1V8SA

Crystal structure analusis of the adp-ribose pyrophosphatase complexed with amp and mg
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
159
structure length
152
Chain Sequence
RTYLYRGRILNLALEGRYEIVEHKPAVAVIALREGRMLFVRQMRPAVGLAPLEIPAGLIEPGEDPLEAARRELAEETGLSGDLTYLFSYFVSPGFTDEKTHVFLAENLKEVEAIEVVWMRPEEALERHQRGEVEFSATGLVGVLYYHAFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ADP-ribose pyrophosphatase
publication title Structural insights into the Thermus thermophilus ADP-ribose pyrophosphatase mechanism via crystal structures with the bound substrate and metal
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 152
sequence length 159
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2004-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1v8sA00
1VRLA 2ICJA 1Q33A 3O69A 5GHNA 1PPVA 2RRKA 2DHOA 3J7Ye 2YVMA 3AC9A 3EEUA 4S2WA 3P6YA 1V8WA 3DKUA 3GZ5A 1PVFA 4JZSA 2AZWA 1GA7A 5ISYA 2G73A 3BHOA 3HHJA 5FSKA 3Q91A 1SJYA 3GG6A 1XSAA 3P5TA 1V8IA 3N9UA 2O5WA 2KDWA 1SZ3A 1NQZA 1K26A 1NFSA 1G9QA 5FSLA 2A6TA 3X0SA 3DUPA 4C9WA 3BM4A 3G0QA 4ZG0A 3SONA 3X0KA 2KDVA 5I8UA 3X0LA 3U53A 4S2VA 3X0JA 3H95A 1OW2A 5BS6A 4KG3A 3X0IA 1KT9A 1PPXA 2DSBA 3E57A 4ICKA 5ANVA 3OGAA 1TUMA 2QJOA 5FSMA 2QJTA 3Q1PA 1V8YA 1MQEA 5DD4A 1MP2A 4C9XA 4JZUA 1SOIA 1K2EA 1V8TA 3O8SA 3MDGA 2Q9PA 1V8MA 4NFXA 2O1CA 2DSCA 1V8LA 1NFZA 3BAPA 2FVVA 4IJXA 3WHWA 1VHGA 1PUQA 1JRKA 2G74A 3A6TA 4DYWA 4S2YA 5GHOA 1VC8A 3A6VA 2DSDA 1XSBA 5GHQA 1U20A 1XSCA 1RRSA 3SHDA 2I8TA 3O52A 3HYQA 5GHMA 1X83A 3EESA 3GZ8A 2CL3A 2B0VA 3X0OA 4HVYA 3GZ6A 1MR2A 2A8QA 5ANSA 2PNYA 1VIQA 3CNGA 4N1TA 5DEQA 5CFJA 1MUTA 3A6UA 2GB5A 2ICKA 2R5WA 5GHPA 1V8UA 2FKBA 3KVHA 4K6EA 1I9AA 3X0RA 3X0NA 1V8SA 5BONA 3ZR1A 5DPKA 2I8UA 2B06A 3N77A 1MK1A 4NFWA 3I9XA 1VHZA 5DDGA 3FSPA 3ACAA 1JKNA 4JZTA 5FSNA 3FK9A 4JZVA 4KG4A 5HZXA 5ANWA 1KTGA 5IW5A 4YPHA 2O5FA 2GT4A 4YPRA 1IRYA 5GHIA 3F6AA 1MQWA 1HX3A 1RYAA 5C8LA 2A8TA 3GRNA 1NQYA 1SU2A 1PUSA 2YVOA 2W4EA 4ILQA 2I6KA 2A8PA 2A8SA 2VNQA 