1JKNA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
165
structure length
165
Chain Sequence
b'GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase
publication title The structure of Ap(4)A hydrolase complexed with ATP-MgF(x) reveals the basis of substrate binding.
pubmed doi rcsb
source organism Lupinus angustifolius
molecule tags Hydrolase
total genus 27
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1jknA00
1MK1A 3SHDA 2PQVA 3H95A 3GZ6A 2DUKA 4KG3A 5ANUA 2CL3A 5FSIA 5C7QA 3I7UA 3ID9A 2GB5A 5HZXA 3MCFA 1V8MA 5FSLA 3X0SA 1KT9A 2ICJA 2B2KA 3FFUA 3X0RA 5BONA 4S2WA 2O1CA 2AZWA 3DUPA 1X83A 3Q4IA 3EEUA 1V8UA 2XSQA 2B06A 1KTGA 2FVVA 4S2YA 2RRKA 2JVBA 3R03A 1V8SA 3P6YA 2A8RA 1X51A 3A6VA 3FSPA 3I7VA 1VRLA 1MQEA 1PPXA 2W4EA 3N77A 3Q1PA 4KYXA 1QVJA 3ZR1A 4JZTA 4YPRA 1V8LA 1V8YA 3HYQA 1MR2A 5ANWA 3Q2TA 2R5WA 2O5WA 3X0OA 1MQWA 3GG6A 2KDWA 3AC9A 3BM4A 4JZUA 3GWYA 5ANVA 2GT4A 2G73A 3F13A 1VHGA 3U53A 1VHZA 2G74A 1F3YA 5GHJA 1JRKA 1VC9A 2J8QA 2QJOA 3MDGA 5DD4A 3ZR0A 4HVYA 4N1TA 1R67A 1VIUA 1NQZA 3X0QA 3X0KA 4KTBA 3QSJA 2QJTA 3HHJA 2YVMA 1I9AA 1SOIA 1V8WA 2A8TA 5FSKA 1SZ3A 5FSMA 3X0LA 3Q2SA 4YOQA 2DSBA 3ACAA 3DKUA 4V14A 3X0NA 1V8RA 3A6UA 3OGAA 3BHOA 3A6TA 5C8LA 2O5FA 2VNQA 2QKMB 3FCMA 4NFWA 3EESA 5ANSA 4S2XA 4C9WA 1VCDA 1XSAA 2A8SA 5GHQA 2YVOA 2ICKA 1RRSA 1OW2A 1VIQA 2A6TA 3KVHA 3EF5A 1NFZA 2YYHA 1MP2A 2FKBA 3COUA 5DEQA 5GHMA 1HZTA 5GHPA 2PNYA 3N9UA 5CFJA 3WHWA 1GA7A 3O52A 1RYAA 3A6SA 2B0VA 1VK6A 4ICKA 4JZSA 5FSNA 1SU2A 1V8NA 2FMLA 5DPKA 1PPVA 4IJXA 1PUNA 2A8QA 3MGMA 5IW4A 3X0MA 3FK9A 4KG4A 5FSOA 1G0SA 3CNGA 4JZVA 5GHIA 3MDIA 2YVNA 1SJYA 3SONA 4MPOA 1NFSA 5IW5A 1XSBA 1U20A 3X0IA 4YPHA 1KHZA 1MUTA 5I8UA 3Q91A 1PUQA 5BS6A 1V8VA 1XSCA 1HX3A 3O6ZA 1PUSA 4ILQA 3O61A 4S2VA 1K2EA 3O8SA 1G9QA 3GZ8A 1TUMA 3F6AA 3P5TA 3RH7A 2DHOA 2DSCA 2VNPA 4DYWA 3BAPA 3L85A 1K26A 2Q9PA 1VC8A 2YVPA 3X0JA 2KDVA 1X84A 1IRYA 1PPWA 4C9XA 5CFIA 2I8TA 3G0QA 2A8PA 3E57A 4N1UA 1NQYA 3J7Ye 1JKNA 4NFXA 2I6KA 3FJYA 5ANTA 3GZ5A 3GRNA 4K6EA 2DSDA 5C7TA 3X0PA 2I8UA 3SMDA 2GT2A 1Q27A 3Q93A 1V8IA 1PVFA 3I9XA 5GHOA 3EXQA 5ISYA 4HFQA 1Q54A 1V8TA 5GHNA 1RRQA 5LPGA 5DDGA 1Q33A 4ZG0A 3O69A
