1V8LA

Structure analysis of the adp-ribose pyrophosphatase complexed with adp-ribose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
157
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEADEDEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 157
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8lA00
4JZUA 3GZ6A 1PPWA 2A8QA 5FSLA 3I9XA 1OW2A 2A8RA 3O52A 4KG3A 4ZG0A 4S2XA 1VRLA 3Q2TA 1V8UA 5IW4A 2DSCA 3Q2SA 2JVBA 3GZ5A 2A8TA 1K2EA 2YVMA 5C7TA 1MR2A 1V8SA 2J8QA 2ICJA 1QVJA 1VIQA 1VC8A 3O61A 3R03A 4YOQA 5DPKA 3CNGA 4N1TA 1NQZA 3SMDA 3GWYA 3N9UA 1PUSA 2B0VA 3MDIA 4HFQA 3N77A 1PVFA 3HHJA 3O6ZA 5GHPA 3X0JA 1R67A 3GRNA 3MCFA 1MQEA 3I7UA 3EEUA 1GA7A 5C8LA 3P5TA 4MPOA 1PUQA 4DYWA 4NFWA 2VNQA 4JZTA 1VC9A 2O5FA 3EF5A 5ANUA 2I8TA 3E57A 1V8NA 2CL3A 3X0MA 3ID9A 2DSBA 2FMLA 3O69A 1TUMA 2A8SA 4KYXA 1V8WA 3ZR0A 3FSPA 2O1CA 1KTGA 3DKUA 3L85A 4HVYA 1SOIA 3ACAA 3EXQA 3FK9A 3X0KA 3DUPA 1KT9A 1PUNA 4IJXA 2G73A 2DHOA 2VNPA 1NFSA 2GB5A 1JRKA 5ANSA 5DEQA 1MUTA 4JZSA 1JKNA 1HX3A 3Q4IA 3X0PA 3X0QA 5GHMA 2QKMB 4S2YA 5CFJA 5GHIA 1RYAA 5I8UA 1XSAA 4C9XA 5FSIA 1MP2A 5BS6A 1V8RA 2PNYA 1SU2A 3EESA 4NFXA 3F13A 3FJYA 3AC9A 5DD4A 4K6EA 1PPXA 1SZ3A 3A6SA 1V8MA 3BM4A 3U53A 5GHQA 1VCDA 2RRKA 5GHNA 3MGMA 3RH7A 4C9WA 4ICKA 5HZXA 3P6YA 4N1UA 5FSMA 2AZWA 2DUKA 3SHDA 1V8YA 3O8SA 1F3YA 2GT4A 3A6UA 3SONA 3BAPA 5DDGA 1PPVA 2PQVA 3Q1PA 3X0RA 1NFZA 1Q33A 3H95A 5C7QA 3J7Ye 1MK1A 3F6AA 3ZR1A 5ISYA 1U20A 2B2KA 1NQYA 2FKBA 3A6VA 3Q91A 3A6TA 3G0QA 2A8PA 3KVHA 1X83A 2I8UA 5GHOA 2GT2A 3GG6A 2A6TA 1KHZA 2R5WA 5FSOA 1HZTA 3X0IA 1X84A 4S2VA 2I6KA 3COUA 5FSKA 1SJYA 2QJTA 3WHWA 4KTBA 1VIUA 2ICKA 1G9QA 1K26A 1V8LA 1XSCA 4YPHA 4JZVA 2B06A 1VK6A 2KDWA 1MQWA 1IRYA 3HYQA 3FCMA 1V8TA 2W4EA 1V8VA 3FFUA 1Q54A 1XSBA 4S2WA 1VHZA 2FVVA 4ILQA 4YPRA 3X0NA 2YVOA 1RRQA 3X0OA 2XSQA 3X0LA 4V14A 5ANWA 2QJOA 1V8IA 2G74A 5FSNA 3I7VA 3OGAA 2KDVA 3QSJA 3Q93A 3GZ8A 5BONA 5IW5A 3MDGA 1Q27A 3BHOA 5ANVA 1I9AA 5GHJA 2Q9PA 5LPGA 1X51A 4KG4A 1RRSA 2YVPA 2YVNA 2YYHA 3X0SA 2O5WA 1G0SA 5ANTA 5CFIA 1VHGA 2DSDA