4V14A 2DUKA 2GT2A 4YOQA 4KTBA 1VIUA 2A8RA 5ANUA 3A6SA 2YVNA 3GWYA 3RH7A 5CFIA 1PUNA 2YYHA 3F13A 3X0PA 5FSIA 3ZR0A 3MDIA 1X84A 3O6ZA 2B2KA 1V8RA 3SMDA 3Q2SA 1Q27A 1VCDA 3COUA 3Q93A 5GHJA 3MGMA 4HFQA 2PQVA 2VNPA 3X0MA 1HZTA 2YVPA 3R03A 1PPWA 3L85A 2JVBA 1Q54A 3FFUA 1QVJA 3EXQA 4S2XA 2XSQA 3O61A 3I7UA 2FMLA 3Q4IA 1VC9A 1RRQA 5ANTA 3ID9A 5C7QA 3EF5A 3MCFA 2QKMB 4KYXA 4MPOA 1F3YA 3FCMA 1V8VA 3I7VA 5FSOA 3Q2TA 1R67A 1V8NA 1VK6A 1X51A 5LPGA 3QSJA 1KHZA 1G0SA 2J8QA 3X0QA 4N1UA 5IW4A 3FJYA 5C7TA
chains in the Genus database with same CATH superfamily
1VRLA 2ICJA 1Q33A 3O69A 5GHNA 1PPVA 2RRKA 2DHOA 4J7GA 2YVMA 3AC9A 3EEUA 4S2WA 3J7Ye 3P6YA 1V8WA 3DKUA 3GZ5A 1PVFA 4JZSA 2AZWA 1GA7A 5ISYA 2G73A 3BHOA 3HHJA 5FSKA 3Q91A 1SJYA 3GG6A 1XSAA 3P5TA 1V8IA 3N9UA 2O5WA 2KDWA 1SZ3A 1NQZA 1K26A 1NFSA 1G9QA 5FSLA 2A6TA 3X0SA 3DUPA 4C9WA 3BM4A 3G0QA 4ZG0A 3SONA 3X0KA 2KDVA 5I8UA 3X0LA 3U53A 4S2VA 3X0JA 3H95A 1OW2A 5BS6A 4KG3A 3X0IA 1KT9A 1PPXA 2DSBA 3E57A 4ICKA 5ANVA 3OGAA 1TUMA 2QJOA 5FSMA 2QJTA 3Q1PA 1V8YA 1MQEA 5DD4A 1MP2A 4C9XA 4JZUA 1SOIA 1K2EA 1V8TA 3O8SA 3MDGA 2Q9PA 1V8MA 4NFXA 2O1CA 2DSCA 1V8LA 1NFZA 3BAPA 2FVVA 4IJXA 3WHWA 1VHGA 1PUQA 1JRKA 2G74A 3A6TA 4DYWA 4S2YA 5GHOA 1VC8A 3A6VA 2DSDA 1XSBA 5GHQA 1U20A 1XSCA 1RRSA 3SHDA 2I8TA 3O52A 3HYQA 5GHMA 1X83A 3EESA 3GZ8A 2CL3A 2B0VA 3X0OA 4HVYA 3GZ6A 1MR2A 2A8QA 5ANSA 2PNYA 1VIQA 3CNGA 4N1TA 5DEQA 5CFJA 1MUTA 3A6UA 2GB5A 2ICKA 2R5WA 5GHPA 1V8UA 2FKBA 3KVHA 4K6EA 1I9AA 3X0RA 3X0NA 1V8SA 5BONA 3ZR1A 5DPKA 2I8UA 2B06A 3N77A 1MK1A 4NFWA 3I9XA 1VHZA 5DDGA 3FSPA 3ACAA 1JKNA 4JZTA 5FSNA 3FK9A 4JZVA 4KG4A 5HZXA 5ANWA 1KTGA 5IW5A 4YPHA 2O5FA 2GT4A 4YPRA 1IRYA 5GHIA 3F6AA 1MQWA 1HX3A 1RYAA 5C8LA 2A8TA 3GRNA 1NQYA 1SU2A 1PUSA 2YVOA 2W4EA 4ILQA 2I6KA 2A8PA 2A8SA 2VNQA 4V14A 2DUKA 2GT2A 4YOQA 4KTBA 1VIUA 2A8RA 5ANUA 3A6SA 2YVNA 3GWYA 3RH7A 5CFIA 1PUNA 2YYHA 3F13A 3X0PA 5FSIA 2CZRA 3ZR0A 3MDIA 1X84A 3O6ZA 2B2KA 1V8RA 3SMDA 3Q2SA 1Q27A 1VCDA 3COUA 3Q93A 5GHJA 3MGMA 4HFQA 2PQVA 2VNPA 3X0MA 1HZTA 2YVPA 4J7HA 3R03A 1PPWA 3L85A 2JVBA 1Q54A 3FFUA 1QVJA 3EXQA 4S2XA 2XSQA 3O61A 3I7UA 2FMLA 3Q4IA 1VC9A 1RRQA 5ANTA 3ID9A 5C7QA 3EF5A 3MCFA 2QKMB 4KYXA 4MPOA 1F3YA 3FCMA 1V8VA 3I7VA 5FSOA 3Q2TA 1R67A 1V8NA 1VK6A 1X51A 5LPGA 3QSJA 1KHZA 1G0SA 2J8QA 3X0QA 4N1UA 5IW4A 3FJYA 5C7TA
