1V8SA

Crystal structure analusis of the adp-ribose pyrophosphatase complexed with amp and mg
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
152
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 36
structure length 152
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8sA00
2YVMA 3I7UA 1RRQA 4N1UA 1V8IA 1I9AA 1V8MA 5DEQA 3FFUA 5ANVA 3HYQA 4KTBA 1VK6A 5CFJA 4ZG0A 2DSDA 5C8LA 3GZ5A 3P5TA 1VC8A 2ICKA 3EXQA 4C9WA 5C7QA 3X0OA 3X0QA 3MDIA 3Q2TA 1KTGA 2I6KA 3MGMA 1MK1A 2QKMB 5IW4A 3SMDA 5FSMA 3ZR1A 3ACAA 1MP2A 5DD4A 1V8WA 3GZ6A 3COUA 1OW2A 1RYAA 5GHPA 3I9XA 4YOQA 2B0VA 4K6EA 3FCMA 3Q2SA 1NFZA 3N9UA 5CFIA 3DUPA 3KVHA 2I8TA 1VIQA 3MDGA 5GHMA 3G0QA 2RRKA 1PUNA 2O5FA 1KT9A 2W4EA 4KG4A 5IW5A 3Q91A 1K26A 3O61A 1K2EA 4JZSA 1Q33A 3GZ8A 5FSNA 2A6TA 3GRNA 1X83A 2AZWA 3RH7A 4YPHA 1PUSA 1V8RA 3F6AA 3I7VA 3SHDA 1VC9A 2B06A 3F13A 5BONA 3FSPA 3J7Ye 3DKUA 4YPRA 2QJOA 2VNPA 4HFQA 2G74A 1PPWA 3QSJA 4DYWA 2KDVA 3X0KA 1Q54A 2YVNA 4KYXA 1PUQA 2VNQA 2FMLA 2DHOA 2J8QA 1V8VA 2A8SA 2PNYA 3N77A 4V14A 2A8TA 2A8QA 5GHOA 1VCDA 5BS6A 1TUMA 2QJTA 2XSQA 1MUTA 1SOIA 2CL3A 3U53A 3O6ZA 3X0RA 1JKNA 3X0SA 1V8LA 1SJYA 1HX3A 2PQVA 1HZTA 3X0LA 1GA7A 2KDWA 2DUKA 3FK9A 3H95A 5I8UA 1V8SA 3A6SA 2O1CA 3X0NA 1XSBA 2GT2A 4C9XA 3Q1PA 5LPGA 1PVFA 5FSIA 3AC9A 4N1TA 1X84A 5FSOA 1SU2A 4HVYA 1Q27A 2YVPA 4S2YA 1V8UA 3X0JA 3MCFA 4JZTA 1MQWA 1RRSA 4ILQA 2B2KA 5DPKA 1NQZA 3HHJA 3X0IA 5ANSA 1NFSA 3GG6A 1VIUA 1KHZA 1V8NA 2YVOA 5ANTA 4KG3A 3BM4A 3L85A 5GHQA 3E57A 4S2XA 5C7TA 1MQEA 3EF5A 1IRYA 2FVVA 1G0SA 2O5WA 2G73A 2JVBA 1VRLA 1X51A 3FJYA 4ICKA 5GHNA 3SONA 3A6UA 4S2WA 1R67A 3CNGA 3ZR0A 2R5WA 1PPVA 3X0PA 1XSCA 3Q93A 3GWYA 5FSKA 1QVJA 2DSCA 4JZVA 1F3YA 3BAPA 3WHWA 5ISYA 3Q4IA 3A6VA 3ID9A 2YYHA 3A6TA 3BHOA 3O69A 1U20A 1SZ3A 1VHZA 2GT4A 3OGAA 4IJXA 1VHGA 5ANWA 5DDGA 4NFXA 1V8TA 2GB5A 3X0MA 5FSLA 1G9QA 2I8UA 3O8SA 3EEUA 1JRKA 2A8PA 3P6YA 4S2VA 2Q9PA 5HZXA 3R03A 2A8RA 3O52A 5ANUA 2DSBA 1PPXA 5GHJA 4MPOA 4JZUA 4NFWA 3EESA 1V8YA 2FKBA 1NQYA 1XSAA 1MR2A 2ICJA 5GHIA
