3P6YA 1GA7A 1V8VA 3BAPA 4IJXA 1V8UA 4ILQA 5HZXA 1VIQA 4YPHA 3FCMA 3N77A 1SZ3A 1MK1A 2YVMA 3X0PA 3Q93A 4YPRA 2PNYA 3I9XA 3SHDA 1F3YA 1V8WA 3ZR1A 1VHGA 5FSMA 4ZG0A 1NQZA 3X0NA 3X0IA 1JRKA 3X0KA 1VC9A 3EXQA 2ICKA 3DUPA 4KTBA 3X0QA 3O6ZA 3RH7A 2RRKA 1Q54A 2A8QA 4NFXA 2GB5A 3I7UA 4HVYA 5ANTA 3DKUA 3MDGA 1PVFA 2A8PA 1JKNA 1U20A 2FKBA 2W4EA 3GRNA 3O61A 1V8RA 3GZ8A 2ICJA 5ANUA 2YVPA 1VC8A 4KG4A 2GT4A 1MQWA 2KDVA 3I7VA 3N9UA 5C8LA 1MUTA 1KT9A 5DD4A 1SJYA 1SU2A 1VCDA 5GHMA 1SOIA 3AC9A 3FJYA 3HHJA 2A8RA 2YVNA 3Q1PA 4C9XA 1HX3A 1Q27A 2A6TA 2I8TA 5GHIA 2QJTA 3Q91A 5ANWA 5DDGA 1IRYA 1QVJA 1VHZA 3GG6A 2O5WA 3R03A 4S2XA 3FSPA 1RRQA 2O1CA 4JZTA 3X0LA 3CNGA 3FFUA 1RYAA 2Q9PA 3O52A 3H95A 1PPWA 3EEUA 2G73A 1KHZA 1HZTA 2DSBA 3WHWA 1PUSA 5BS6A 3GZ6A 3SMDA 1TUMA 3X0OA 4KYXA 3A6SA 3A6VA 5ANSA 3ACAA 3X0RA 4JZVA 4N1UA 5IW4A 1K2EA 4NFWA 5FSNA 5BONA 1PUQA 2VNPA 4MPOA 2AZWA 2R5WA 3U53A 4V14A 1XSBA 5FSLA 2A8TA 5CFIA 5C7TA 4DYWA 1VK6A 2PQVA 3GWYA 3GZ5A 3QSJA 5FSOA 1V8MA 1NFSA 2I8UA 3EF5A 4S2YA 1XSAA 1V8NA 1G0SA 5DPKA 4C9WA 1PPVA 3MCFA 5FSIA 1V8YA 3O69A 3MDIA 1Q33A 5GHOA 2FVVA 2XSQA 2GT2A 3Q4IA 1RRSA 2YVOA 1G9QA 1MR2A 1PUNA 4JZSA 3X0JA 4YOQA 3KVHA 5C7QA 1V8SA 3ID9A 2J8QA 3Q2SA 4HFQA 5ANVA 3COUA 5IW5A 2QKMB 2B2KA 2DSCA 1I9AA 5LPGA 3J7Ye 2A8SA 2B06A 2O5FA 2YYHA 2DUKA 5DEQA 5GHNA 4JZUA 2QJOA 1NFZA 2JVBA 3SONA 2DSDA 1KTGA 3L85A 1V8TA 3P5TA 4KG3A 3X0SA 2B0VA 2G74A 3G0QA 4S2VA 1VIUA 1R67A 3EESA 3ZR0A 1XSCA 5GHQA 5ISYA 1NQYA 1V8IA 3F13A
chains in the Genus database with same CATH superfamily
2KDWA 3MGMA 2FMLA 3A6UA 2CL3A 2DHOA 4S2WA 3BM4A 5FSKA 3Q2TA 4N1TA 3FK9A 1X51A 5GHJA 1V8LA 3BHOA 2I6KA 5GHPA 3HYQA 1X83A 1K26A 5I8UA 3F6AA 5CFJA 1X84A 3OGAA 1MP2A 1MQEA 3X0MA 3E57A 3O8SA 2VNQA 1VRLA 1PPXA 4ICKA 4K6EA 3A6TA 1OW2A 3P6YA 1GA7A 1V8VA 3BAPA 4IJXA 1V8UA 4ILQA 5HZXA 1VIQA 4YPHA 3FCMA 3N77A 1SZ3A 1MK1A 2YVMA 