chains in the Genus database with same CATH superfamily
4JZUA 3GZ6A 1PPWA 2A8QA 5FSLA 3I9XA 1OW2A 2A8RA 3O52A 4KG3A 4ZG0A 4S2XA 1VRLA 3Q2TA 1V8UA 5IW4A 2DSCA 3Q2SA 2JVBA 3GZ5A 2A8TA 1K2EA 2YVMA 5C7TA 1MR2A 1V8SA 2J8QA 2ICJA 1QVJA 1VIQA 1VC8A 3O61A 3R03A 4YOQA 5DPKA 3CNGA 4N1TA 1NQZA 3SMDA 3GWYA 3N9UA 1PUSA 2B0VA 3MDIA 4HFQA 3N77A 1PVFA 3HHJA 3O6ZA 5GHPA 3X0JA 1R67A 3GRNA 3MCFA 1MQEA 3I7UA 3EEUA 1GA7A 5C8LA 3P5TA 4MPOA 1PUQA 4DYWA 4NFWA 2VNQA 4JZTA 1VC9A 2O5FA 3EF5A 5ANUA 2I8TA 3E57A 1V8NA 2CL3A 3X0MA 3ID9A 2DSBA 2FMLA 3O69A 1TUMA 2A8SA 4KYXA 1V8WA 3ZR0A 3FSPA 2O1CA 1KTGA 3DKUA 3L85A 4HVYA 1SOIA 3ACAA 3EXQA 3FK9A 3X0KA 3DUPA 1KT9A 1PUNA 4IJXA 2G73A 2DHOA 2VNPA 1NFSA 2GB5A 1JRKA 5ANSA 5DEQA 1MUTA 4JZSA 1JKNA 1HX3A 3Q4IA 3X0PA 3X0QA 5GHMA 2QKMB 4S2YA 5CFJA 5GHIA 4J7GA 1RYAA 5I8UA 1XSAA 4J7HA 5FSIA 1MP2A 4C9XA 5BS6A 1V8RA 2PNYA 1SU2A 3EESA 4NFXA 3F13A 3FJYA 3AC9A 5DD4A 4K6EA 1PPXA 1SZ3A 3A6SA 1V8MA 3BM4A 3U53A 5GHQA 1VCDA 2RRKA 5GHNA 3MGMA 3RH7A 4C9WA 4ICKA 5HZXA 3P6YA 4N1UA 5FSMA 2AZWA 2DUKA 3SHDA 1V8YA 3O8SA 1F3YA 2GT4A 3A6UA 3SONA 3BAPA 5DDGA 1PPVA 2PQVA 3Q1PA 3X0RA 1NFZA 1Q33A 3H95A 5C7QA 3J7Ye 1MK1A 3F6AA 3ZR1A 5ISYA 1U20A 2B2KA 1NQYA 2FKBA 3A6VA 3Q91A 3A6TA 3G0QA 2A8PA 3KVHA 1X83A 2I8UA 5GHOA 2GT2A 3GG6A 2A6TA 1KHZA 2R5WA 5FSOA 1HZTA 3X0IA 1X84A 4S2VA 2I6KA 3COUA 5FSKA 1SJYA 2QJTA 3WHWA 4KTBA 1VIUA 2CZRA 2ICKA 1G9QA 1K26A 1V8LA 1XSCA 4YPHA 4JZVA 2B06A 1VK6A 2KDWA 1MQWA 1IRYA 3HYQA 3FCMA 1V8TA 2W4EA 1V8VA 3FFUA 1Q54A 1XSBA 4S2WA 1VHZA 2FVVA 4ILQA 4YPRA 3X0NA 2YVOA 1RRQA 3X0OA 2XSQA 3X0LA 4V14A 5ANWA 2QJOA 1V8IA 2G74A 5FSNA 3I7VA 3OGAA 2KDVA 3QSJA 3Q93A 3GZ8A 5BONA 5IW5A 3MDGA 1Q27A 3BHOA 5ANVA 1I9AA 5GHJA 2Q9PA 5LPGA 1X51A 4KG4A 1RRSA 2YVPA 2YVNA 2YYHA 3X0SA 2O5WA 1G0SA 5ANTA 5CFIA 1VHGA 2DSDA
chains in the Genus database with same CATH topology
