1JKNA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
165
structure length
165
Chain Sequence
GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase
publication title The structure of Ap(4)A hydrolase complexed with ATP-MgF(x) reveals the basis of substrate binding.
pubmed doi rcsb
source organism Lupinus angustifolius
total genus 27
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1jknA00
3MDIA 2YYHA 2ICJA 4YPRA 1K2EA 3GWYA 1VRLA 3OGAA 1MR2A 2B0VA 5ANUA 1OW2A 2CL3A 1G9QA 3COUA 2FVVA 2B06A 5C8LA 2YVPA 4N1UA 3FCMA 3I7UA 3X0QA 2O5FA 4S2YA 1XSAA 3EESA 4S2VA 3X0OA 2R5WA 4KG4A 3HHJA 1U20A 4DYWA 1VC9A 1V8VA 2GT4A 3ZR1A 1NQZA 1GA7A 3I7VA 3BHOA 4JZTA 4N1TA 3WHWA 5ANWA 2O1CA 3O6ZA 4KG3A 5I8UA 5BS6A 3QSJA 1PVFA 1V8MA 5CFJA 2FKBA 3Q2TA 1PPXA 2AZWA 3P5TA 2J8QA 2YVMA 3Q93A 3R03A 3U53A 1HX3A 3O52A 5GHIA 4NFWA 4C9XA 1X51A 1QVJA 1V8IA 3GG6A 2GT2A 1SU2A 3ID9A 3X0RA 3X0KA 5GHOA 3A6VA 2KDWA 3X0LA 4S2WA 1Q27A 1MQWA 5ISYA 3G0QA 5DD4A 3P6YA 1X83A 5CFIA 2YVNA 3O8SA 2A6TA 3BM4A 1VIQA 3EEUA 5FSIA 2YVOA 1VC8A 1JRKA 5LPGA 1PUNA 3O69A 4ICKA 1G0SA 2A8PA 1XSCA 2KDVA 1NQYA 2FMLA 2GB5A 2Q9PA 3DKUA 1MP2A 2XSQA 1KHZA 1NFSA 2ICKA 2PQVA 3ACAA 4IJXA 3X0SA 4YPHA 2A8RA 1Q33A 2I6KA 3KVHA 1RRQA 3MGMA 5ANTA 4HFQA 1PUQA 1KTGA 1V8SA 1K26A 2G73A 5FSNA 2VNPA 5GHNA 1V8TA 4JZUA 2I8TA 2QJTA 3FFUA 2RRKA 5GHQA 3N77A 1PPWA 1VCDA 3BAPA 4YOQA 3MDGA 1SZ3A 2DHOA 4V14A 1RRSA 1SJYA 4C9WA 3Q2SA 4KTBA 5BONA 3SONA 1V8LA 2VNQA 3J7Ye 3GZ5A 2O5WA 2W4EA 5FSOA 1X84A 5FSMA 3GZ6A 3FSPA 2G74A 1VHZA 3SMDA 1V8UA 3EF5A 5IW4A 3GZ8A 1VK6A 3GRNA 5DEQA 1SOIA 1MUTA 5GHPA 1V8YA 2A8SA 3L85A 5DPKA 1RYAA 1VIUA 3AC9A 3EXQA 3E57A 3FJYA 4HVYA 3A6SA 2DUKA 2I8UA 3F6AA 2A8QA 4MPOA 3RH7A 3FK9A 3X0JA 5GHMA 3O61A 3I9XA 5DDGA 5C7TA 5IW5A 3CNGA 4ZG0A 4NFXA 5FSLA 3X0NA 1MK1A 3ZR0A 3A6UA 