3X0PA 3Q93A 4YPRA 2PNYA 3I9XA 3SHDA 1F3YA 1V8WA 3ZR1A 1VHGA 5FSMA 4ZG0A 1NQZA 3X0NA 3X0IA 1JRKA 3X0KA 1VC9A 3EXQA 2ICKA 3DUPA 4KTBA 3X0QA 3O6ZA 3RH7A 2RRKA 1Q54A 2A8QA 4NFXA 2GB5A 3I7UA 4HVYA 5ANTA 3DKUA 3MDGA 1PVFA 2A8PA 1JKNA 1U20A 2FKBA 2W4EA 3GRNA 3O61A 1V8RA 3GZ8A 2ICJA 5ANUA 2YVPA 1VC8A 4KG4A 2GT4A 4J7GA 1MQWA 2KDVA 3I7VA 3N9UA 5C8LA 1MUTA 1KT9A 5DD4A 1SJYA 1SU2A 1VCDA 5GHMA 1SOIA 3AC9A 3FJYA 3HHJA 2A8RA 2YVNA 3Q1PA 4C9XA 1HX3A 1Q27A 2A6TA 2I8TA 5GHIA 2QJTA 3Q91A 5ANWA 5DDGA 1IRYA 1QVJA 1VHZA 3GG6A 2O5WA 3R03A 4S2XA 3FSPA 1RRQA 2O1CA 4JZTA 3X0LA 3CNGA 3FFUA 1RYAA 2Q9PA 3O52A 3H95A 1PPWA 3EEUA 2G73A 1KHZA 1HZTA 2DSBA 3WHWA 1PUSA 5BS6A 3GZ6A 3SMDA 1TUMA 3X0OA 4KYXA 3A6SA 3A6VA 5ANSA 3ACAA 3X0RA 4JZVA 4N1UA 5IW4A 1K2EA 4NFWA 5FSNA 5BONA 1PUQA 2CZRA 2VNPA 4MPOA 2AZWA 4J7HA 2R5WA 3U53A 4V14A 1XSBA 5FSLA 2A8TA 5CFIA 5C7TA 4DYWA 1VK6A 2PQVA 3GWYA 3GZ5A 3QSJA 5FSOA 1V8MA 1NFSA 2I8UA 3EF5A 4S2YA 1XSAA 1V8NA 1G0SA 5DPKA 4C9WA 1PPVA 3MCFA 5FSIA 1V8YA 3O69A 3MDIA 1Q33A 5GHOA 2FVVA 2XSQA 2GT2A 3Q4IA 1RRSA 2YVOA 1G9QA 1MR2A 1PUNA 4JZSA 3X0JA 4YOQA 3KVHA 5C7QA 1V8SA 3ID9A 2J8QA 3Q2SA 4HFQA 5ANVA 3COUA 5IW5A 2QKMB 2B2KA 2DSCA 1I9AA 5LPGA 3J7Ye 2A8SA 2B06A 2O5FA 2YYHA 2DUKA 5DEQA 5GHNA 4JZUA 2QJOA 1NFZA 2JVBA 3SONA 2DSDA 1KTGA 3L85A 1V8TA 3P5TA 4KG3A 3X0SA 2B0VA 2G74A 3G0QA 4S2VA 1VIUA 1R67A 3EESA 3ZR0A 1XSCA 5GHQA 5ISYA 1NQYA 1V8IA 3F13A
chains in the Genus database with same CATH topology
2KDWA 3MGMA 2FMLA 3A6UA 2CL3A 2DHOA 4S2WA 3BM4A 5FSKA 3Q2TA 4N1TA 3FK9A 1X51A 5GHJA 1V8LA 3BHOA 2I6KA 5GHPA 3HYQA 1X83A 1K26A 5I8UA 3F6AA 5CFJA 1X84A 3OGAA 1MP2A 1MQEA 3X0MA 3E57A 3O8SA 2VNQA 1VRLA 1PPXA 4ICKA 4K6EA 3A6TA 1OW2A 3P6YA 1GA7A 1V8VA 3BAPA 4IJXA 1V8UA 4ILQA 5HZXA 1VIQA 4YPHA 3FCMA 3N77A 1SZ3A 1MK1A 2YVMA 3X0PA 3Q93A 4YPRA 2PNYA 3I9XA 3SHDA 1F3YA 1V8WA 3ZR1A 1VHGA 5FSMA 4ZG0A 