4JZUA 3GZ6A 1PPWA 2A8QA 5FSLA 3I9XA 1OW2A 2A8RA 3O52A 4KG3A 4ZG0A 4S2XA 1VRLA 3Q2TA 1V8UA 5IW4A 2DSCA 3Q2SA 2JVBA 3GZ5A 2A8TA 1K2EA 2YVMA 5C7TA 1MR2A 1V8SA 2J8QA 2ICJA 1QVJA 1VIQA 1VC8A 3O61A 3R03A 4YOQA 5DPKA 3CNGA 4N1TA 1NQZA 3SMDA 3GWYA 3N9UA 1PUSA 2B0VA 3MDIA 4HFQA 3N77A 1PVFA 3HHJA 3O6ZA 5GHPA 3X0JA 1R67A 3GRNA 3MCFA 1MQEA 3I7UA 3EEUA 1GA7A 5C8LA 3P5TA 4MPOA 1PUQA 4DYWA 4NFWA 2VNQA 4JZTA 1VC9A 2O5FA 3EF5A 5ANUA 2I8TA 3E57A 1V8NA 2CL3A 3X0MA 3ID9A 2DSBA 2FMLA 3O69A 1TUMA 2A8SA 4KYXA 1V8WA 3ZR0A 3FSPA 2O1CA 1KTGA 3DKUA 3L85A 4HVYA 1SOIA 3ACAA 3EXQA 3FK9A 3X0KA 3DUPA 1KT9A 1PUNA 4IJXA 2G73A 2DHOA 2VNPA 1NFSA 2GB5A 1JRKA 5ANSA 5DEQA 1MUTA 4JZSA 1JKNA 1HX3A 3Q4IA 3X0PA 3X0QA 5GHMA 2QKMB 4S2YA 5CFJA 5GHIA 4J7GA 1RYAA 5I8UA 1XSAA 4J7HA 5FSIA 1MP2A 4C9XA 5BS6A 1V8RA 2PNYA 1SU2A 3EESA 4NFXA 3F13A 3FJYA 3AC9A 5DD4A 4K6EA 1PPXA 1SZ3A 3A6SA 1V8MA 3BM4A 3U53A 5GHQA 1VCDA 2RRKA 5GHNA 3MGMA 3RH7A 4C9WA 4ICKA 5HZXA 3P6YA 4N1UA 5FSMA 2AZWA 2DUKA 3SHDA 1V8YA 3O8SA 1F3YA 2GT4A 3A6UA 3SONA 3BAPA 5DDGA 1PPVA 2PQVA 3Q1PA 3X0RA 1NFZA 1Q33A 3H95A 5C7QA 3J7Ye 1MK1A 3F6AA 3ZR1A 5ISYA 1U20A 2B2KA 1NQYA 2FKBA 3A6VA 3Q91A 3A6TA 3G0QA 2A8PA 3KVHA 1X83A 2I8UA 5GHOA 2GT2A 3GG6A 2A6TA 1KHZA 2R5WA 5FSOA 1HZTA 3X0IA 1X84A 4S2VA 2I6KA 3COUA 5FSKA 1SJYA 2QJTA 3WHWA 4KTBA 1VIUA 2CZRA 2ICKA 1G9QA 1K26A 1V8LA 1XSCA 4YPHA 4JZVA 2B06A 1VK6A 2KDWA 1MQWA 1IRYA 3HYQA 3FCMA 1V8TA 2W4EA 1V8VA 3FFUA 1Q54A 1XSBA 4S2WA 1VHZA 2FVVA 4ILQA 4YPRA 3X0NA 2YVOA 1RRQA 3X0OA 2XSQA 3X0LA 4V14A 5ANWA 2QJOA 1V8IA 2G74A 5FSNA 3I7VA 3OGAA 2KDVA 3QSJA 3Q93A 3GZ8A 5BONA 5IW5A 3MDGA 1Q27A 3BHOA 5ANVA 1I9AA 5GHJA 2Q9PA 5LPGA 1X51A 4KG4A 1RRSA 2YVPA 2YVNA 2YYHA 3X0SA 2O5WA 1G0SA 5ANTA 5CFIA 1VHGA 2DSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZU A;  3GZ6 A;  1PPW A;  2A8Q A;  5FSL A;  3I9X A;  1OW2 A;  2A8R A;  3O52 A;  4KG3 A;  4ZG0 A;  4S2X A;  1VRL A;  3Q2T A;  1V8U A;  5IW4 A;  2DSC A;  