chains in the Genus database with same CATH topology
1VRLA 2ICJA 1Q33A 3O69A 5GHNA 1PPVA 2RRKA 2DHOA 4J7GA 2YVMA 3AC9A 3EEUA 4S2WA 3J7Ye 3P6YA 1V8WA 3DKUA 3GZ5A 1PVFA 4JZSA 2AZWA 1GA7A 5ISYA 2G73A 3BHOA 3HHJA 5FSKA 3Q91A 1SJYA 3GG6A 1XSAA 3P5TA 1V8IA 3N9UA 2O5WA 2KDWA 1SZ3A 1NQZA 1K26A 1NFSA 1G9QA 5FSLA 2A6TA 3X0SA 3DUPA 4C9WA 3BM4A 3G0QA 4ZG0A 3SONA 3X0KA 2KDVA 5I8UA 3X0LA 3U53A 4S2VA 3X0JA 3H95A 1OW2A 5BS6A 4KG3A 3X0IA 1KT9A 1PPXA 2DSBA 3E57A 4ICKA 5ANVA 3OGAA 1TUMA 2QJOA 5FSMA 2QJTA 3Q1PA 1V8YA 1MQEA 5DD4A 1MP2A 4C9XA 4JZUA 1SOIA 1K2EA 1V8TA 3O8SA 3MDGA 2Q9PA 1V8MA 4NFXA 2O1CA 2DSCA 1V8LA 1NFZA 3BAPA 2FVVA 4IJXA 3WHWA 1VHGA 1PUQA 1JRKA 2G74A 3A6TA 4DYWA 4S2YA 5GHOA 1VC8A 3A6VA 2DSDA 1XSBA 5GHQA 1U20A 1XSCA 1RRSA 3SHDA 2I8TA 3O52A 3HYQA 5GHMA 1X83A 3EESA 3GZ8A 2CL3A 2B0VA 3X0OA 4HVYA 3GZ6A 1MR2A 2A8QA 5ANSA 2PNYA 1VIQA 3CNGA 4N1TA 5DEQA 5CFJA 1MUTA 3A6UA 2GB5A 2ICKA 2R5WA 5GHPA 1V8UA 2FKBA 3KVHA 4K6EA 1I9AA 3X0RA 3X0NA 1V8SA 5BONA 3ZR1A 5DPKA 2I8UA 2B06A 3N77A 1MK1A 4NFWA 3I9XA 1VHZA 5DDGA 3FSPA 3ACAA 1JKNA 4JZTA 5FSNA 3FK9A 4JZVA 4KG4A 5HZXA 5ANWA 1KTGA 5IW5A 4YPHA 2O5FA 2GT4A 4YPRA 1IRYA 5GHIA 3F6AA 1MQWA 1HX3A 1RYAA 5C8LA 2A8TA 3GRNA 1NQYA 1SU2A 1PUSA 2YVOA 2W4EA 4ILQA 2I6KA 2A8PA 2A8SA 2VNQA 4V14A 2DUKA 2GT2A 4YOQA 4KTBA 1VIUA 2A8RA 5ANUA 3A6SA 2YVNA 3GWYA 3RH7A 5CFIA 1PUNA 2YYHA 3F13A 3X0PA 5FSIA 2CZRA 3ZR0A 3MDIA 1X84A 3O6ZA 2B2KA 1V8RA 3SMDA 3Q2SA 1Q27A 1VCDA 3COUA 3Q93A 5GHJA 3MGMA 4HFQA 2PQVA 2VNPA 3X0MA 1HZTA 2YVPA 4J7HA 3R03A 1PPWA 3L85A 2JVBA 1Q54A 3FFUA 1QVJA 3EXQA 4S2XA 2XSQA 3O61A 3I7UA 2FMLA 3Q4IA 1VC9A 1RRQA 5ANTA 3ID9A 5C7QA 3EF5A 3MCFA 2QKMB 4KYXA 4MPOA 1F3YA 3FCMA 1V8VA 3I7VA 5FSOA 3Q2TA 1R67A 1V8NA 1VK6A 1X51A 