chains in the Genus database with same CATH superfamily
2YVMA 3I7UA 1RRQA 4N1UA 1V8IA 1I9AA 1V8MA 5DEQA 3FFUA 5ANVA 3HYQA 4KTBA 1VK6A 5CFJA 4ZG0A 2DSDA 5C8LA 3GZ5A 3P5TA 1VC8A 2ICKA 3EXQA 4C9WA 5C7QA 3X0OA 3X0QA 3MDIA 3Q2TA 1KTGA 2I6KA 3MGMA 1MK1A 2QKMB 5IW4A 3SMDA 5FSMA 3ZR1A 3ACAA 1MP2A 5DD4A 1V8WA 3GZ6A 3COUA 1OW2A 1RYAA 5GHPA 3I9XA 4YOQA 2B0VA 4K6EA 3FCMA 3Q2SA 1NFZA 3N9UA 5CFIA 3DUPA 3KVHA 2I8TA 1VIQA 3MDGA 5GHMA 3G0QA 2RRKA 1PUNA 2O5FA 1KT9A 2W4EA 4KG4A 5IW5A 3Q91A 1K26A 3O61A 1K2EA 4JZSA 1Q33A 3GZ8A 5FSNA 2A6TA 3GRNA 1X83A 2AZWA 3RH7A 4YPHA 1PUSA 1V8RA 3F6AA 3I7VA 3SHDA 1VC9A 2B06A 3F13A 5BONA 3FSPA 3J7Ye 3DKUA 4YPRA 2QJOA 2VNPA 4HFQA 2G74A 1PPWA 3QSJA 4DYWA 2KDVA 3X0KA 1Q54A 2YVNA 4KYXA 1PUQA 2VNQA 2FMLA 2DHOA 2J8QA 1V8VA 2A8SA 2PNYA 3N77A 4V14A 2A8TA 2A8QA 5GHOA 1VCDA 5BS6A 1TUMA 4J7HA 2QJTA 2XSQA 1MUTA 1SOIA 2CL3A 3U53A 3O6ZA 3X0RA 1JKNA 3X0SA 1V8LA 1SJYA 1HX3A 2PQVA 1HZTA 3X0LA 1GA7A 2KDWA 2DUKA 3FK9A 3H95A 5I8UA 1V8SA 3A6SA 2O1CA 3X0NA 1XSBA 2GT2A 4C9XA 2CZRA 3Q1PA 5LPGA 1PVFA 5FSIA 3AC9A 4N1TA 1X84A 5FSOA 1SU2A 4HVYA 1Q27A 2YVPA 4S2YA 1V8UA 3X0JA 3MCFA 4JZTA 1MQWA 1RRSA 4ILQA 2B2KA 5DPKA 1NQZA 3HHJA 3X0IA 5ANSA 1NFSA 3GG6A 1VIUA 1KHZA 1V8NA 2YVOA 5ANTA 4KG3A 3BM4A 3L85A 5GHQA 3E57A 4S2XA 5C7TA 1MQEA 3EF5A 1IRYA 2FVVA 1G0SA 2O5WA 2G73A 2JVBA 1VRLA 1X51A 3FJYA 4ICKA 5GHNA 3SONA 3A6UA 4S2WA 1R67A 3CNGA 3ZR0A 2R5WA 1PPVA 3X0PA 1XSCA 3Q93A 3GWYA 5FSKA 1QVJA 2DSCA 4JZVA 1F3YA 3BAPA 3WHWA 5ISYA 3Q4IA 3A6VA 3ID9A 2YYHA 3A6TA 3BHOA 3O69A 1U20A 1SZ3A 1VHZA 2GT4A 3OGAA 4IJXA 1VHGA 4J7GA 5ANWA 5DDGA 4NFXA 1V8TA 2GB5A 3X0MA 5FSLA 1G9QA 2I8UA 3O8SA 3EEUA 1JRKA 2A8PA 3P6YA 4S2VA 2Q9PA 5HZXA 3R03A 2A8RA 3O52A 5ANUA 2DSBA 1PPXA 5GHJA 4MPOA 4JZUA 4NFWA 3EESA 1V8YA 2FKBA 1NQYA 1XSAA 1MR2A 2ICJA 5GHIA
chains in the Genus database with same CATH topology
