3GZ8A

Cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
154
structure length
154
Chain Sequence
MTEAEYLANYDPKAFKAQLLTVDAVLFTYHDQQLKVLLVQRSNHPFLGLWGLPGGFIDETCDESLEQTVLRKLAEKTAVVPPYIEQLCTVGNNSRDARGWSVTVCYTALMSYQACQIQIASVSDVKWWPLADVLQMPLAFDHLQLIEQARERLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords MutT/nudix family protein
publication title Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 35
structure length 154
sequence length 154
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3gz8A01
2KDWA 3R03A 2G74A 2O5FA 3BAPA 5DEQA 2DSBA 5DDGA 2GT2A 1VHGA 5C8LA 2A8SA 5FSKA 5FSIA 5FSLA 3X0NA 4YOQA 1R67A 1X83A 1G0SA 2YVPA 4KTBA 5ANWA 3ZR0A 2AZWA 3BM4A 1PPVA 1X51A 1V8NA 3GG6A 3MCFA 1SU2A 2O1CA 5ANVA 1XSAA 3X0SA 2A8RA 2DUKA 1XSCA 3Q4IA 2I6KA 1HX3A 3X0PA 4KG4A 3KVHA 3P5TA 1PUNA 2R5WA 2QJTA 3X0KA 3MGMA 5IW5A 2PQVA 3N9UA 4HVYA 1V8WA 2ICKA 2J8QA 3A6VA 3ID9A 3Q2SA 1MQEA 3ACAA 3HHJA 2GT4A 2FVVA 1K26A 4JZSA 1MK1A 1X84A 3O69A 3I7UA 4K6EA 1MQWA 1PUQA 5FSMA 5ISYA 3MDIA 4ICKA 4MPOA 4S2XA 1V8IA 4S2YA 1VCDA 3A6UA 3DUPA 5BONA 5GHIA 3FSPA 3X0IA 4HFQA 1SZ3A 4S2VA 1HZTA 1V8TA 1TUMA 2FMLA 3O61A 3X0RA 1VRLA 5GHNA 1V8VA 3DKUA 5I8UA 3X0QA 3G0QA 3N77A 5C7QA 1MP2A 3QSJA 1V8RA 5ANUA 1OW2A 2PNYA 3I9XA 1SJYA 3X0MA 5GHQA 1PUSA 3GZ8A 4N1UA 2FKBA 1U20A 1XSBA 2O5WA 3EXQA 2GB5A 2A8PA 2QJOA 3OGAA 4S2WA 4C9WA 1RRQA 1GA7A 1IRYA 4ZG0A 2A8QA 4NFXA 1PPXA 1V8MA 2W4EA 3H95A 1V8YA 1VK6A 4ILQA 1G9QA 4C9XA 1NFZA 3X0LA 1RRSA 5FSOA 3EEUA 3E57A 3GWYA 3O6ZA 4JZTA 4KG3A 5GHPA 1JKNA 2YVMA 5GHOA 4YPRA 3F13A 3GZ5A 2A6TA 3SHDA 1I9AA 5LPGA 3I7VA 3F6AA 2B06A 1Q27A 1VC9A 5GHMA 1KTGA 4JZUA 5CFJA 3HYQA 2B2KA 1Q54A 3X0OA 2Q9PA 1QVJA 3Q93A 1F3YA 1NQYA 3U53A 3Q1PA 3SMDA 1SOIA 1RYAA 1V8SA 1PPWA 2YVNA 1NFSA 1V8LA 5HZXA 1KHZA 3FFUA 3GRNA 5DD4A 3J7Ye 1VC8A 5CFIA 5ANSA 1PVFA 4N1TA 2G73A 1Q33A 1MR2A 3O52A 5GHJA 3WHWA 2DHOA 5C7TA 2VNQA 3AC9A 2RRKA 3Q2TA 3GZ6A 2KDVA 5DPKA 2JVBA 1MUTA 2I8UA 3O8SA 2QKMB 3X0JA 1K2EA 5IW4A 2B0VA 3A6SA 2I8TA 4NFWA 3MDGA 3ZR1A 3Q91A 3FK9A 3P6YA 3CNGA 1KT9A 4JZVA 1VIUA 2YVOA 4KYXA 5BS6A 4YPHA 3A6TA 3EESA 3SONA 2ICJA 2XSQA 4V14A 1VHZA 2DSCA 2VNPA 4IJXA 2YYHA 3FCMA 1V8UA 3BHOA 3EF5A 5ANTA 3L85A 1VIQA 3RH7A 1NQZA 3COUA 2DSDA 3FJYA 2A8TA 1JRKA 2CL3A 4DYWA 5FSNA