5LPGA 3QSJA 1KHZA 1G0SA 2J8QA 3X0QA 4N1UA 5IW4A 3FJYA 5C7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRL A;  2ICJ A;  1Q33 A;  3O69 A;  5GHN A;  1PPV A;  2RRK A;  2DHO A;  3J7Y e;  2YVM A;  3AC9 A;  3EEU A;  4S2W A;  3P6Y A;  1V8W A;  3DKU A;  3GZ5 A;  1PVF A;  4JZS A;  2AZW A;  1GA7 A;  5ISY A;  2G73 A;  3BHO A;  3HHJ A;  5FSK A;  3Q91 A;  1SJY A;  3GG6 A;  1XSA A;  3P5T A;  1V8I A;  3N9U A;  2O5W A;  2KDW A;  1SZ3 A;  1NQZ A;  1K26 A;  1NFS A;  1G9Q A;  5FSL A;  2A6T A;  3X0S A;  3DUP A;  4C9W A;  3BM4 A;  3G0Q A;  4ZG0 A;  3SON A;  3X0K A;  2KDV A;  5I8U A;  3X0L A;  3U53 A;  4S2V A;  3X0J A;  3H95 A;  1OW2 A;  5BS6 A;  4KG3 A;  3X0I A;  1KT9 A;  1PPX A;  2DSB A;  3E57 A;  4ICK A;  5ANV A;  3OGA A;  1TUM A;  2QJO A;  5FSM A;  2QJT A;  3Q1P A;  1V8Y A;  1MQE A;  5DD4 A;  1MP2 A;  4C9X A;  4JZU A;  1SOI A;  1K2E A;  1V8T A;  3O8S A;  3MDG A;  2Q9P A;  1V8M A;  4NFX A;  2O1C A;  2DSC A;  1V8L A;  1NFZ A;  3BAP A;  2FVV A;  4IJX A;  3WHW A;  1VHG A;  1PUQ A;  1JRK A;  2G74 A;  3A6T A;  4DYW A;  4S2Y A;  5GHO A;  1VC8 A;  3A6V A;  2DSD A;  1XSB A;  5GHQ A;  1U20 A;  1XSC A;  1RRS A;  3SHD A;  2I8T A;  3O52 A;  3HYQ A;  5GHM A;  1X83 A;  3EES A;  3GZ8 A;  2CL3 A;  2B0V A;  3X0O A;  4HVY A;  3GZ6 A;  1MR2 A;  2A8Q A;  5ANS A;  2PNY A;  1VIQ A;  3CNG A;  4N1T A;  5DEQ A;  5CFJ A;  1MUT A;  3A6U A;  2GB5 A;  2ICK A;  2R5W A;  5GHP A;  1V8U A;  2FKB A;  3KVH A;  4K6E A;  1I9A A;  3X0R A;  3X0N A;  1V8S A;  5BON A;  3ZR1 A;  5DPK A;  2I8U A;  2B06 A;  3N77 A;  1MK1 A;  4NFW A;  3I9X A;  1VHZ A;  5DDG A;  3FSP A;  3ACA A;  1JKN A;  4JZT A;  5FSN A;  3FK9 A;  4JZV A;  4KG4 A;  5HZX A;  5ANW A;  1KTG A;  5IW5 A;  4YPH A;  2O5F A;  2GT4 A;  4YPR A;  1IRY A;  5GHI A;  3F6A A;  1MQW A;  1HX3 A;  1RYA A;  5C8L A;  2A8T A;  3GRN A;  1NQY A;  1SU2 A;  1PUS A;  2YVO A;  2W4E A;  4ILQ A;  2I6K A;  2A8P A;  2A8S A;  2VNQ A;  4V14 A;  2DUK A;  2GT2 A;  4YOQ A;  4KTB A;  1VIU A;  2A8R A;  5ANU A;  3A6S A;  2YVN A;  