2YVMA 3I7UA 1RRQA 4N1UA 1V8IA 1I9AA 1V8MA 5DEQA 3FFUA 5ANVA 3HYQA 4KTBA 1VK6A 5CFJA 4ZG0A 2DSDA 5C8LA 3GZ5A 3P5TA 1VC8A 2ICKA 3EXQA 4C9WA 5C7QA 3X0OA 3X0QA 3MDIA 3Q2TA 1KTGA 2I6KA 3MGMA 1MK1A 2QKMB 5IW4A 3SMDA 5FSMA 3ZR1A 3ACAA 1MP2A 5DD4A 1V8WA 3GZ6A 3COUA 1OW2A 1RYAA 5GHPA 3I9XA 4YOQA 2B0VA 4K6EA 3FCMA 3Q2SA 1NFZA 3N9UA 5CFIA 3DUPA 3KVHA 2I8TA 1VIQA 3MDGA 5GHMA 3G0QA 2RRKA 1PUNA 2O5FA 1KT9A 2W4EA 4KG4A 5IW5A 3Q91A 1K26A 3O61A 1K2EA 4JZSA 1Q33A 3GZ8A 5FSNA 2A6TA 3GRNA 1X83A 2AZWA 3RH7A 4YPHA 1PUSA 1V8RA 3F6AA 3I7VA 3SHDA 1VC9A 2B06A 3F13A 5BONA 3FSPA 3J7Ye 3DKUA 4YPRA 2QJOA 2VNPA 4HFQA 2G74A 1PPWA 3QSJA 4DYWA 2KDVA 3X0KA 1Q54A 2YVNA 4KYXA 1PUQA 2VNQA 2FMLA 2DHOA 2J8QA 1V8VA 2A8SA 2PNYA 3N77A 4V14A 2A8TA 2A8QA 5GHOA 1VCDA 5BS6A 1TUMA 4J7HA 2QJTA 2XSQA 1MUTA 1SOIA 2CL3A 3U53A 3O6ZA 3X0RA 1JKNA 3X0SA 1V8LA 1SJYA 1HX3A 2PQVA 1HZTA 3X0LA 1GA7A 2KDWA 2DUKA 3FK9A 3H95A 5I8UA 1V8SA 3A6SA 2O1CA 3X0NA 1XSBA 2GT2A 4C9XA 2CZRA 3Q1PA 5LPGA 1PVFA 5FSIA 3AC9A 4N1TA 1X84A 5FSOA 1SU2A 4HVYA 1Q27A 2YVPA 4S2YA 1V8UA 3X0JA 3MCFA 4JZTA 1MQWA 1RRSA 4ILQA 2B2KA 5DPKA 1NQZA 3HHJA 3X0IA 5ANSA 1NFSA 3GG6A 1VIUA 1KHZA 1V8NA 2YVOA 5ANTA 4KG3A 3BM4A 3L85A 5GHQA 3E57A 4S2XA 5C7TA 1MQEA 3EF5A 1IRYA 2FVVA 1G0SA 2O5WA 2G73A 2JVBA 1VRLA 1X51A 3FJYA 4ICKA 5GHNA 3SONA 3A6UA 4S2WA 1R67A 3CNGA 3ZR0A 2R5WA 1PPVA 3X0PA 1XSCA 3Q93A 3GWYA 5FSKA 1QVJA 2DSCA 4JZVA 1F3YA 3BAPA 3WHWA 5ISYA 3Q4IA 3A6VA 3ID9A 2YYHA 3A6TA 3BHOA 3O69A 1U20A 1SZ3A 1VHZA 2GT4A 3OGAA 4IJXA 1VHGA 4J7GA 5ANWA 5DDGA 4NFXA 1V8TA 2GB5A 3X0MA 5FSLA 1G9QA 2I8UA 3O8SA 3EEUA 1JRKA 2A8PA 3P6YA 4S2VA 2Q9PA 5HZXA 3R03A 2A8RA 3O52A 5ANUA 2DSBA 1PPXA 5GHJA 4MPOA 4JZUA 4NFWA 3EESA 1V8YA 2FKBA 1NQYA 1XSAA 1MR2A 2ICJA 5GHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVM A;  3I7U A;  1RRQ A;  4N1U A;  1V8I A;  1I9A A;  1V8M A;  5DEQ A;  3FFU A;  5ANV A;  3HYQ A;  4KTB A;  1VK6 A;  5CFJ A;  4ZG0 A;  2DSD A;  5C8L A;  3GZ5 A;  3P5T A;  