1NQZA 3X0NA 3X0IA 1JRKA 3X0KA 1VC9A 3EXQA 2ICKA 3DUPA 4KTBA 3X0QA 3O6ZA 3RH7A 2RRKA 1Q54A 2A8QA 4NFXA 2GB5A 3I7UA 4HVYA 5ANTA 3DKUA 3MDGA 1PVFA 2A8PA 1JKNA 1U20A 2FKBA 2W4EA 3GRNA 3O61A 1V8RA 3GZ8A 2ICJA 5ANUA 2YVPA 1VC8A 4KG4A 2GT4A 4J7GA 1MQWA 2KDVA 3I7VA 3N9UA 5C8LA 1MUTA 1KT9A 5DD4A 1SJYA 1SU2A 1VCDA 5GHMA 1SOIA 3AC9A 3FJYA 3HHJA 2A8RA 2YVNA 3Q1PA 4C9XA 1HX3A 1Q27A 2A6TA 2I8TA 5GHIA 2QJTA 3Q91A 5ANWA 5DDGA 1IRYA 1QVJA 1VHZA 3GG6A 2O5WA 3R03A 4S2XA 3FSPA 1RRQA 2O1CA 4JZTA 3X0LA 3CNGA 3FFUA 1RYAA 2Q9PA 3O52A 3H95A 1PPWA 3EEUA 2G73A 1KHZA 1HZTA 2DSBA 3WHWA 1PUSA 5BS6A 3GZ6A 3SMDA 1TUMA 3X0OA 4KYXA 3A6SA 3A6VA 5ANSA 3ACAA 3X0RA 4JZVA 4N1UA 5IW4A 1K2EA 4NFWA 5FSNA 5BONA 1PUQA 2CZRA 2VNPA 4MPOA 2AZWA 4J7HA 2R5WA 3U53A 4V14A 1XSBA 5FSLA 2A8TA 5CFIA 5C7TA 4DYWA 1VK6A 2PQVA 3GWYA 3GZ5A 3QSJA 5FSOA 1V8MA 1NFSA 2I8UA 3EF5A 4S2YA 1XSAA 1V8NA 1G0SA 5DPKA 4C9WA 1PPVA 3MCFA 5FSIA 1V8YA 3O69A 3MDIA 1Q33A 5GHOA 2FVVA 2XSQA 2GT2A 3Q4IA 1RRSA 2YVOA 1G9QA 1MR2A 1PUNA 4JZSA 3X0JA 4YOQA 3KVHA 5C7QA 1V8SA 3ID9A 2J8QA 3Q2SA 4HFQA 5ANVA 3COUA 5IW5A 2QKMB 2B2KA 2DSCA 1I9AA 5LPGA 3J7Ye 2A8SA 2B06A 2O5FA 2YYHA 2DUKA 5DEQA 5GHNA 4JZUA 2QJOA 1NFZA 2JVBA 3SONA 2DSDA 1KTGA 3L85A 1V8TA 3P5TA 4KG3A 3X0SA 2B0VA 2G74A 3G0QA 4S2VA 1VIUA 1R67A 3EESA 3ZR0A 1XSCA 5GHQA 5ISYA 1NQYA 1V8IA 3F13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDW A;  3MGM A;  2FML A;  3A6U A;  2CL3 A;  2DHO A;  4S2W A;  3BM4 A;  5FSK A;  3Q2T A;  4N1T A;  3FK9 A;  1X51 A;  5GHJ A;  1V8L A;  3BHO A;  2I6K A;  5GHP A;  3HYQ A;  1X83 A;  1K26 A;  5I8U A;  3F6A A;  5CFJ A;  1X84 A;  3OGA A;  1MP2 A;  1MQE A;  3X0M A;  3E57 A;  3O8S A;  2VNQ A;  1VRL A;  1PPX A;  4ICK A;  4K6E A;  3A6T A;  1OW2 A;  3P6Y A;  1GA7 A;  1V8V A;  3BAP A;  4IJX A;  1V8U A;  4ILQ A;  5HZX A;  1VIQ A;  4YPH A;  3FCM A;  3N77 A;  1SZ3 A;  1MK1 