3GWY A;  3RH7 A;  5CFI A;  1PUN A;  2YYH A;  3F13 A;  3X0P A;  5FSI A;  3ZR0 A;  3MDI A;  1X84 A;  3O6Z A;  2B2K A;  1V8R A;  3SMD A;  3Q2S A;  1Q27 A;  1VCD A;  3COU A;  3Q93 A;  5GHJ A;  3MGM A;  4HFQ A;  2PQV A;  2VNP A;  3X0M A;  1HZT A;  2YVP A;  3R03 A;  1PPW A;  3L85 A;  2JVB A;  1Q54 A;  3FFU A;  1QVJ A;  3EXQ A;  4S2X A;  2XSQ A;  3O61 A;  3I7U A;  2FML A;  3Q4I A;  1VC9 A;  1RRQ A;  5ANT A;  3ID9 A;  5C7Q A;  3EF5 A;  3MCF A;  2QKM B;  4KYX A;  4MPO A;  1F3Y A;  3FCM A;  1V8V A;  3I7V A;  5FSO A;  3Q2T A;  1R67 A;  1V8N A;  1VK6 A;  1X51 A;  5LPG A;  3QSJ A;  1KHZ A;  1G0S A;  2J8Q A;  3X0Q A;  4N1U A;  5IW4 A;  3FJY A;  5C7T A; 
#chains in the Genus database with same CATH topology
 1VRL A;  2ICJ A;  1Q33 A;  3O69 A;  5GHN A;  1PPV A;  2RRK A;  2DHO A;  4J7G A;  2YVM A;  3AC9 A;  3EEU A;  4S2W A;  3J7Y e;  3P6Y A;  1V8W A;  3DKU A;  3GZ5 A;  1PVF A;  4JZS A;  2AZW A;  1GA7 A;  5ISY A;  2G73 A;  3BHO A;  3HHJ A;  5FSK A;  3Q91 A;  1SJY A;  3GG6 A;  1XSA A;  3P5T A;  1V8I A;  3N9U A;  2O5W A;  2KDW A;  1SZ3 A;  1NQZ A;  1K26 A;  1NFS A;  1G9Q A;  5FSL A;  2A6T A;  3X0S A;  3DUP A;  4C9W A;  3BM4 A;  3G0Q A;  4ZG0 A;  3SON A;  3X0K A;  2KDV A;  5I8U A;  3X0L A;  3U53 A;  4S2V A;  3X0J A;  3H95 A;  1OW2 A;  5BS6 A;  4KG3 A;  3X0I A;  1KT9 A;  1PPX A;  2DSB A;  3E57 A;  4ICK A;  5ANV A;  3OGA A;  1TUM A;  2QJO A;  5FSM A;  2QJT A;  3Q1P A;  1V8Y A;  1MQE A;  5DD4 A;  1MP2 A;  4C9X A;  4JZU A;  1SOI A;  1K2E A;  1V8T A;  3O8S A;  3MDG A;  2Q9P A;  1V8M A;  4NFX A;  2O1C A;  2DSC A;  1V8L A;  1NFZ A;  3BAP A;  2FVV A;  4IJX A;  3WHW A;  1VHG A;  1PUQ A;  1JRK A;  2G74 A;  3A6T A;  4DYW A;  4S2Y A;  5GHO A;  1VC8 A;  3A6V A;  2DSD A;  1XSB A;  5GHQ A;  1U20 A;  1XSC A;  1RRS A;  3SHD A;  2I8T A;  3O52 A;  3HYQ A;  5GHM A;  1X83 A;  3EES A;  3GZ8 A;  2CL3 A;  2B0V A;  3X0O A;  4HVY A;  3GZ6 A;  1MR2 A;  2A8Q A;  5ANS A;  2PNY A;  1VIQ A;  3CNG A;  4N1T A;  5DEQ A;  5CFJ A;  1MUT A;  3A6U A;  2GB5 A;  