chains in the Genus database with same CATH superfamily
2KDWA 3R03A 2G74A 2O5FA 3BAPA 5DEQA 2DSBA 5DDGA 2GT2A 1VHGA 5C8LA 2A8SA 5FSKA 5FSIA 5FSLA 3X0NA 4YOQA 1R67A 1X83A 1G0SA 2YVPA 4KTBA 5ANWA 3ZR0A 2AZWA 3BM4A 1PPVA 1X51A 1V8NA 3GG6A 3MCFA 1SU2A 2O1CA 5ANVA 1XSAA 3X0SA 2A8RA 2DUKA 1XSCA 3Q4IA 2I6KA 1HX3A 3X0PA 4KG4A 3KVHA 3P5TA 1PUNA 2R5WA 2QJTA 3X0KA 3MGMA 5IW5A 2PQVA 3N9UA 4HVYA 1V8WA 2ICKA 2J8QA 3A6VA 3ID9A 3Q2SA 1MQEA 3ACAA 3HHJA 2GT4A 4J7GA 2FVVA 1K26A 4JZSA 1MK1A 1X84A 3O69A 3I7UA 4K6EA 1MQWA 1PUQA 5FSMA 5ISYA 3MDIA 4ICKA 4MPOA 4S2XA 1V8IA 4S2YA 1VCDA 3A6UA 3DUPA 5BONA 5GHIA 3FSPA 2CZRA 3X0IA 4HFQA 1SZ3A 4S2VA 1HZTA 1V8TA 1TUMA 2FMLA 3O61A 3X0RA 1VRLA 5GHNA 1V8VA 3DKUA 5I8UA 3X0QA 3G0QA 3N77A 5C7QA 1MP2A 3QSJA 1V8RA 5ANUA 1OW2A 2PNYA 3I9XA 1SJYA 3X0MA 5GHQA 1PUSA 3GZ8A 4N1UA 2FKBA 1U20A 1XSBA 2O5WA 3EXQA 2GB5A 2A8PA 2QJOA 3OGAA 4S2WA 4C9WA 1RRQA 1GA7A 1IRYA 4ZG0A 2A8QA 4NFXA 1PPXA 1V8MA 2W4EA 3H95A 1V8YA 1VK6A 4ILQA 1G9QA 4C9XA 1NFZA 3X0LA 1RRSA 5FSOA 3EEUA 3E57A 3GWYA 3O6ZA 4JZTA 4KG3A 5GHPA 1JKNA 2YVMA 5GHOA 4YPRA 3F13A 3GZ5A 2A6TA 3SHDA 1I9AA 5LPGA 3I7VA 3F6AA 2B06A 1Q27A 1VC9A 5GHMA 1KTGA 4JZUA 5CFJA 3HYQA 2B2KA 1Q54A 3X0OA 2Q9PA 1QVJA 3Q93A 1F3YA 1NQYA 3U53A 3Q1PA 3SMDA 1SOIA 1RYAA 1V8SA 1PPWA 2YVNA 1NFSA 1V8LA 5HZXA 1KHZA 3FFUA 3GRNA 5DD4A 3J7Ye 1VC8A 5CFIA 5ANSA 1PVFA 4N1TA 2G73A 1Q33A 1MR2A 3O52A 5GHJA 3WHWA 2DHOA 5C7TA 2VNQA 3AC9A 2RRKA 3Q2TA 4J7HA 3GZ6A 2KDVA 5DPKA 2JVBA 1MUTA 2I8UA 3O8SA 2QKMB 3X0JA 1K2EA 5IW4A 2B0VA 3A6SA 2I8TA 4NFWA 3MDGA 3ZR1A 3Q91A 3FK9A 3P6YA 3CNGA 1KT9A 4JZVA 1VIUA 2YVOA 4KYXA 5BS6A 4YPHA 3A6TA 3EESA 3SONA 2ICJA 2XSQA 4V14A 1VHZA 2DSCA 2VNPA 4IJXA 2YYHA 3FCMA 1V8UA 3BHOA 3EF5A 5ANTA 3L85A 1VIQA 3RH7A 1NQZA 3COUA 2DSDA 3FJYA 2A8TA 1JRKA 2CL3A 4DYWA 5FSNA