chains in the Genus database with same CATH superfamily
1MK1A 3SHDA 2PQVA 3H95A 3GZ6A 2DUKA 4KG3A 5ANUA 2CL3A 5FSIA 5C7QA 3I7UA 3ID9A 2GB5A 4J7HA 3MCFA 1V8MA 5HZXA 2CZRA 5FSLA 3X0SA 1KT9A 2ICJA 2B2KA 3FFUA 3X0RA 5BONA 4S2WA 2O1CA 2AZWA 3DUPA 1X83A 3Q4IA 3EEUA 1V8UA 2XSQA 2B06A 1KTGA 2FVVA 4S2YA 2RRKA 2JVBA 3R03A 1V8SA 3P6YA 2A8RA 1X51A 3A6VA 3FSPA 3I7VA 1VRLA 1MQEA 1PPXA 2W4EA 3N77A 3Q1PA 4KYXA 1QVJA 3ZR1A 4JZTA 4YPRA 1V8LA 1V8YA 3HYQA 1MR2A 5ANWA 3Q2TA 2R5WA 2O5WA 3X0OA 1MQWA 3GG6A 2KDWA 3AC9A 3BM4A 4JZUA 3GWYA 5ANVA 2GT4A 2G73A 3F13A 1VHGA 3U53A 1VHZA 2G74A 1F3YA 5GHJA 1JRKA 1VC9A 2J8QA 2QJOA 3MDGA 5DD4A 3ZR0A 4HVYA 4N1TA 1R67A 1VIUA 1NQZA 3X0QA 3X0KA 4KTBA 3QSJA 2QJTA 3HHJA 2YVMA 1I9AA 1SOIA 1V8WA 2A8TA 5FSKA 1SZ3A 5FSMA 3X0LA 3Q2SA 4YOQA 2DSBA 3ACAA 3DKUA 4V14A 3X0NA 1V8RA 3A6UA 3OGAA 3BHOA 3A6TA 5C8LA 2O5FA 2VNQA 2QKMB 3FCMA 4NFWA 3EESA 5ANSA 4S2XA 4C9WA 1VCDA 1XSAA 2A8SA 5GHQA 2YVOA 2ICKA 1RRSA 1OW2A 1VIQA 2A6TA 3KVHA 3EF5A 1NFZA 2YYHA 1MP2A 2FKBA 3COUA 5DEQA 5GHMA 1HZTA 5GHPA 2PNYA 3N9UA 4J7GA 3WHWA 1GA7A 5CFJA 3O52A 1RYAA 3A6SA 2B0VA 1VK6A 4ICKA 4JZSA 5FSNA 1SU2A 1V8NA 2FMLA 5DPKA 1PPVA 4IJXA 1PUNA 2A8QA 3MGMA 5IW4A 3X0MA 3FK9A 4KG4A 5FSOA 1G0SA 3CNGA 4JZVA 5GHIA 3MDIA 2YVNA 1SJYA 3SONA 4MPOA 1NFSA 5IW5A 1XSBA 1U20A 3X0IA 4YPHA 1KHZA 1MUTA 5I8UA 3Q91A 1PUQA 5BS6A 1V8VA 1XSCA 1HX3A 3O6ZA 1PUSA 4ILQA 3O61A 4S2VA 1K2EA 3O8SA 1G9QA 3GZ8A 1TUMA 3F6AA 3P5TA 3RH7A 2DHOA 2DSCA 2VNPA 4DYWA 3BAPA 3L85A 1K26A 2Q9PA 1VC8A 2YVPA 3X0JA 2KDVA 1X84A 1IRYA 1PPWA 4C9XA 5CFIA 2I8TA 3G0QA 2A8PA 3E57A 4N1UA 1NQYA 3J7Ye 1JKNA 4NFXA 2I6KA 3FJYA 5ANTA 3GZ5A 3GRNA 4K6EA 2DSDA 5C7TA 3X0PA 2I8UA 3SMDA 2GT2A 1Q27A 3Q93A 1V8IA 1PVFA 3I9XA 5GHOA 3EXQA 5ISYA 4HFQA 1Q54A 1V8TA 5GHNA 1RRQA 5LPGA 5DDGA 1Q33A 4ZG0A 3O69A