2ICK A;  2R5W A;  5GHP A;  1V8U A;  2FKB A;  3KVH A;  4K6E A;  1I9A A;  3X0R A;  3X0N A;  1V8S A;  5BON A;  3ZR1 A;  5DPK A;  2I8U A;  2B06 A;  3N77 A;  1MK1 A;  4NFW A;  3I9X A;  1VHZ A;  5DDG A;  3FSP A;  3ACA A;  1JKN A;  4JZT A;  5FSN A;  3FK9 A;  4JZV A;  4KG4 A;  5HZX A;  5ANW A;  1KTG A;  5IW5 A;  4YPH A;  2O5F A;  2GT4 A;  4YPR A;  1IRY A;  5GHI A;  3F6A A;  1MQW A;  1HX3 A;  1RYA A;  5C8L A;  2A8T A;  3GRN A;  1NQY A;  1SU2 A;  1PUS A;  2YVO A;  2W4E A;  4ILQ A;  2I6K A;  2A8P A;  2A8S A;  2VNQ A;  4V14 A;  2DUK A;  2GT2 A;  4YOQ A;  4KTB A;  1VIU A;  2A8R A;  5ANU A;  3A6S A;  2YVN A;  3GWY A;  3RH7 A;  5CFI A;  1PUN A;  2YYH A;  3F13 A;  3X0P A;  5FSI A;  2CZR A;  3ZR0 A;  3MDI A;  1X84 A;  3O6Z A;  2B2K A;  1V8R A;  3SMD A;  3Q2S A;  1Q27 A;  1VCD A;  3COU A;  3Q93 A;  5GHJ A;  3MGM A;  4HFQ A;  2PQV A;  2VNP A;  3X0M A;  1HZT A;  2YVP A;  4J7H A;  3R03 A;  1PPW A;  3L85 A;  2JVB A;  1Q54 A;  3FFU A;  1QVJ A;  3EXQ A;  4S2X A;  2XSQ A;  3O61 A;  3I7U A;  2FML A;  3Q4I A;  1VC9 A;  1RRQ A;  5ANT A;  3ID9 A;  5C7Q A;  3EF5 A;  3MCF A;  2QKM B;  4KYX A;  4MPO A;  1F3Y A;  3FCM A;  1V8V A;  3I7V A;  5FSO A;  3Q2T A;  1R67 A;  1V8N A;  1VK6 A;  1X51 A;  5LPG A;  3QSJ A;  1KHZ A;  1G0S A;  2J8Q A;  3X0Q A;  4N1U A;  5IW4 A;  3FJY A;  5C7T A; 
#chains in the Genus database with same CATH homology
 1VRL A;  2ICJ A;  1Q33 A;  3O69 A;  5GHN A;  1PPV A;  2RRK A;  2DHO A;  4J7G A;  2YVM A;  3AC9 A;  3EEU A;  4S2W A;  3J7Y e;  3P6Y A;  1V8W A;  3DKU A;  3GZ5 A;  1PVF A;  4JZS A;  2AZW A;  1GA7 A;  5ISY A;  2G73 A;  3BHO A;  3HHJ A;  5FSK A;  3Q91 A;  1SJY A;  3GG6 A;  1XSA A;  3P5T A;  1V8I A;  3N9U A;  2O5W A;  2KDW A;  1SZ3 A;  1NQZ A;  1K26 A;  1NFS A;  1G9Q A;  5FSL A;  2A6T A;  3X0S A;  3DUP A;  4C9W A;  3BM4 A;  3G0Q A;  4ZG0 A;  3SON A;  3X0K A;  2KDV A;  5I8U A;  3X0L A;  3U53 A;  4S2V A;  3X0J A;  3H95 A;  1OW2 A;  5BS6 A;  4KG3 A;  3X0I A;  1KT9 A;  1PPX A;  2DSB A;  3E57 A;  4ICK A;  5ANV A;  3OGA