1VC8 A;  2ICK A;  3EXQ A;  4C9W A;  5C7Q A;  3X0O A;  3X0Q A;  3MDI A;  3Q2T A;  1KTG A;  2I6K A;  3MGM A;  1MK1 A;  2QKM B;  5IW4 A;  3SMD A;  5FSM A;  3ZR1 A;  3ACA A;  1MP2 A;  5DD4 A;  1V8W A;  3GZ6 A;  3COU A;  1OW2 A;  1RYA A;  5GHP A;  3I9X A;  4YOQ A;  2B0V A;  4K6E A;  3FCM A;  3Q2S A;  1NFZ A;  3N9U A;  5CFI A;  3DUP A;  3KVH A;  2I8T A;  1VIQ A;  3MDG A;  5GHM A;  3G0Q A;  2RRK A;  1PUN A;  2O5F A;  1KT9 A;  2W4E A;  4KG4 A;  5IW5 A;  3Q91 A;  1K26 A;  3O61 A;  1K2E A;  4JZS A;  1Q33 A;  3GZ8 A;  5FSN A;  2A6T A;  3GRN A;  1X83 A;  2AZW A;  3RH7 A;  4YPH A;  1PUS A;  1V8R A;  3F6A A;  3I7V A;  3SHD A;  1VC9 A;  2B06 A;  3F13 A;  5BON A;  3FSP A;  3J7Y e;  3DKU A;  4YPR A;  2QJO A;  2VNP A;  4HFQ A;  2G74 A;  1PPW A;  3QSJ A;  4DYW A;  2KDV A;  3X0K A;  1Q54 A;  2YVN A;  4KYX A;  1PUQ A;  2VNQ A;  2FML A;  2DHO A;  2J8Q A;  1V8V A;  2A8S A;  2PNY A;  3N77 A;  4V14 A;  2A8T A;  2A8Q A;  5GHO A;  1VCD A;  5BS6 A;  1TUM A;  2QJT A;  2XSQ A;  1MUT A;  1SOI A;  2CL3 A;  3U53 A;  3O6Z A;  3X0R A;  1JKN A;  3X0S A;  1V8L A;  1SJY A;  1HX3 A;  2PQV A;  1HZT A;  3X0L A;  1GA7 A;  2KDW A;  2DUK A;  3FK9 A;  3H95 A;  5I8U A;  1V8S A;  3A6S A;  2O1C A;  3X0N A;  1XSB A;  2GT2 A;  4C9X A;  3Q1P A;  5LPG A;  1PVF A;  5FSI A;  3AC9 A;  4N1T A;  1X84 A;  5FSO A;  1SU2 A;  4HVY A;  1Q27 A;  2YVP A;  4S2Y A;  1V8U A;  3X0J A;  3MCF A;  4JZT A;  1MQW A;  1RRS A;  4ILQ A;  2B2K A;  5DPK A;  1NQZ A;  3HHJ A;  3X0I A;  5ANS A;  1NFS A;  3GG6 A;  1VIU A;  1KHZ A;  1V8N A;  2YVO A;  5ANT A;  4KG3 A;  3BM4 A;  3L85 A;  5GHQ A;  3E57 A;  4S2X A;  5C7T A;  1MQE A;  3EF5 A;  1IRY A;  2FVV A;  1G0S A;  2O5W A;  2G73 A;  2JVB A;  1VRL A;  1X51 A;  3FJY A;  4ICK A;  5GHN A;  3SON A;  3A6U A;  4S2W A;  1R67 A;  3CNG A;  3ZR0 A;  2R5W A;  1PPV A;  3X0P A;  1XSC A;  3Q93 A;  3GWY A;  5FSK A;  1QVJ A;  2DSC A;  4JZV A;  1F3Y A;  3BAP A;  3WHW A;  5ISY A;  3Q4I