chains in the Genus database with same CATH topology
2KDWA 3R03A 2G74A 2O5FA 3BAPA 5DEQA 2DSBA 5DDGA 2GT2A 1VHGA 5C8LA 2A8SA 5FSKA 5FSIA 5FSLA 3X0NA 4YOQA 1R67A 1X83A 1G0SA 2YVPA 4KTBA 5ANWA 3ZR0A 2AZWA 3BM4A 1PPVA 1X51A 1V8NA 3GG6A 3MCFA 1SU2A 2O1CA 5ANVA 1XSAA 3X0SA 2A8RA 2DUKA 1XSCA 3Q4IA 2I6KA 1HX3A 3X0PA 4KG4A 3KVHA 3P5TA 1PUNA 2R5WA 2QJTA 3X0KA 3MGMA 5IW5A 2PQVA 3N9UA 4HVYA 1V8WA 2ICKA 2J8QA 3A6VA 3ID9A 3Q2SA 1MQEA 3ACAA 3HHJA 2GT4A 4J7GA 2FVVA 1K26A 4JZSA 1MK1A 1X84A 3O69A 3I7UA 4K6EA 1MQWA 1PUQA 5FSMA 5ISYA 3MDIA 4ICKA 4MPOA 4S2XA 1V8IA 4S2YA 1VCDA 3A6UA 3DUPA 5BONA 5GHIA 3FSPA 2CZRA 3X0IA 4HFQA 1SZ3A 4S2VA 1HZTA 1V8TA 1TUMA 2FMLA 3O61A 3X0RA 1VRLA 5GHNA 1V8VA 3DKUA 5I8UA 3X0QA 3G0QA 3N77A 5C7QA 1MP2A 3QSJA 1V8RA 5ANUA 1OW2A 2PNYA 3I9XA 1SJYA 3X0MA 5GHQA 1PUSA 3GZ8A 4N1UA 2FKBA 1U20A 1XSBA 2O5WA 3EXQA 2GB5A 2A8PA 2QJOA 3OGAA 4S2WA 4C9WA 1RRQA 1GA7A 1IRYA 4ZG0A 2A8QA 4NFXA 1PPXA 1V8MA 2W4EA 3H95A 1V8YA 1VK6A 4ILQA 1G9QA 4C9XA 1NFZA 3X0LA 1RRSA 5FSOA 3EEUA 3E57A 3GWYA 3O6ZA 4JZTA 4KG3A 5GHPA 1JKNA 2YVMA 5GHOA 4YPRA 3F13A 3GZ5A 2A6TA 3SHDA 1I9AA 5LPGA 3I7VA 3F6AA 2B06A 1Q27A 1VC9A 5GHMA 1KTGA 4JZUA 5CFJA 3HYQA 2B2KA 1Q54A 3X0OA 2Q9PA 1QVJA 3Q93A 1F3YA 1NQYA 3U53A 3Q1PA 3SMDA 1SOIA 1RYAA 1V8SA 1PPWA 2YVNA 1NFSA 1V8LA 5HZXA 1KHZA 3FFUA 3GRNA 5DD4A 3J7Ye 1VC8A 5CFIA 5ANSA 1PVFA 4N1TA 2G73A 1Q33A 1MR2A 3O52A 5GHJA 3WHWA 2DHOA 5C7TA 2VNQA 3AC9A 2RRKA 3Q2TA 4J7HA 3GZ6A 2KDVA 5DPKA 2JVBA 1MUTA 2I8UA 3O8SA 2QKMB 3X0JA 1K2EA 5IW4A 2B0VA 3A6SA 2I8TA 4NFWA 3MDGA 3ZR1A 3Q91A 3FK9A 3P6YA 3CNGA 1KT9A 4JZVA 1VIUA 2YVOA 4KYXA 5BS6A 4YPHA 3A6TA 3EESA 3SONA 2ICJA 2XSQA 4V14A 1VHZA 2DSCA 2VNPA 4IJXA 2YYHA 3FCMA 1V8UA 3BHOA 3EF5A 5ANTA 3L85A 1VIQA 3RH7A 1NQZA 3COUA 2DSDA 3FJYA 2A8TA 1JRKA 2CL3A 4DYWA 5FSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDW A;  3R03 A;  2G74 A;  2O5F A;  3BAP