chains in the Genus database with same CATH topology
1MK1A 3SHDA 2PQVA 3H95A 3GZ6A 2DUKA 4KG3A 5ANUA 2CL3A 5FSIA 5C7QA 3I7UA 3ID9A 2GB5A 4J7HA 3MCFA 1V8MA 5HZXA 2CZRA 5FSLA 3X0SA 1KT9A 2ICJA 2B2KA 3FFUA 3X0RA 5BONA 4S2WA 2O1CA 2AZWA 3DUPA 1X83A 3Q4IA 3EEUA 1V8UA 2XSQA 2B06A 1KTGA 2FVVA 4S2YA 2RRKA 2JVBA 3R03A 1V8SA 3P6YA 2A8RA 1X51A 3A6VA 3FSPA 3I7VA 1VRLA 1MQEA 1PPXA 2W4EA 3N77A 3Q1PA 4KYXA 1QVJA 3ZR1A 4JZTA 4YPRA 1V8LA 1V8YA 3HYQA 1MR2A 5ANWA 3Q2TA 2R5WA 2O5WA 3X0OA 1MQWA 3GG6A 2KDWA 3AC9A 3BM4A 4JZUA 3GWYA 5ANVA 2GT4A 2G73A 3F13A 1VHGA 3U53A 1VHZA 2G74A 1F3YA 5GHJA 1JRKA 1VC9A 2J8QA 2QJOA 3MDGA 5DD4A 3ZR0A 4HVYA 4N1TA 1R67A 1VIUA 1NQZA 3X0QA 3X0KA 4KTBA 3QSJA 2QJTA 3HHJA 2YVMA 1I9AA 1SOIA 1V8WA 2A8TA 5FSKA 1SZ3A 5FSMA 3X0LA 3Q2SA 4YOQA 2DSBA 3ACAA 3DKUA 4V14A 3X0NA 1V8RA 3A6UA 3OGAA 3BHOA 3A6TA 5C8LA 2O5FA 2VNQA 2QKMB 3FCMA 4NFWA 3EESA 5ANSA 4S2XA 4C9WA 1VCDA 1XSAA 2A8SA 5GHQA 2YVOA 2ICKA 1RRSA 1OW2A 1VIQA 2A6TA 3KVHA 3EF5A 1NFZA 2YYHA 1MP2A 2FKBA 3COUA 5DEQA 5GHMA 1HZTA 5GHPA 2PNYA 3N9UA 4J7GA 3WHWA 1GA7A 5CFJA 3O52A 1RYAA 3A6SA 2B0VA 1VK6A 4ICKA 4JZSA 5FSNA 1SU2A 1V8NA 2FMLA 5DPKA 1PPVA 4IJXA 1PUNA 2A8QA 3MGMA 5IW4A 3X0MA 3FK9A 4KG4A 5FSOA 1G0SA 3CNGA 4JZVA 5GHIA 3MDIA 2YVNA 1SJYA 3SONA 4MPOA 1NFSA 5IW5A 1XSBA 1U20A 3X0IA 4YPHA 1KHZA 1MUTA 5I8UA 3Q91A 1PUQA 5BS6A 1V8VA 1XSCA 1HX3A 3O6ZA 1PUSA 4ILQA 3O61A 4S2VA 1K2EA 3O8SA 1G9QA 3GZ8A 1TUMA 3F6AA 3P5TA 3RH7A 2DHOA 2DSCA 2VNPA 4DYWA 3BAPA 3L85A 1K26A 2Q9PA 1VC8A 2YVPA 3X0JA 2KDVA 1X84A 1IRYA 1PPWA 4C9XA 5CFIA 2I8TA 3G0QA 2A8PA 3E57A 4N1UA 1NQYA 3J7Ye 1JKNA 4NFXA 2I6KA 3FJYA 5ANTA 3GZ5A 3GRNA 4K6EA 2DSDA 5C7TA 3X0PA 2I8UA 3SMDA 2GT2A 1Q27A 3Q93A 1V8IA 1PVFA 3I9XA 5GHOA 3EXQA 5ISYA 4HFQA 1Q54A 1V8TA 5GHNA 1RRQA 5LPGA 5DDGA 1Q33A 4ZG0A 3O69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK1 A;  3SHD A;  2PQV A;  3H95 A;  3GZ6 A;  2DUK A;  4KG3 A;  5ANU A;  2CL3 A;  5FSI A;  