A;  3A6V A;  3ID9 A;  2YYH A;  3A6T A;  3BHO A;  3O69 A;  1U20 A;  1SZ3 A;  1VHZ A;  2GT4 A;  3OGA A;  4IJX A;  1VHG A;  5ANW A;  5DDG A;  4NFX A;  1V8T A;  2GB5 A;  3X0M A;  5FSL A;  1G9Q A;  2I8U A;  3O8S A;  3EEU A;  1JRK A;  2A8P A;  3P6Y A;  4S2V A;  2Q9P A;  5HZX A;  3R03 A;  2A8R A;  3O52 A;  5ANU A;  2DSB A;  1PPX A;  5GHJ A;  4MPO A;  4JZU A;  4NFW A;  3EES A;  1V8Y A;  2FKB A;  1NQY A;  1XSA A;  1MR2 A;  2ICJ A;  5GHI A; 
#chains in the Genus database with same CATH topology
 2YVM A;  3I7U A;  1RRQ A;  4N1U A;  1V8I A;  1I9A A;  1V8M A;  5DEQ A;  3FFU A;  5ANV A;  3HYQ A;  4KTB A;  1VK6 A;  5CFJ A;  4ZG0 A;  2DSD A;  5C8L A;  3GZ5 A;  3P5T A;  1VC8 A;  2ICK A;  3EXQ A;  4C9W A;  5C7Q A;  3X0O A;  3X0Q A;  3MDI A;  3Q2T A;  1KTG A;  2I6K A;  3MGM A;  1MK1 A;  2QKM B;  5IW4 A;  3SMD A;  5FSM A;  3ZR1 A;  3ACA A;  1MP2 A;  5DD4 A;  1V8W A;  3GZ6 A;  3COU A;  1OW2 A;  1RYA A;  5GHP A;  3I9X A;  4YOQ A;  2B0V A;  4K6E A;  3FCM A;  3Q2S A;  1NFZ A;  3N9U A;  5CFI A;  3DUP A;  3KVH A;  2I8T A;  1VIQ A;  3MDG A;  5GHM A;  3G0Q A;  2RRK A;  1PUN A;  2O5F A;  1KT9 A;  2W4E A;  4KG4 A;  5IW5 A;  3Q91 A;  1K26 A;  3O61 A;  1K2E A;  4JZS A;  1Q33 A;  3GZ8 A;  5FSN A;  2A6T A;  3GRN A;  1X83 A;  2AZW A;  3RH7 A;  4YPH A;  1PUS A;  1V8R A;  3F6A A;  3I7V A;  3SHD A;  1VC9 A;  2B06 A;  3F13 A;  5BON A;  3FSP A;  3J7Y e;  3DKU A;  4YPR A;  2QJO A;  2VNP A;  4HFQ A;  2G74 A;  1PPW A;  3QSJ A;  4DYW A;  2KDV A;  3X0K A;  1Q54 A;  2YVN A;  4KYX A;  1PUQ A;  2VNQ A;  2FML A;  2DHO A;  2J8Q A;  1V8V A;  2A8S A;  2PNY A;  3N77 A;  4V14 A;  2A8T A;  2A8Q A;  5GHO A;  1VCD A;  5BS6 A;  1TUM A;  4J7H A;  2QJT A;  2XSQ A;  1MUT A;  1SOI A;  2CL3 A;  3U53 A;  3O6Z A;  3X0R A;  1JKN A;  3X0S A;  1V8L A;  1SJY A;  1HX3 A;  2PQV A;  1HZT A;  3X0L A;  1GA7 A;  2KDW A;  2DUK A;  3FK9 A;  3H95 A;  5I8U A;  1V8S A;  3A6S A;  2O1C A;  3X0N A;  1XSB A;  2GT2 