A;  2YVM A;  3X0P A;  3Q93 A;  4YPR A;  2PNY A;  3I9X A;  3SHD A;  1F3Y A;  1V8W A;  3ZR1 A;  1VHG A;  5FSM A;  4ZG0 A;  1NQZ A;  3X0N A;  3X0I A;  1JRK A;  3X0K A;  1VC9 A;  3EXQ A;  2ICK A;  3DUP A;  4KTB A;  3X0Q A;  3O6Z A;  3RH7 A;  2RRK A;  1Q54 A;  2A8Q A;  4NFX A;  2GB5 A;  3I7U A;  4HVY A;  5ANT A;  3DKU A;  3MDG A;  1PVF A;  2A8P A;  1JKN A;  1U20 A;  2FKB A;  2W4E A;  3GRN A;  3O61 A;  1V8R A;  3GZ8 A;  2ICJ A;  5ANU A;  2YVP A;  1VC8 A;  4KG4 A;  2GT4 A;  1MQW A;  2KDV A;  3I7V A;  3N9U A;  5C8L A;  1MUT A;  1KT9 A;  5DD4 A;  1SJY A;  1SU2 A;  1VCD A;  5GHM A;  1SOI A;  3AC9 A;  3FJY A;  3HHJ A;  2A8R A;  2YVN A;  3Q1P A;  4C9X A;  1HX3 A;  1Q27 A;  2A6T A;  2I8T A;  5GHI A;  2QJT A;  3Q91 A;  5ANW A;  5DDG A;  1IRY A;  1QVJ A;  1VHZ A;  3GG6 A;  2O5W A;  3R03 A;  4S2X A;  3FSP A;  1RRQ A;  2O1C A;  4JZT A;  3X0L A;  3CNG A;  3FFU A;  1RYA A;  2Q9P A;  3O52 A;  3H95 A;  1PPW A;  3EEU A;  2G73 A;  1KHZ A;  1HZT A;  2DSB A;  3WHW A;  1PUS A;  5BS6 A;  3GZ6 A;  3SMD A;  1TUM A;  3X0O A;  4KYX A;  3A6S A;  3A6V A;  5ANS A;  3ACA A;  3X0R A;  4JZV A;  4N1U A;  5IW4 A;  1K2E A;  4NFW A;  5FSN A;  5BON A;  1PUQ A;  2VNP A;  4MPO A;  2AZW A;  2R5W A;  3U53 A;  4V14 A;  1XSB A;  5FSL A;  2A8T A;  5CFI A;  5C7T A;  4DYW A;  1VK6 A;  2PQV A;  3GWY A;  3GZ5 A;  3QSJ A;  5FSO A;  1V8M A;  1NFS A;  2I8U A;  3EF5 A;  4S2Y A;  1XSA A;  1V8N A;  1G0S A;  5DPK A;  4C9W A;  1PPV A;  3MCF A;  5FSI A;  1V8Y A;  3O69 A;  3MDI A;  1Q33 A;  5GHO A;  2FVV A;  2XSQ A;  2GT2 A;  3Q4I A;  1RRS A;  2YVO A;  1G9Q A;  1MR2 A;  1PUN A;  4JZS A;  3X0J A;  4YOQ A;  3KVH A;  5C7Q A;  1V8S A;  3ID9 A;  2J8Q A;  3Q2S A;  4HFQ A;  5ANV A;  3COU A;  5IW5 A;  2QKM B;  2B2K A;  2DSC A;  1I9A A;  5LPG A;  3J7Y e;  2A8S A;  2B06 A;  2O5F A;  2YYH A;  2DUK A;  5DEQ A;  5GHN A;  4JZU A;  2QJO A;  1NFZ A;  2JVB A;  3SON A;  2DSD A;  1KTG A;  3L85 A;  1V8T A;  3P5T A;  4KG3 A;  3X0S A;  2B0V A;  2G74 A;  3G0Q A;  4S2V A;  1VIU A;  1R67 A;  3EES A;  3ZR0 A;  1XSC A;  5GHQ A;  5ISY A;  1NQY A;  1V8I A;  3F13 A; 