3SHDA 1I9AA 3X0MA 3X0IA 3Q4IA 2DSBA 2QKMB 5HZXA 4JZVA 1JKNA 5ANSA 2QJOA 5GHJA 3A6TA 3HYQA 4KYXA 1TUMA 2PNYA 4JZSA 3X0PA 4S2XA 5ANVA 4ILQA 1R67A 3MCFA 1V8NA 2DSDA 5C7QA 1IRYA 3N9UA 1F3YA 2A8TA 3DUPA 1NFZA 1KT9A 1V8RA 1Q54A 3Q1PA 1PPVA 1V8WA 4K6EA 3F13A 5FSKA 2B2KA 2JVBA 1HZTA 3H95A 1PUSA 1VHGA 1XSBA 1MQEA 3Q91A 2DSCA
chains in the Genus database with same CATH superfamily
3MDIA 2YYHA 2ICJA 4YPRA 1K2EA 3GWYA 1VRLA 3OGAA 1MR2A 2B0VA 5ANUA 1OW2A 2CL3A 1G9QA 3COUA 2FVVA 2B06A 5C8LA 2YVPA 4N1UA 3FCMA 3I7UA 3X0QA 2O5FA 4S2YA 1XSAA 3EESA 4S2VA 3X0OA 2R5WA 4KG4A 3HHJA 1U20A 4DYWA 1VC9A 1V8VA 2GT4A 3ZR1A 1NQZA 1GA7A 3I7VA 3BHOA 4JZTA 4N1TA 3WHWA 5ANWA 2O1CA 3O6ZA 4KG3A 5I8UA 5BS6A 3QSJA 1PVFA 1V8MA 5CFJA 2FKBA 3Q2TA 1PPXA 2AZWA 3P5TA 2J8QA 2YVMA 3Q93A 3R03A 3U53A 1HX3A 3O52A 5GHIA 4NFWA 4C9XA 1X51A 1QVJA 1V8IA 3GG6A 2GT2A 1SU2A 3ID9A 3X0RA 4J7HA 5GHOA 3X0KA 3A6VA 2KDWA 3X0LA 4S2WA 1Q27A 1MQWA 5ISYA 3G0QA 5DD4A 3P6YA 1X83A 5CFIA 2YVNA 3O8SA 2A6TA 3BM4A 1VIQA 3EEUA 5FSIA 2YVOA 1VC8A 1JRKA 5LPGA 1PUNA 3O69A 4ICKA 1G0SA 2A8PA 1XSCA 2KDVA 1NQYA 2FMLA 2GB5A 2Q9PA 3DKUA 1MP2A 2XSQA 1KHZA 1NFSA 2ICKA 2PQVA 3ACAA 4IJXA 3X0SA 2CZRA 4YPHA 2A8RA 1Q33A 2I6KA 3KVHA 1RRQA 3MGMA 5ANTA 4HFQA 1PUQA 1KTGA 1V8SA 1K26A 2G73A 5FSNA 2VNPA 5GHNA 1V8TA 4JZUA 2I8TA 2QJTA 3FFUA 2RRKA 5GHQA 3N77A 1PPWA 1VCDA 3BAPA 4YOQA 3MDGA 1SZ3A 2DHOA 4V14A 1RRSA 1SJYA 4C9WA 3Q2SA 4KTBA 5BONA 3SONA 1V8LA 2VNQA 3J7Ye 3GZ5A 2O5WA 2W4EA 5FSOA 1X84A 5FSMA 3GZ6A 3FSPA 2G74A 1VHZA 3SMDA 1V8UA 3EF5A 5IW4A 3GZ8A 1VK6A 3GRNA 5DEQA 1SOIA 1MUTA 5GHPA 1V8YA 2A8SA 3L85A 5DPKA 1RYAA 1VIUA 4J7GA 3AC9A 3EXQA 3E57A 3FJYA 4HVYA 3A6SA 2DUKA 2I8UA 3F6AA 2A8QA 4MPOA 3RH7A 3FK9A 3X0JA 5GHMA 3O61A 3I9XA 5DDGA 5C7TA 5IW5A 3CNGA 4ZG0A 4NFXA 5FSLA 3X0NA 1MK1A 3ZR0A 3A6UA 3SHDA 1I9AA 