A;  4C9X A;  2CZR A;  3Q1P A;  5LPG A;  1PVF A;  5FSI A;  3AC9 A;  4N1T A;  1X84 A;  5FSO A;  1SU2 A;  4HVY A;  1Q27 A;  2YVP A;  4S2Y A;  1V8U A;  3X0J A;  3MCF A;  4JZT A;  1MQW A;  1RRS A;  4ILQ A;  2B2K A;  5DPK A;  1NQZ A;  3HHJ A;  3X0I A;  5ANS A;  1NFS A;  3GG6 A;  1VIU A;  1KHZ A;  1V8N A;  2YVO A;  5ANT A;  4KG3 A;  3BM4 A;  3L85 A;  5GHQ A;  3E57 A;  4S2X A;  5C7T A;  1MQE A;  3EF5 A;  1IRY A;  2FVV A;  1G0S A;  2O5W A;  2G73 A;  2JVB A;  1VRL A;  1X51 A;  3FJY A;  4ICK A;  5GHN A;  3SON A;  3A6U A;  4S2W A;  1R67 A;  3CNG A;  3ZR0 A;  2R5W A;  1PPV A;  3X0P A;  1XSC A;  3Q93 A;  3GWY A;  5FSK A;  1QVJ A;  2DSC A;  4JZV A;  1F3Y A;  3BAP A;  3WHW A;  5ISY A;  3Q4I A;  3A6V A;  3ID9 A;  2YYH A;  3A6T A;  3BHO A;  3O69 A;  1U20 A;  1SZ3 A;  1VHZ A;  2GT4 A;  3OGA A;  4IJX A;  1VHG A;  4J7G A;  5ANW A;  5DDG A;  4NFX A;  1V8T A;  2GB5 A;  3X0M A;  5FSL A;  1G9Q A;  2I8U A;  3O8S A;  3EEU A;  1JRK A;  2A8P A;  3P6Y A;  4S2V A;  2Q9P A;  5HZX A;  3R03 A;  2A8R A;  3O52 A;  5ANU A;  2DSB A;  1PPX A;  5GHJ A;  4MPO A;  4JZU A;  4NFW A;  3EES A;  1V8Y A;  2FKB A;  1NQY A;  1XSA A;  1MR2 A;  2ICJ A;  5GHI A; 
#chains in the Genus database with same CATH homology
 2YVM A;  3I7U A;  1RRQ A;  4N1U A;  1V8I A;  1I9A A;  1V8M A;  5DEQ A;  3FFU A;  5ANV A;  3HYQ A;  4KTB A;  1VK6 A;  5CFJ A;  4ZG0 A;  2DSD A;  5C8L A;  3GZ5 A;  3P5T A;  1VC8 A;  2ICK A;  3EXQ A;  4C9W A;  5C7Q A;  3X0O A;  3X0Q A;  3MDI A;  3Q2T A;  1KTG A;  2I6K A;  3MGM A;  1MK1 A;  2QKM B;  5IW4 A;  3SMD A;  5FSM A;  3ZR1 A;  3ACA A;  1MP2 A;  5DD4 A;  1V8W A;  3GZ6 A;  3COU A;  1OW2 A;  1RYA A;  5GHP A;  3I9X A;  4YOQ A;  2B0V A;  4K6E A;  3FCM A;  3Q2S A;  1NFZ A;  3N9U A;  5CFI A;  3DUP A;  3KVH A;  2I8T A;  1VIQ A;  3MDG A;  5GHM A;  3G0Q A;  2RRK A;  1PUN A;  2O5F A;  1KT9 A;  2W4E A;  4KG4 A;  5IW5 A;  3Q91 A;  1K26 A;  3O61 A;  1K2E A;  4JZS A;  1Q33 A;  3GZ8 A;  