#chains in the Genus database with same CATH topology
 2KDW A;  3MGM A;  2FML A;  3A6U A;  2CL3 A;  2DHO A;  4S2W A;  3BM4 A;  5FSK A;  3Q2T A;  4N1T A;  3FK9 A;  1X51 A;  5GHJ A;  1V8L A;  3BHO A;  2I6K A;  5GHP A;  3HYQ A;  1X83 A;  1K26 A;  5I8U A;  3F6A A;  5CFJ A;  1X84 A;  3OGA A;  1MP2 A;  1MQE A;  3X0M A;  3E57 A;  3O8S A;  2VNQ A;  1VRL A;  1PPX A;  4ICK A;  4K6E A;  3A6T A;  1OW2 A;  3P6Y A;  1GA7 A;  1V8V A;  3BAP A;  4IJX A;  1V8U A;  4ILQ A;  5HZX A;  1VIQ A;  4YPH A;  3FCM A;  3N77 A;  1SZ3 A;  1MK1 A;  2YVM A;  3X0P A;  3Q93 A;  4YPR A;  2PNY A;  3I9X A;  3SHD A;  1F3Y A;  1V8W A;  3ZR1 A;  1VHG A;  5FSM A;  4ZG0 A;  1NQZ A;  3X0N A;  3X0I A;  1JRK A;  3X0K A;  1VC9 A;  3EXQ A;  2ICK A;  3DUP A;  4KTB A;  3X0Q A;  3O6Z A;  3RH7 A;  2RRK A;  1Q54 A;  2A8Q A;  4NFX A;  2GB5 A;  3I7U A;  4HVY A;  5ANT A;  3DKU A;  3MDG A;  1PVF A;  2A8P A;  1JKN A;  1U20 A;  2FKB A;  2W4E A;  3GRN A;  3O61 A;  1V8R A;  3GZ8 A;  2ICJ A;  5ANU A;  2YVP A;  1VC8 A;  4KG4 A;  2GT4 A;  4J7G A;  1MQW A;  2KDV A;  3I7V A;  3N9U A;  5C8L A;  1MUT A;  1KT9 A;  5DD4 A;  1SJY A;  1SU2 A;  1VCD A;  5GHM A;  1SOI A;  3AC9 A;  3FJY A;  3HHJ A;  2A8R A;  2YVN A;  3Q1P A;  4C9X A;  1HX3 A;  1Q27 A;  2A6T A;  2I8T A;  5GHI A;  2QJT A;  3Q91 A;  5ANW A;  5DDG A;  1IRY A;  1QVJ A;  1VHZ A;  3GG6 A;  2O5W A;  3R03 A;  4S2X A;  3FSP A;  1RRQ A;  2O1C A;  4JZT A;  3X0L A;  3CNG A;  3FFU A;  1RYA A;  2Q9P A;  3O52 A;  3H95 A;  1PPW A;  3EEU A;  2G73 A;  1KHZ A;  1HZT A;  2DSB A;  3WHW A;  1PUS A;  5BS6 A;  3GZ6 A;  3SMD A;  1TUM A;  3X0O A;  4KYX A;  3A6S A;  3A6V A;  5ANS A;  