5C7Q A;  3I7U A;  3ID9 A;  2GB5 A;  5HZX A;  3MCF A;  1V8M A;  5FSL A;  3X0S A;  1KT9 A;  2ICJ A;  2B2K A;  3FFU A;  3X0R A;  5BON A;  4S2W A;  2O1C A;  2AZW A;  3DUP A;  1X83 A;  3Q4I A;  3EEU A;  1V8U A;  2XSQ A;  2B06 A;  1KTG A;  2FVV A;  4S2Y A;  2RRK A;  2JVB A;  3R03 A;  1V8S A;  3P6Y A;  2A8R A;  1X51 A;  3A6V A;  3FSP A;  3I7V A;  1VRL A;  1MQE A;  1PPX A;  2W4E A;  3N77 A;  3Q1P A;  4KYX A;  1QVJ A;  3ZR1 A;  4JZT A;  4YPR A;  1V8L A;  1V8Y A;  3HYQ A;  1MR2 A;  5ANW A;  3Q2T A;  2R5W A;  2O5W A;  3X0O A;  1MQW A;  3GG6 A;  2KDW A;  3AC9 A;  3BM4 A;  4JZU A;  3GWY A;  5ANV A;  2GT4 A;  2G73 A;  3F13 A;  1VHG A;  3U53 A;  1VHZ A;  2G74 A;  1F3Y A;  5GHJ A;  1JRK A;  1VC9 A;  2J8Q A;  2QJO A;  3MDG A;  5DD4 A;  3ZR0 A;  4HVY A;  4N1T A;  1R67 A;  1VIU A;  1NQZ A;  3X0Q A;  3X0K A;  4KTB A;  3QSJ A;  2QJT A;  3HHJ A;  2YVM A;  1I9A A;  1SOI A;  1V8W A;  2A8T A;  5FSK A;  1SZ3 A;  5FSM A;  3X0L A;  3Q2S A;  4YOQ A;  2DSB A;  3ACA A;  3DKU A;  4V14 A;  3X0N A;  1V8R A;  3A6U A;  3OGA A;  3BHO A;  3A6T A;  5C8L A;  2O5F A;  2VNQ A;  2QKM B;  3FCM A;  4NFW A;  3EES A;  5ANS A;  4S2X A;  4C9W A;  1VCD A;  1XSA A;  2A8S A;  5GHQ A;  2YVO A;  2ICK A;  1RRS A;  1OW2 A;  1VIQ A;  2A6T A;  3KVH A;  3EF5 A;  1NFZ A;  2YYH A;  1MP2 A;  2FKB A;  3COU A;  5DEQ A;  5GHM A;  1HZT A;  5GHP A;  2PNY A;  3N9U A;  5CFJ A;  3WHW A;  1GA7 A;  3O52 A;  1RYA A;  3A6S A;  2B0V A;  1VK6 A;  4ICK A;  4JZS A;  5FSN A;  1SU2 A;  1V8N A;  2FML A;  5DPK A;  1PPV A;  4IJX A;  1PUN A;  2A8Q A;  3MGM A;  5IW4 A;  3X0M A;  3FK9 A;  4KG4 A;  5FSO A;  1G0S A;  3CNG A;  4JZV A;  5GHI A;  3MDI A;  2YVN A;  1SJY A;  3SON A;  4MPO A;  1NFS A;  5IW5 A;  1XSB A;  1U20 A;  3X0I A;  4YPH A;  1KHZ A;  1MUT A;  5I8U A;  3Q91 A;  1PUQ A;  5BS6 A;  1V8V A;  1XSC A;  1HX3 A;  3O6Z A;  1PUS A;  4ILQ A;  3O61 A;  4S2V A;  1K2E A;  3O8S A;  1G9Q A;  3GZ8 A;  1TUM A;  3F6A A;  3P5T A;  3RH7 A;  2DHO