5FSN A;  2A6T A;  3GRN A;  1X83 A;  2AZW A;  3RH7 A;  4YPH A;  1PUS A;  1V8R A;  3F6A A;  3I7V A;  3SHD A;  1VC9 A;  2B06 A;  3F13 A;  5BON A;  3FSP A;  3J7Y e;  3DKU A;  4YPR A;  2QJO A;  2VNP A;  4HFQ A;  2G74 A;  1PPW A;  3QSJ A;  4DYW A;  2KDV A;  3X0K A;  1Q54 A;  2YVN A;  4KYX A;  1PUQ A;  2VNQ A;  2FML A;  2DHO A;  2J8Q A;  1V8V A;  2A8S A;  2PNY A;  3N77 A;  4V14 A;  2A8T A;  2A8Q A;  5GHO A;  1VCD A;  5BS6 A;  1TUM A;  4J7H A;  2QJT A;  2XSQ A;  1MUT A;  1SOI A;  2CL3 A;  3U53 A;  3O6Z A;  3X0R A;  1JKN A;  3X0S A;  1V8L A;  1SJY A;  1HX3 A;  2PQV A;  1HZT A;  3X0L A;  1GA7 A;  2KDW A;  2DUK A;  3FK9 A;  3H95 A;  5I8U A;  1V8S A;  3A6S A;  2O1C A;  3X0N A;  1XSB A;  2GT2 A;  4C9X A;  2CZR A;  3Q1P A;  5LPG A;  1PVF A;  5FSI A;  3AC9 A;  4N1T A;  1X84 A;  5FSO A;  1SU2 A;  4HVY A;  1Q27 A;  2YVP A;  4S2Y A;  1V8U A;  3X0J A;  3MCF A;  4JZT A;  1MQW A;  1RRS A;  4ILQ A;  2B2K A;  5DPK A;  1NQZ A;  3HHJ A;  3X0I A;  5ANS A;  1NFS A;  3GG6 A;  1VIU A;  1KHZ A;  1V8N A;  2YVO A;  5ANT A;  4KG3 A;  3BM4 A;  3L85 A;  5GHQ A;  3E57 A;  4S2X A;  5C7T A;  1MQE A;  3EF5 A;  1IRY A;  2FVV A;  1G0S A;  2O5W A;  2G73 A;  2JVB A;  1VRL A;  1X51 A;  3FJY A;  4ICK A;  5GHN A;  3SON A;  3A6U A;  4S2W A;  1R67 A;  3CNG A;  3ZR0 A;  2R5W A;  1PPV A;  3X0P A;  1XSC A;  3Q93 A;  3GWY A;  5FSK A;  1QVJ A;  2DSC A;  4JZV A;  1F3Y A;  3BAP A;  3WHW A;  5ISY A;  3Q4I A;  3A6V A;  3ID9 A;  2YYH A;  3A6T A;  3BHO A;  3O69 A;  1U20 A;  1SZ3 A;  1VHZ A;  2GT4 A;  3OGA A;  4IJX A;  1VHG A;  4J7G A;  5ANW A;  5DDG A;  4NFX A;  1V8T A;  2GB5 A;  3X0M A;  5FSL A;  1G9Q A;  2I8U A;  3O8S A;  3EEU A;  1JRK A;  2A8P A;  3P6Y A;  4S2V A;  2Q9P A;  5HZX A;  3R03 A;  2A8R A;  3O52 A;  5ANU A;  2DSB A;  1PPX A;  5GHJ A;  4MPO A;  4JZU A;  4NFW A;  3EES A;  1V8Y A;  2FKB A;  1NQY A;  1XSA A;  1MR2 A;  2ICJ A;  5GHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...