3ACA A;  3X0R A;  4JZV A;  4N1U A;  5IW4 A;  1K2E A;  4NFW A;  5FSN A;  5BON A;  1PUQ A;  2CZR A;  2VNP A;  4MPO A;  2AZW A;  4J7H A;  2R5W A;  3U53 A;  4V14 A;  1XSB A;  5FSL A;  2A8T A;  5CFI A;  5C7T A;  4DYW A;  1VK6 A;  2PQV A;  3GWY A;  3GZ5 A;  3QSJ A;  5FSO A;  1V8M A;  1NFS A;  2I8U A;  3EF5 A;  4S2Y A;  1XSA A;  1V8N A;  1G0S A;  5DPK A;  4C9W A;  1PPV A;  3MCF A;  5FSI A;  1V8Y A;  3O69 A;  3MDI A;  1Q33 A;  5GHO A;  2FVV A;  2XSQ A;  2GT2 A;  3Q4I A;  1RRS A;  2YVO A;  1G9Q A;  1MR2 A;  1PUN A;  4JZS A;  3X0J A;  4YOQ A;  3KVH A;  5C7Q A;  1V8S A;  3ID9 A;  2J8Q A;  3Q2S A;  4HFQ A;  5ANV A;  3COU A;  5IW5 A;  2QKM B;  2B2K A;  2DSC A;  1I9A A;  5LPG A;  3J7Y e;  2A8S A;  2B06 A;  2O5F A;  2YYH A;  2DUK A;  5DEQ A;  5GHN A;  4JZU A;  2QJO A;  1NFZ A;  2JVB A;  3SON A;  2DSD A;  1KTG A;  3L85 A;  1V8T A;  3P5T A;  4KG3 A;  3X0S A;  2B0V A;  2G74 A;  3G0Q A;  4S2V A;  1VIU A;  1R67 A;  3EES A;  3ZR0 A;  1XSC A;  5GHQ A;  5ISY A;  1NQY A;  1V8I A;  3F13 A; 
#chains in the Genus database with same CATH homology
 2KDW A;  3MGM A;  2FML A;  3A6U A;  2CL3 A;  2DHO A;  4S2W A;  3BM4 A;  5FSK A;  3Q2T A;  4N1T A;  3FK9 A;  1X51 A;  5GHJ A;  1V8L A;  3BHO A;  2I6K A;  5GHP A;  3HYQ A;  1X83 A;  1K26 A;  5I8U A;  3F6A A;  5CFJ A;  1X84 A;  3OGA A;  1MP2 A;  1MQE A;  3X0M A;  3E57 A;  3O8S A;  2VNQ A;  1VRL A;  1PPX A;  4ICK A;  4K6E A;  3A6T A;  1OW2 A;  3P6Y A;  1GA7 A;  1V8V A;  3BAP A;  4IJX A;  1V8U A;  4ILQ A;  5HZX A;  1VIQ A;  4YPH A;  3FCM A;  3N77 A;  1SZ3 A;  1MK1 A;  2YVM A;  3X0P A;  3Q93 A;  4YPR A;  2PNY A;  3I9X A;  3SHD A;  1F3Y A;  1V8W A;  3ZR1 A;  1VHG A;  5FSM A;  4ZG0 A;  1NQZ A;  3X0N A;  3X0I A;  1JRK A;  3X0K A;  1VC9 A;  3EXQ A;  2ICK A;  3DUP A;  4KTB A;  3X0Q A;  3O6Z A;  3RH7 A;  2RRK A;  1Q54 A;  2A8Q A;  4NFX A;  2GB5 A;  3I7U A;  4HVY A;  5ANT A;  3DKU A;  3MDG A;  1PVF A;  2A8P A;  1JKN A;  1U20 A;  2FKB A;  2W4E A;  3GRN A;  3O61 A;  1V8R A;  3GZ8 A;  2ICJ A;  5ANU A;  2YVP A;  1VC8 A;  4KG4 A;  2GT4 A;  4J7G A;  1MQW A;  2KDV A;  3I7V A;  3N9U A;  5C8L A;  1MUT A;  1KT9 A;  5DD4 A;  1SJY A;  1SU2 A;  1VCD A;  5GHM A;  1SOI A;  3AC9 A;  3FJY A;  3HHJ A;  2A8R A;  2YVN A;  3Q1P A;  4C9X A;  1HX3 A;  1Q27 A;  2A6T A;  2I8T A;  5GHI A;  2QJT A;  3Q91 A;  5ANW A;  5DDG A;  1IRY A;  1QVJ A;  1VHZ A;  3GG6 A;  2O5W A;  3R03 A;  4S2X A;  3FSP A;  1RRQ A;  2O1C A;  4JZT A;  3X0L A;  3CNG A;  3FFU A;  1RYA A;  2Q9P A;  3O52 A;  3H95 A;  1PPW A;  3EEU A;  2G73 A;  1KHZ A;  1HZT A;  2DSB A;  3WHW A;  1PUS A;  5BS6 A;  3GZ6 A;  3SMD A;  1TUM A;  3X0O A;  4KYX A;  3A6S A;  3A6V A;  5ANS A;  3ACA A;  3X0R A;  4JZV A;  4N1U A;  5IW4 A;  1K2E A;  4NFW A;  5FSN A;  5BON A;  1PUQ A;  2CZR A;  2VNP A;  4MPO A;  2AZW A;  4J7H A;  2R5W A;  3U53 A;  4V14 A;  1XSB A;  5FSL A;  2A8T A;  5CFI A;  5C7T A;  4DYW A;  1VK6 A;  2PQV A;  3GWY A;  3GZ5 A;  3QSJ A;  5FSO A;  1V8M A;  1NFS A;  2I8U A;  3EF5 A;  4S2Y A;  1XSA A;  1V8N A;  1G0S A;  5DPK A;  4C9W A;  1PPV A;  3MCF A;  5FSI A;  1V8Y A;  3O69 A;  3MDI A;  1Q33 A;  5GHO A;  2FVV A;  2XSQ A;  2GT2 A;  3Q4I A;  1RRS A;  2YVO A;  1G9Q A;  1MR2 A;  1PUN A;  4JZS A;  3X0J A;  4YOQ A;  3KVH A;  5C7Q A;  1V8S A;  3ID9 A;  2J8Q A;  3Q2S A;  4HFQ A;  5ANV A;  3COU A;  5IW5 A;  2QKM B;  2B2K A;  2DSC A;  1I9A A;  5LPG A;  3J7Y e;  2A8S A;  2B06 A;  2O5F A;  2YYH A;  2DUK A;  5DEQ A;  5GHN A;  4JZU A;  2QJO A;  1NFZ A;  2JVB A;  3SON A;  2DSD A;  1KTG A;  3L85 A;  1V8T A;  3P5T A;  4KG3 A;  3X0S A;  2B0V A;  2G74 A;  3G0Q A;  4S2V A;  1VIU A;  1R67 A;  3EES A;  3ZR0 A;  1XSC A;  5GHQ A;  5ISY A;  1NQY A;  1V8I A;  3F13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...