A;  5DEQ A;  2DSB A;  5DDG A;  2GT2 A;  1VHG A;  5C8L A;  2A8S A;  5FSK A;  5FSI A;  5FSL A;  3X0N A;  4YOQ A;  1R67 A;  1X83 A;  1G0S A;  2YVP A;  4KTB A;  5ANW A;  3ZR0 A;  2AZW A;  3BM4 A;  1PPV A;  1X51 A;  1V8N A;  3GG6 A;  3MCF A;  1SU2 A;  2O1C A;  5ANV A;  1XSA A;  3X0S A;  2A8R A;  2DUK A;  1XSC A;  3Q4I A;  2I6K A;  1HX3 A;  3X0P A;  4KG4 A;  3KVH A;  3P5T A;  1PUN A;  2R5W A;  2QJT A;  3X0K A;  3MGM A;  5IW5 A;  2PQV A;  3N9U A;  4HVY A;  1V8W A;  2ICK A;  2J8Q A;  3A6V A;  3ID9 A;  3Q2S A;  1MQE A;  3ACA A;  3HHJ A;  2GT4 A;  2FVV A;  1K26 A;  4JZS A;  1MK1 A;  1X84 A;  3O69 A;  3I7U A;  4K6E A;  1MQW A;  1PUQ A;  5FSM A;  5ISY A;  3MDI A;  4ICK A;  4MPO A;  4S2X A;  1V8I A;  4S2Y A;  1VCD A;  3A6U A;  3DUP A;  5BON A;  5GHI A;  3FSP A;  3X0I A;  4HFQ A;  1SZ3 A;  4S2V A;  1HZT A;  1V8T A;  1TUM A;  2FML A;  3O61 A;  3X0R A;  1VRL A;  5GHN A;  1V8V A;  3DKU A;  5I8U A;  3X0Q A;  3G0Q A;  3N77 A;  5C7Q A;  1MP2 A;  3QSJ A;  1V8R A;  5ANU A;  1OW2 A;  2PNY A;  3I9X A;  1SJY A;  3X0M A;  5GHQ A;  1PUS A;  3GZ8 A;  4N1U A;  2FKB A;  1U20 A;  1XSB A;  2O5W A;  3EXQ A;  2GB5 A;  2A8P A;  2QJO A;  3OGA A;  4S2W A;  4C9W A;  1RRQ A;  1GA7 A;  1IRY A;  4ZG0 A;  2A8Q A;  4NFX A;  1PPX A;  1V8M A;  2W4E A;  3H95 A;  1V8Y A;  1VK6 A;  4ILQ A;  1G9Q A;  4C9X A;  1NFZ A;  3X0L A;  1RRS A;  5FSO A;  3EEU A;  3E57 A;  3GWY A;  3O6Z A;  4JZT A;  4KG3 A;  5GHP A;  1JKN A;  2YVM A;  5GHO A;  4YPR A;  3F13 A;  3GZ5 A;  2A6T A;  3SHD A;  1I9A A;  5LPG A;  3I7V A;  3F6A A;  2B06 A;  1Q27 A;  1VC9 A;  5GHM A;  1KTG A;  4JZU A;  5CFJ A;  3HYQ A;  2B2K A;  1Q54 A;  3X0O A;  2Q9P A;  1QVJ A;  3Q93 A;  1F3Y A;  1NQY A;  3U53 A;  3Q1P A;  3SMD A;  1SOI A;  1RYA A;  1V8S A;  1PPW A;  2YVN A;  1NFS A;  1V8L A;  5HZX A;  1KHZ A;  3FFU A;  3GRN A;  5DD4 A;  3J7Y e;  1VC8 A;  5CFI A;  5ANS A;  1PVF A;  4N1T A;  2G73 A;  1Q33 A;  1MR2 A;  3O52 A;  5GHJ A;  3WHW A;  2DHO A;  5C7T A;  2VNQ A;  3AC9 A;  2RRK A;  3Q2T A;  3GZ6 A;  2KDV A;  5DPK A;  2JVB A;  1MUT A;  2I8U A;  3O8S A;  2QKM B;  3X0J A;  1K2E A;  5IW4 A;  2B0V A;  3A6S A;  2I8T A;  4NFW A;  3MDG A;  3ZR1 A;  3Q91 A;  3FK9 A;  3P6Y A;  3CNG A;  1KT9 A;  4JZV A;  1VIU A;  2YVO A;  4KYX A;  5BS6 A;  4YPH A;  3A6T A;  3EES A;  3SON A;  2ICJ A;  2XSQ A;  4V14 A;  1VHZ A;  2DSC A;  2VNP A;  4IJX A;  2YYH A;  3FCM A;  1V8U A;  3BHO A;  3EF5 A;  5ANT A;  3L85 A;  1VIQ A;  3RH7 A;  1NQZ A;  3COU A;  2DSD A;  3FJY A;  2A8T A;  1JRK A;  2CL3 A;  4DYW A;  5FSN A; 
#chains in the Genus database with same CATH topology
 2KDW A;  3R03 A;  2G74 A;  2O5F A;  3BAP A;  5DEQ A;  2DSB A;  5DDG A;  2GT2 A;  1VHG A;  5C8L A;  2A8S A;  5FSK A;  5FSI A;  5FSL A;  3X0N A;  4YOQ A;  1R67 A;  1X83 A;  1G0S A;  2YVP A;  4KTB A;  5ANW A;  3ZR0 A;  2AZW A;  3BM4 A;  1PPV A;  1X51 A;  1V8N A;  3GG6 A;  3MCF A;  1SU2 A;  2O1C A;  5ANV A;  1XSA A;  3X0S A;  2A8R A;  2DUK A;  1XSC A;  3Q4I A;  2I6K A;  1HX3 A;  3X0P A;  4KG4 A;  3KVH A;  3P5T A;  1PUN A;  2R5W A;  2QJT A;  3X0K A;  3MGM A;  5IW5 A;  2PQV A;  3N9U A;  4HVY A;  1V8W A;  2ICK A;  2J8Q A;  3A6V A;  3ID9 A;  3Q2S A;  1MQE A;  3ACA A;  3HHJ A;  2GT4 A;  4J7G A;  2FVV A;  1K26 A;  4JZS A;  1MK1 A;  1X84 A;  3O69 A;  3I7U A;  4K6E A;  1MQW A;  1PUQ A;  5FSM A;  5ISY A;  3MDI A;  4ICK A;  4MPO A;  4S2X A;  1V8I A;  4S2Y A;  1VCD A;  3A6U A;  3DUP A;  5BON A;  5GHI A;  3FSP A;  2CZR A;  3X0I A;  4HFQ A;  1SZ3 A;  4S2V A;  1HZT A;  1V8T A;  1TUM A;  2FML A;  3O61 A;  3X0R A;  1VRL A;  5GHN A;  1V8V A;  3DKU A;  5I8U A;  3X0Q A;  3G0Q A;  3N77 A;  5C7Q A;  1MP2 A;  3QSJ A;  1V8R A;  5ANU A;  1OW2 A;  2PNY A;  3I9X A;  1SJY A;  3X0M A;  5GHQ A;  1PUS A;  3GZ8 A;  4N1U A;  2FKB A;  1U20 A;  1XSB A;  2O5W A;  3EXQ A;  2GB5 A;  2A8P A;  2QJO A;  3OGA A;  4S2W A;  4C9W A;  1RRQ A;  1GA7 A;  1IRY A;  4ZG0 A;  2A8Q A;  4NFX A;  1PPX A;  1V8M A;  2W4E A;  3H95 A;  1V8Y A;  1VK6 