3Q2S A;  2JVB A;  3GZ5 A;  2A8T A;  1K2E A;  2YVM A;  5C7T A;  1MR2 A;  1V8S A;  2J8Q A;  2ICJ A;  1QVJ A;  1VIQ A;  1VC8 A;  3O61 A;  3R03 A;  4YOQ A;  5DPK A;  3CNG A;  4N1T A;  1NQZ A;  3SMD A;  3GWY A;  3N9U A;  1PUS A;  2B0V A;  3MDI A;  4HFQ A;  3N77 A;  1PVF A;  3HHJ A;  3O6Z A;  5GHP A;  3X0J A;  1R67 A;  3GRN A;  3MCF A;  1MQE A;  3I7U A;  3EEU A;  1GA7 A;  5C8L A;  3P5T A;  4MPO A;  1PUQ A;  4DYW A;  4NFW A;  2VNQ A;  4JZT A;  1VC9 A;  2O5F A;  3EF5 A;  5ANU A;  2I8T A;  3E57 A;  1V8N A;  2CL3 A;  3X0M A;  3ID9 A;  2DSB A;  2FML A;  3O69 A;  1TUM A;  2A8S A;  4KYX A;  1V8W A;  3ZR0 A;  3FSP A;  2O1C A;  1KTG A;  3DKU A;  3L85 A;  4HVY A;  1SOI A;  3ACA A;  3EXQ A;  3FK9 A;  3X0K A;  3DUP A;  1KT9 A;  1PUN A;  4IJX A;  2G73 A;  2DHO A;  2VNP A;  1NFS A;  2GB5 A;  1JRK A;  5ANS A;  5DEQ A;  1MUT A;  4JZS A;  1JKN A;  1HX3 A;  3Q4I A;  3X0P A;  3X0Q A;  5GHM A;  2QKM B;  4S2Y A;  5CFJ A;  5GHI A;  1RYA A;  5I8U A;  1XSA A;  4C9X A;  5FSI A;  1MP2 A;  5BS6 A;  1V8R A;  2PNY A;  1SU2 A;  3EES A;  4NFX A;  3F13 A;  3FJY A;  3AC9 A;  5DD4 A;  4K6E A;  1PPX A;  1SZ3 A;  3A6S A;  1V8M A;  3BM4 A;  3U53 A;  5GHQ A;  1VCD A;  2RRK A;  5GHN A;  3MGM A;  3RH7 A;  4C9W A;  4ICK A;  5HZX A;  3P6Y A;  4N1U A;  5FSM A;  2AZW A;  2DUK A;  3SHD A;  1V8Y A;  3O8S A;  1F3Y A;  2GT4 A;  3A6U A;  3SON A;  3BAP A;  5DDG A;  1PPV A;  2PQV A;  3Q1P A;  3X0R A;  1NFZ A;  1Q33 A;  3H95 A;  5C7Q A;  3J7Y e;  1MK1 A;  3F6A A;  3ZR1 A;  5ISY A;  1U20 A;  2B2K A;  1NQY A;  2FKB A;  3A6V A;  3Q91 A;  3A6T A;  3G0Q A;  2A8P A;  3KVH A;  1X83 A;  2I8U A;  5GHO A;  2GT2 A;  3GG6 A;  2A6T A;  1KHZ A;  2R5W A;  5FSO A;  1HZT A;  3X0I A;  1X84 A;  4S2V A;  2I6K A;  3COU A;  5FSK A;  1SJY A;  2QJT A;  3WHW A;  4KTB A;  1VIU A;  2ICK A;  1G9Q A;  1K26 A;  1V8L A;  1XSC A;  4YPH A;  4JZV A;  2B06 A;  1VK6 A;  2KDW A;  1MQW A;  1IRY A;  3HYQ A;  3FCM A;  1V8T A;  2W4E A;  