A;  2DSC A;  2VNP A;  4DYW A;  3BAP A;  3L85 A;  1K26 A;  2Q9P A;  1VC8 A;  2YVP A;  3X0J A;  2KDV A;  1X84 A;  1IRY A;  1PPW A;  4C9X A;  5CFI A;  2I8T A;  3G0Q A;  2A8P A;  3E57 A;  4N1U A;  1NQY A;  3J7Y e;  1JKN A;  4NFX A;  2I6K A;  3FJY A;  5ANT A;  3GZ5 A;  3GRN A;  4K6E A;  2DSD A;  5C7T A;  3X0P A;  2I8U A;  3SMD A;  2GT2 A;  1Q27 A;  3Q93 A;  1V8I A;  1PVF A;  3I9X A;  5GHO A;  3EXQ A;  5ISY A;  4HFQ A;  1Q54 A;  1V8T A;  5GHN A;  1RRQ A;  5LPG A;  5DDG A;  1Q33 A;  4ZG0 A;  3O69 A; 
#chains in the Genus database with same CATH topology
 1MK1 A;  3SHD A;  2PQV A;  3H95 A;  3GZ6 A;  2DUK A;  4KG3 A;  5ANU A;  2CL3 A;  5FSI A;  5C7Q A;  3I7U A;  3ID9 A;  2GB5 A;  4J7H A;  3MCF A;  1V8M A;  5HZX A;  2CZR A;  5FSL A;  3X0S A;  1KT9 A;  2ICJ A;  2B2K A;  3FFU A;  3X0R A;  5BON A;  4S2W A;  2O1C A;  2AZW A;  3DUP A;  1X83 A;  3Q4I A;  3EEU A;  1V8U A;  2XSQ A;  2B06 A;  1KTG A;  2FVV A;  4S2Y A;  2RRK A;  2JVB A;  3R03 A;  1V8S A;  3P6Y A;  2A8R A;  1X51 A;  3A6V A;  3FSP A;  3I7V A;  1VRL A;  1MQE A;  1PPX A;  2W4E A;  3N77 A;  3Q1P A;  4KYX A;  1QVJ A;  3ZR1 A;  4JZT A;  4YPR A;  1V8L A;  1V8Y A;  3HYQ A;  1MR2 A;  5ANW A;  3Q2T A;  2R5W A;  2O5W A;  3X0O A;  1MQW A;  3GG6 A;  2KDW A;  3AC9 A;  3BM4 A;  4JZU A;  3GWY A;  5ANV A;  2GT4 A;  2G73 A;  3F13 A;  1VHG A;  3U53 A;  1VHZ A;  2G74 A;  1F3Y A;  5GHJ A;  1JRK A;  1VC9 A;  2J8Q A;  2QJO A;  3MDG A;  5DD4 A;  3ZR0 A;  4HVY A;  4N1T A;  1R67 A;  1VIU A;  1NQZ A;  3X0Q A;  3X0K A;  4KTB A;  3QSJ A;  2QJT A;  3HHJ A;  2YVM A;  1I9A A;  1SOI A;  1V8W A;  2A8T A;  5FSK A;  1SZ3 A;  5FSM A;  3X0L A;  3Q2S A;  4YOQ A;  2DSB A;  3ACA A;  3DKU A;  4V14 A;  3X0N A;  1V8R A;  3A6U A;  3OGA A;  3BHO A;  3A6T A;  5C8L A;  2O5F A;  2VNQ A;  2QKM B;  3FCM A;  4NFW A;  3EES A;  5ANS A;  4S2X A;  4C9W A;  1VCD A;  1XSA A;  2A8S A;  5GHQ A;  2YVO A;  2ICK A;  1RRS A;  1OW2 A;  1VIQ A;  2A6T A;  3KVH A;  3EF5 A;  