A;  4ILQ A;  1G9Q A;  4C9X A;  1NFZ A;  3X0L A;  1RRS A;  5FSO A;  3EEU A;  3E57 A;  3GWY A;  3O6Z A;  4JZT A;  4KG3 A;  5GHP A;  1JKN A;  2YVM A;  5GHO A;  4YPR A;  3F13 A;  3GZ5 A;  2A6T A;  3SHD A;  1I9A A;  5LPG A;  3I7V A;  3F6A A;  2B06 A;  1Q27 A;  1VC9 A;  5GHM A;  1KTG A;  4JZU A;  5CFJ A;  3HYQ A;  2B2K A;  1Q54 A;  3X0O A;  2Q9P A;  1QVJ A;  3Q93 A;  1F3Y A;  1NQY A;  3U53 A;  3Q1P A;  3SMD A;  1SOI A;  1RYA A;  1V8S A;  1PPW A;  2YVN A;  1NFS A;  1V8L A;  5HZX A;  1KHZ A;  3FFU A;  3GRN A;  5DD4 A;  3J7Y e;  1VC8 A;  5CFI A;  5ANS A;  1PVF A;  4N1T A;  2G73 A;  1Q33 A;  1MR2 A;  3O52 A;  5GHJ A;  3WHW A;  2DHO A;  5C7T A;  2VNQ A;  3AC9 A;  2RRK A;  3Q2T A;  4J7H A;  3GZ6 A;  2KDV A;  5DPK A;  2JVB A;  1MUT A;  2I8U A;  3O8S A;  2QKM B;  3X0J A;  1K2E A;  5IW4 A;  2B0V A;  3A6S A;  2I8T A;  4NFW A;  3MDG A;  3ZR1 A;  3Q91 A;  3FK9 A;  3P6Y A;  3CNG A;  1KT9 A;  4JZV A;  1VIU A;  2YVO A;  4KYX A;  5BS6 A;  4YPH A;  3A6T A;  3EES A;  3SON A;  2ICJ A;  2XSQ A;  4V14 A;  1VHZ A;  2DSC A;  2VNP A;  4IJX A;  2YYH A;  3FCM A;  1V8U A;  3BHO A;  3EF5 A;  5ANT A;  3L85 A;  1VIQ A;  3RH7 A;  1NQZ A;  3COU A;  2DSD A;  3FJY A;  2A8T A;  1JRK A;  2CL3 A;  4DYW A;  5FSN A; 
#chains in the Genus database with same CATH homology
 2KDW A;  3R03 A;  2G74 A;  2O5F A;  3BAP A;  5DEQ A;  2DSB A;  5DDG A;  2GT2 A;  1VHG A;  5C8L A;  2A8S A;  5FSK A;  5FSI A;  5FSL A;  3X0N A;  4YOQ A;  1R67 A;  1X83 A;  1G0S A;  2YVP A;  4KTB A;  5ANW A;  3ZR0 A;  2AZW A;  3BM4 A;  1PPV A;  1X51 A;  1V8N A;  3GG6 A;  3MCF A;  1SU2 A;  2O1C A;  5ANV A;  1XSA A;  3X0S A;  2A8R A;  2DUK A;  1XSC A;  3Q4I A;  2I6K A;  1HX3 A;  3X0P A;  4KG4 A;  3KVH A;  3P5T A;  1PUN A;  2R5W A;  2QJT A;  3X0K A;  3MGM A;  5IW5 A;  2PQV A;  3N9U A;  4HVY A;  1V8W A;  2ICK A;  2J8Q A;  3A6V A;  3ID9 A;  3Q2S A;  1MQE A;  3ACA A;  3HHJ A;  2GT4 A;  4J7G A;  2FVV A;  1K26 A;  4JZS A;  1MK1 A;  1X84 A;  3O69 A;  3I7U