1V8V A;  3FFU A;  1Q54 A;  1XSB A;  4S2W A;  1VHZ A;  2FVV A;  4ILQ A;  4YPR A;  3X0N A;  2YVO A;  1RRQ A;  3X0O A;  2XSQ A;  3X0L A;  4V14 A;  5ANW A;  2QJO A;  1V8I A;  2G74 A;  5FSN A;  3I7V A;  3OGA A;  2KDV A;  3QSJ A;  3Q93 A;  3GZ8 A;  5BON A;  5IW5 A;  3MDG A;  1Q27 A;  3BHO A;  5ANV A;  1I9A A;  5GHJ A;  2Q9P A;  5LPG A;  1X51 A;  4KG4 A;  1RRS A;  2YVP A;  2YVN A;  2YYH A;  3X0S A;  2O5W A;  1G0S A;  5ANT A;  5CFI A;  1VHG A;  2DSD A; 
#chains in the Genus database with same CATH topology
 4JZU A;  3GZ6 A;  1PPW A;  2A8Q A;  5FSL A;  3I9X A;  1OW2 A;  2A8R A;  3O52 A;  4KG3 A;  4ZG0 A;  4S2X A;  1VRL A;  3Q2T A;  1V8U A;  5IW4 A;  2DSC A;  3Q2S A;  2JVB A;  3GZ5 A;  2A8T A;  1K2E A;  2YVM A;  5C7T A;  1MR2 A;  1V8S A;  2J8Q A;  2ICJ A;  1QVJ A;  1VIQ A;  1VC8 A;  3O61 A;  3R03 A;  4YOQ A;  5DPK A;  3CNG A;  4N1T A;  1NQZ A;  3SMD A;  3GWY A;  3N9U A;  1PUS A;  2B0V A;  3MDI A;  4HFQ A;  3N77 A;  1PVF A;  3HHJ A;  3O6Z A;  5GHP A;  3X0J A;  1R67 A;  3GRN A;  3MCF A;  1MQE A;  3I7U A;  3EEU A;  1GA7 A;  5C8L A;  3P5T A;  4MPO A;  1PUQ A;  4DYW A;  4NFW A;  2VNQ A;  4JZT A;  1VC9 A;  2O5F A;  3EF5 A;  5ANU A;  2I8T A;  3E57 A;  1V8N A;  2CL3 A;  3X0M A;  3ID9 A;  2DSB A;  2FML A;  3O69 A;  1TUM A;  2A8S A;  4KYX A;  1V8W A;  3ZR0 A;  3FSP A;  2O1C A;  1KTG A;  3DKU A;  3L85 A;  4HVY A;  1SOI A;  3ACA A;  3EXQ A;  3FK9 A;  3X0K A;  3DUP A;  1KT9 A;  1PUN A;  4IJX A;  2G73 A;  2DHO A;  2VNP A;  1NFS A;  2GB5 A;  1JRK A;  5ANS A;  5DEQ A;  1MUT A;  4JZS A;  1JKN A;  1HX3 A;  3Q4I A;  3X0P A;  3X0Q A;  5GHM A;  2QKM B;  4S2Y A;  5CFJ A;  5GHI A;  4J7G A;  1RYA A;  5I8U A;  1XSA A;  4J7H A;  5FSI A;  1MP2 A;  4C9X A;  5BS6 A;  1V8R A;  2PNY A;  1SU2 A;  3EES A;  4NFX A;  3F13 A;  3FJY A;  3AC9 A;  5DD4 A;  4K6E A;  1PPX A;  1SZ3 A;  3A6S A;  1V8M A;  3BM4 A;  3U53 A;  5GHQ A;  1VCD A;  2RRK A;  5GHN A;  3MGM A;  3RH7 A;  4C9W A;  4ICK