1NFZ A;  2YYH A;  1MP2 A;  2FKB A;  3COU A;  5DEQ A;  5GHM A;  1HZT A;  5GHP A;  2PNY A;  3N9U A;  4J7G A;  3WHW A;  1GA7 A;  5CFJ A;  3O52 A;  1RYA A;  3A6S A;  2B0V A;  1VK6 A;  4ICK A;  4JZS A;  5FSN A;  1SU2 A;  1V8N A;  2FML A;  5DPK A;  1PPV A;  4IJX A;  1PUN A;  2A8Q A;  3MGM A;  5IW4 A;  3X0M A;  3FK9 A;  4KG4 A;  5FSO A;  1G0S A;  3CNG A;  4JZV A;  5GHI A;  3MDI A;  2YVN A;  1SJY A;  3SON A;  4MPO A;  1NFS A;  5IW5 A;  1XSB A;  1U20 A;  3X0I A;  4YPH A;  1KHZ A;  1MUT A;  5I8U A;  3Q91 A;  1PUQ A;  5BS6 A;  1V8V A;  1XSC A;  1HX3 A;  3O6Z A;  1PUS A;  4ILQ A;  3O61 A;  4S2V A;  1K2E A;  3O8S A;  1G9Q A;  3GZ8 A;  1TUM A;  3F6A A;  3P5T A;  3RH7 A;  2DHO A;  2DSC A;  2VNP A;  4DYW A;  3BAP A;  3L85 A;  1K26 A;  2Q9P A;  1VC8 A;  2YVP A;  3X0J A;  2KDV A;  1X84 A;  1IRY A;  1PPW A;  4C9X A;  5CFI A;  2I8T A;  3G0Q A;  2A8P A;  3E57 A;  4N1U A;  1NQY A;  3J7Y e;  1JKN A;  4NFX A;  2I6K A;  3FJY A;  5ANT A;  3GZ5 A;  3GRN A;  4K6E A;  2DSD A;  5C7T A;  3X0P A;  2I8U A;  3SMD A;  2GT2 A;  1Q27 A;  3Q93 A;  1V8I A;  1PVF A;  3I9X A;  5GHO A;  3EXQ A;  5ISY A;  4HFQ A;  1Q54 A;  1V8T A;  5GHN A;  1RRQ A;  5LPG A;  5DDG A;  1Q33 A;  4ZG0 A;  3O69 A; 
#chains in the Genus database with same CATH homology
 1MK1 A;  3SHD A;  2PQV A;  3H95 A;  3GZ6 A;  2DUK A;  4KG3 A;  5ANU A;  2CL3 A;  5FSI A;  5C7Q A;  3I7U A;  3ID9 A;  2GB5 A;  4J7H A;  3MCF A;  1V8M A;  5HZX A;  2CZR A;  5FSL A;  3X0S A;  1KT9 A;  2ICJ A;  2B2K A;  3FFU A;  3X0R A;  5BON A;  4S2W A;  2O1C A;  2AZW A;  3DUP A;  1X83 A;  3Q4I A;  3EEU A;  1V8U A;  2XSQ A;  2B06 A;  1KTG A;  2FVV A;  4S2Y A;  2RRK A;  2JVB A;  3R03 A;  1V8S A;  3P6Y A;  2A8R A;  1X51 A;  3A6V A;  3FSP A;  3I7V A;  1VRL A;  1MQE A;  1PPX A;  2W4E A;  3N77 A;  3Q1P A;  4KYX A;  1QVJ A;  3ZR1 A;  4JZT A;  4YPR A;  1V8L A;  1V8Y A;  3HYQ A;  1MR2 A;  5ANW A;  3Q2T A;  2R5W A;  2O5W A;  3X0O A;  1MQW A;  3GG6 A;  2KDW A;  3AC9 A;  