A;  4K6E A;  1MQW A;  1PUQ A;  5FSM A;  5ISY A;  3MDI A;  4ICK A;  4MPO A;  4S2X A;  1V8I A;  4S2Y A;  1VCD A;  3A6U A;  3DUP A;  5BON A;  5GHI A;  3FSP A;  2CZR A;  3X0I A;  4HFQ A;  1SZ3 A;  4S2V A;  1HZT A;  1V8T A;  1TUM A;  2FML A;  3O61 A;  3X0R A;  1VRL A;  5GHN A;  1V8V A;  3DKU A;  5I8U A;  3X0Q A;  3G0Q A;  3N77 A;  5C7Q A;  1MP2 A;  3QSJ A;  1V8R A;  5ANU A;  1OW2 A;  2PNY A;  3I9X A;  1SJY A;  3X0M A;  5GHQ A;  1PUS A;  3GZ8 A;  4N1U A;  2FKB A;  1U20 A;  1XSB A;  2O5W A;  3EXQ A;  2GB5 A;  2A8P A;  2QJO A;  3OGA A;  4S2W A;  4C9W A;  1RRQ A;  1GA7 A;  1IRY A;  4ZG0 A;  2A8Q A;  4NFX A;  1PPX A;  1V8M A;  2W4E A;  3H95 A;  1V8Y A;  1VK6 A;  4ILQ A;  1G9Q A;  4C9X A;  1NFZ A;  3X0L A;  1RRS A;  5FSO A;  3EEU A;  3E57 A;  3GWY A;  3O6Z A;  4JZT A;  4KG3 A;  5GHP A;  1JKN A;  2YVM A;  5GHO A;  4YPR A;  3F13 A;  3GZ5 A;  2A6T A;  3SHD A;  1I9A A;  5LPG A;  3I7V A;  3F6A A;  2B06 A;  1Q27 A;  1VC9 A;  5GHM A;  1KTG A;  4JZU A;  5CFJ A;  3HYQ A;  2B2K A;  1Q54 A;  3X0O A;  2Q9P A;  1QVJ A;  3Q93 A;  1F3Y A;  1NQY A;  3U53 A;  3Q1P A;  3SMD A;  1SOI A;  1RYA A;  1V8S A;  1PPW A;  2YVN A;  1NFS A;  1V8L A;  5HZX A;  1KHZ A;  3FFU A;  3GRN A;  5DD4 A;  3J7Y e;  1VC8 A;  5CFI A;  5ANS A;  1PVF A;  4N1T A;  2G73 A;  1Q33 A;  1MR2 A;  3O52 A;  5GHJ A;  3WHW A;  2DHO A;  5C7T A;  2VNQ A;  3AC9 A;  2RRK A;  3Q2T A;  4J7H A;  3GZ6 A;  2KDV A;  5DPK A;  2JVB A;  1MUT A;  2I8U A;  3O8S A;  2QKM B;  3X0J A;  1K2E A;  5IW4 A;  2B0V A;  3A6S A;  2I8T A;  4NFW A;  3MDG A;  3ZR1 A;  3Q91 A;  3FK9 A;  3P6Y A;  3CNG A;  1KT9 A;  4JZV A;  1VIU A;  2YVO A;  4KYX A;  5BS6 A;  4YPH A;  3A6T A;  3EES A;  3SON A;  2ICJ A;  2XSQ A;  4V14 A;  1VHZ A;  2DSC A;  2VNP A;  4IJX A;  2YYH A;  3FCM A;  1V8U A;  3BHO A;  3EF5 A;  5ANT A;  3L85 A;  1VIQ A;  3RH7 A;  1NQZ A;  3COU A;  2DSD A;  3FJY A;  2A8T A;  1JRK A;  2CL3 A;  4DYW A;  5FSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...