A;  5HZX A;  3P6Y A;  4N1U A;  5FSM A;  2AZW A;  2DUK A;  3SHD A;  1V8Y A;  3O8S A;  1F3Y A;  2GT4 A;  3A6U A;  3SON A;  3BAP A;  5DDG A;  1PPV A;  2PQV A;  3Q1P A;  3X0R A;  1NFZ A;  1Q33 A;  3H95 A;  5C7Q A;  3J7Y e;  1MK1 A;  3F6A A;  3ZR1 A;  5ISY A;  1U20 A;  2B2K A;  1NQY A;  2FKB A;  3A6V A;  3Q91 A;  3A6T A;  3G0Q A;  2A8P A;  3KVH A;  1X83 A;  2I8U A;  5GHO A;  2GT2 A;  3GG6 A;  2A6T A;  1KHZ A;  2R5W A;  5FSO A;  1HZT A;  3X0I A;  1X84 A;  4S2V A;  2I6K A;  3COU A;  5FSK A;  1SJY A;  2QJT A;  3WHW A;  4KTB A;  1VIU A;  2CZR A;  2ICK A;  1G9Q A;  1K26 A;  1V8L A;  1XSC A;  4YPH A;  4JZV A;  2B06 A;  1VK6 A;  2KDW A;  1MQW A;  1IRY A;  3HYQ A;  3FCM A;  1V8T A;  2W4E A;  1V8V A;  3FFU A;  1Q54 A;  1XSB A;  4S2W A;  1VHZ A;  2FVV A;  4ILQ A;  4YPR A;  3X0N A;  2YVO A;  1RRQ A;  3X0O A;  2XSQ A;  3X0L A;  4V14 A;  5ANW A;  2QJO A;  1V8I A;  2G74 A;  5FSN A;  3I7V A;  3OGA A;  2KDV A;  3QSJ A;  3Q93 A;  3GZ8 A;  5BON A;  5IW5 A;  3MDG A;  1Q27 A;  3BHO A;  5ANV A;  1I9A A;  5GHJ A;  2Q9P A;  5LPG A;  1X51 A;  4KG4 A;  1RRS A;  2YVP A;  2YVN A;  2YYH A;  3X0S A;  2O5W A;  1G0S A;  5ANT A;  5CFI A;  1VHG A;  2DSD A; 
#chains in the Genus database with same CATH homology
 4JZU A;  3GZ6 A;  1PPW A;  2A8Q A;  5FSL A;  3I9X A;  1OW2 A;  2A8R A;  3O52 A;  4KG3 A;  4ZG0 A;  4S2X A;  1VRL A;  3Q2T A;  1V8U A;  5IW4 A;  2DSC A;  3Q2S A;  2JVB A;  3GZ5 A;  2A8T A;  1K2E A;  2YVM A;  5C7T A;  1MR2 A;  1V8S A;  2J8Q A;  2ICJ A;  1QVJ A;  1VIQ A;  1VC8 A;  3O61 A;  3R03 A;  4YOQ A;  5DPK A;  3CNG A;  4N1T A;  1NQZ A;  3SMD A;  3GWY A;  3N9U A;  1PUS A;  2B0V A;  3MDI A;  4HFQ A;  3N77 A;  1PVF A;  3HHJ A;  3O6Z A;  5GHP A;  3X0J A;  1R67 A;  3GRN A;  3MCF A;  1MQE A;  3I7U A;  3EEU A;  1GA7 A;  5C8L A;  3P5T A;  4MPO A;  1PUQ A;  4DYW A;  4NFW A;  2VNQ A;  4JZT A;  1VC9 A;  2O5F A;  3EF5 A;  5ANU A;  2I8T A;  3E57 A;  1V8N A;  2CL3 A;  3X0M A;  3ID9 