3BM4 A;  4JZU A;  3GWY A;  5ANV A;  2GT4 A;  2G73 A;  3F13 A;  1VHG A;  3U53 A;  1VHZ A;  2G74 A;  1F3Y A;  5GHJ A;  1JRK A;  1VC9 A;  2J8Q A;  2QJO A;  3MDG A;  5DD4 A;  3ZR0 A;  4HVY A;  4N1T A;  1R67 A;  1VIU A;  1NQZ A;  3X0Q A;  3X0K A;  4KTB A;  3QSJ A;  2QJT A;  3HHJ A;  2YVM A;  1I9A A;  1SOI A;  1V8W A;  2A8T A;  5FSK A;  1SZ3 A;  5FSM A;  3X0L A;  3Q2S A;  4YOQ A;  2DSB A;  3ACA A;  3DKU A;  4V14 A;  3X0N A;  1V8R A;  3A6U A;  3OGA A;  3BHO A;  3A6T A;  5C8L A;  2O5F A;  2VNQ A;  2QKM B;  3FCM A;  4NFW A;  3EES A;  5ANS A;  4S2X A;  4C9W A;  1VCD A;  1XSA A;  2A8S A;  5GHQ A;  2YVO A;  2ICK A;  1RRS A;  1OW2 A;  1VIQ A;  2A6T A;  3KVH A;  3EF5 A;  1NFZ A;  2YYH A;  1MP2 A;  2FKB A;  3COU A;  5DEQ A;  5GHM A;  1HZT A;  5GHP A;  2PNY A;  3N9U A;  4J7G A;  3WHW A;  1GA7 A;  5CFJ A;  3O52 A;  1RYA A;  3A6S A;  2B0V A;  1VK6 A;  4ICK A;  4JZS A;  5FSN A;  1SU2 A;  1V8N A;  2FML A;  5DPK A;  1PPV A;  4IJX A;  1PUN A;  2A8Q A;  3MGM A;  5IW4 A;  3X0M A;  3FK9 A;  4KG4 A;  5FSO A;  1G0S A;  3CNG A;  4JZV A;  5GHI A;  3MDI A;  2YVN A;  1SJY A;  3SON A;  4MPO A;  1NFS A;  5IW5 A;  1XSB A;  1U20 A;  3X0I A;  4YPH A;  1KHZ A;  1MUT A;  5I8U A;  3Q91 A;  1PUQ A;  5BS6 A;  1V8V A;  1XSC A;  1HX3 A;  3O6Z A;  1PUS A;  4ILQ A;  3O61 A;  4S2V A;  1K2E A;  3O8S A;  1G9Q A;  3GZ8 A;  1TUM A;  3F6A A;  3P5T A;  3RH7 A;  2DHO A;  2DSC A;  2VNP A;  4DYW A;  3BAP A;  3L85 A;  1K26 A;  2Q9P A;  1VC8 A;  2YVP A;  3X0J A;  2KDV A;  1X84 A;  1IRY A;  1PPW A;  4C9X A;  5CFI A;  2I8T A;  3G0Q A;  2A8P A;  3E57 A;  4N1U A;  1NQY A;  3J7Y e;  1JKN A;  4NFX A;  2I6K A;  3FJY A;  5ANT A;  3GZ5 A;  3GRN A;  4K6E A;  2DSD A;  5C7T A;  3X0P A;  2I8U A;  3SMD A;  2GT2 A;  1Q27 A;  3Q93 A;  1V8I A;  1PVF A;  3I9X A;  5GHO A;  3EXQ A;  5ISY A;  4HFQ A;  1Q54 A;  1V8T A;  5GHN A;  1RRQ A;  5LPG A;  5DDG A;  1Q33 A;  4ZG0 A;  3O69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...