A;  1TUM A;  2QJO A;  5FSM A;  2QJT A;  3Q1P A;  1V8Y A;  1MQE A;  5DD4 A;  1MP2 A;  4C9X A;  4JZU A;  1SOI A;  1K2E A;  1V8T A;  3O8S A;  3MDG A;  2Q9P A;  1V8M A;  4NFX A;  2O1C A;  2DSC A;  1V8L A;  1NFZ A;  3BAP A;  2FVV A;  4IJX A;  3WHW A;  1VHG A;  1PUQ A;  1JRK A;  2G74 A;  3A6T A;  4DYW A;  4S2Y A;  5GHO A;  1VC8 A;  3A6V A;  2DSD A;  1XSB A;  5GHQ A;  1U20 A;  1XSC A;  1RRS A;  3SHD A;  2I8T A;  3O52 A;  3HYQ A;  5GHM A;  1X83 A;  3EES A;  3GZ8 A;  2CL3 A;  2B0V A;  3X0O A;  4HVY A;  3GZ6 A;  1MR2 A;  2A8Q A;  5ANS A;  2PNY A;  1VIQ A;  3CNG A;  4N1T A;  5DEQ A;  5CFJ A;  1MUT A;  3A6U A;  2GB5 A;  2ICK A;  2R5W A;  5GHP A;  1V8U A;  2FKB A;  3KVH A;  4K6E A;  1I9A A;  3X0R A;  3X0N A;  1V8S A;  5BON A;  3ZR1 A;  5DPK A;  2I8U A;  2B06 A;  3N77 A;  1MK1 A;  4NFW A;  3I9X A;  1VHZ A;  5DDG A;  3FSP A;  3ACA A;  1JKN A;  4JZT A;  5FSN A;  3FK9 A;  4JZV A;  4KG4 A;  5HZX A;  5ANW A;  1KTG A;  5IW5 A;  4YPH A;  2O5F A;  2GT4 A;  4YPR A;  1IRY A;  5GHI A;  3F6A A;  1MQW A;  1HX3 A;  1RYA A;  5C8L A;  2A8T A;  3GRN A;  1NQY A;  1SU2 A;  1PUS A;  2YVO A;  2W4E A;  4ILQ A;  2I6K A;  2A8P A;  2A8S A;  2VNQ A;  4V14 A;  2DUK A;  2GT2 A;  4YOQ A;  4KTB A;  1VIU A;  2A8R A;  5ANU A;  3A6S A;  2YVN A;  3GWY A;  3RH7 A;  5CFI A;  1PUN A;  2YYH A;  3F13 A;  3X0P A;  5FSI A;  2CZR A;  3ZR0 A;  3MDI A;  1X84 A;  3O6Z A;  2B2K A;  1V8R A;  3SMD A;  3Q2S A;  1Q27 A;  1VCD A;  3COU A;  3Q93 A;  5GHJ A;  3MGM A;  4HFQ A;  2PQV A;  2VNP A;  3X0M A;  1HZT A;  2YVP A;  4J7H A;  3R03 A;  1PPW A;  3L85 A;  2JVB A;  1Q54 A;  3FFU A;  1QVJ A;  3EXQ A;  4S2X A;  2XSQ A;  3O61 A;  3I7U A;  2FML A;  3Q4I A;  1VC9 A;  1RRQ A;  5ANT A;  3ID9 A;  5C7Q A;  3EF5 A;  3MCF A;  2QKM B;  4KYX A;  4MPO A;  1F3Y A;  3FCM A;  1V8V A;  3I7V A;  5FSO A;  3Q2T A;  1R67 A;  1V8N A;  1VK6 A;  1X51 A;  5LPG A;  3QSJ A;  1KHZ A;  1G0S A;  2J8Q A;  3X0Q A;  4N1U A;  5IW4 A;  3FJY A;  5C7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...