A;  2DSB A;  2FML A;  3O69 A;  1TUM A;  2A8S A;  4KYX A;  1V8W A;  3ZR0 A;  3FSP A;  2O1C A;  1KTG A;  3DKU A;  3L85 A;  4HVY A;  1SOI A;  3ACA A;  3EXQ A;  3FK9 A;  3X0K A;  3DUP A;  1KT9 A;  1PUN A;  4IJX A;  2G73 A;  2DHO A;  2VNP A;  1NFS A;  2GB5 A;  1JRK A;  5ANS A;  5DEQ A;  1MUT A;  4JZS A;  1JKN A;  1HX3 A;  3Q4I A;  3X0P A;  3X0Q A;  5GHM A;  2QKM B;  4S2Y A;  5CFJ A;  5GHI A;  4J7G A;  1RYA A;  5I8U A;  1XSA A;  4J7H A;  5FSI A;  1MP2 A;  4C9X A;  5BS6 A;  1V8R A;  2PNY A;  1SU2 A;  3EES A;  4NFX A;  3F13 A;  3FJY A;  3AC9 A;  5DD4 A;  4K6E A;  1PPX A;  1SZ3 A;  3A6S A;  1V8M A;  3BM4 A;  3U53 A;  5GHQ A;  1VCD A;  2RRK A;  5GHN A;  3MGM A;  3RH7 A;  4C9W A;  4ICK A;  5HZX A;  3P6Y A;  4N1U A;  5FSM A;  2AZW A;  2DUK A;  3SHD A;  1V8Y A;  3O8S A;  1F3Y A;  2GT4 A;  3A6U A;  3SON A;  3BAP A;  5DDG A;  1PPV A;  2PQV A;  3Q1P A;  3X0R A;  1NFZ A;  1Q33 A;  3H95 A;  5C7Q A;  3J7Y e;  1MK1 A;  3F6A A;  3ZR1 A;  5ISY A;  1U20 A;  2B2K A;  1NQY A;  2FKB A;  3A6V A;  3Q91 A;  3A6T A;  3G0Q A;  2A8P A;  3KVH A;  1X83 A;  2I8U A;  5GHO A;  2GT2 A;  3GG6 A;  2A6T A;  1KHZ A;  2R5W A;  5FSO A;  1HZT A;  3X0I A;  1X84 A;  4S2V A;  2I6K A;  3COU A;  5FSK A;  1SJY A;  2QJT A;  3WHW A;  4KTB A;  1VIU A;  2CZR A;  2ICK A;  1G9Q A;  1K26 A;  1V8L A;  1XSC A;  4YPH A;  4JZV A;  2B06 A;  1VK6 A;  2KDW A;  1MQW A;  1IRY A;  3HYQ A;  3FCM A;  1V8T A;  2W4E A;  1V8V A;  3FFU A;  1Q54 A;  1XSB A;  4S2W A;  1VHZ A;  2FVV A;  4ILQ A;  4YPR A;  3X0N A;  2YVO A;  1RRQ A;  3X0O A;  2XSQ A;  3X0L A;  4V14 A;  5ANW A;  2QJO A;  1V8I A;  2G74 A;  5FSN A;  3I7V A;  3OGA A;  2KDV A;  3QSJ A;  3Q93 A;  3GZ8 A;  5BON A;  5IW5 A;  3MDG A;  1Q27 A;  3BHO A;  5ANV A;  1I9A A;  5GHJ A;  2Q9P A;  5LPG A;  1X51 A;  4KG4 A;  1RRS A;  2YVP A;  2YVN A;  2YYH A;  3X0S A;  2O5W A;  1G0S A;  5ANT A;  5CFI A;  1VHG A;  2DSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...