3X0MA 3X0IA 3Q4IA 2DSBA 2QKMB 5HZXA 4JZVA 1JKNA 5ANSA 2QJOA 5GHJA 3A6TA 3HYQA 4KYXA 1TUMA 2PNYA 4JZSA 3X0PA 4S2XA 5ANVA 4ILQA 1R67A 3MCFA 1V8NA 2DSDA 5C7QA 1IRYA 3N9UA 1F3YA 2A8TA 3DUPA 1NFZA 1KT9A 1V8RA 1Q54A 3Q1PA 1PPVA 1V8WA 4K6EA 3F13A 5FSKA 2B2KA 2JVBA 1HZTA 3H95A 1PUSA 1VHGA 1XSBA 1MQEA 3Q91A 2DSCA
chains in the Genus database with same CATH topology
3MDIA 2YYHA 2ICJA 4YPRA 1K2EA 3GWYA 1VRLA 3OGAA 1MR2A 2B0VA 5ANUA 1OW2A 2CL3A 1G9QA 3COUA 2FVVA 2B06A 5C8LA 2YVPA 4N1UA 3FCMA 3I7UA 3X0QA 2O5FA 4S2YA 1XSAA 3EESA 4S2VA 3X0OA 2R5WA 4KG4A 3HHJA 1U20A 4DYWA 1VC9A 1V8VA 2GT4A 3ZR1A 1NQZA 1GA7A 3I7VA 3BHOA 4JZTA 4N1TA 3WHWA 5ANWA 2O1CA 3O6ZA 4KG3A 5I8UA 5BS6A 3QSJA 1PVFA 1V8MA 5CFJA 2FKBA 3Q2TA 1PPXA 2AZWA 3P5TA 2J8QA 2YVMA 3Q93A 3R03A 3U53A 1HX3A 3O52A 5GHIA 4NFWA 4C9XA 1X51A 1QVJA 1V8IA 3GG6A 2GT2A 1SU2A 3ID9A 3X0RA 4J7HA 5GHOA 3X0KA 3A6VA 2KDWA 3X0LA 4S2WA 1Q27A 1MQWA 5ISYA 3G0QA 5DD4A 3P6YA 1X83A 5CFIA 2YVNA 3O8SA 2A6TA 3BM4A 1VIQA 3EEUA 5FSIA 2YVOA 1VC8A 1JRKA 5LPGA 1PUNA 3O69A 4ICKA 1G0SA 2A8PA 1XSCA 2KDVA 1NQYA 2FMLA 2GB5A 2Q9PA 3DKUA 1MP2A 2XSQA 1KHZA 1NFSA 2ICKA 2PQVA 3ACAA 4IJXA 3X0SA 2CZRA 4YPHA 2A8RA 1Q33A 2I6KA 3KVHA 1RRQA 3MGMA 5ANTA 4HFQA 1PUQA 1KTGA 1V8SA 1K26A 2G73A 5FSNA 2VNPA 5GHNA 1V8TA 4JZUA 2I8TA 2QJTA 3FFUA 2RRKA 5GHQA 3N77A 1PPWA 1VCDA 3BAPA 4YOQA 3MDGA 1SZ3A 2DHOA 4V14A 1RRSA 1SJYA 4C9WA 3Q2SA 4KTBA 5BONA 3SONA 1V8LA 2VNQA 3J7Ye 3GZ5A 2O5WA 2W4EA 5FSOA 1X84A 5FSMA 3GZ6A 3FSPA 2G74A 1VHZA 3SMDA 1V8UA 3EF5A 5IW4A 3GZ8A 1VK6A 3GRNA 5DEQA 1SOIA 1MUTA 5GHPA 1V8YA 2A8SA 3L85A 5DPKA 1RYAA 1VIUA 4J7GA 3AC9A 3EXQA 3E57A 3FJYA 4HVYA 3A6SA 2DUKA 2I8UA 3F6AA 2A8QA 4MPOA 3RH7A 3FK9A 3X0JA 5GHMA 3O61A 3I9XA 5DDGA 5C7TA 5IW5A 3CNGA 4ZG0A 4NFXA 5FSLA 3X0NA 1MK1A 3ZR0A 3A6UA 3SHDA 1I9AA 3X0MA 3X0IA 3Q4IA 2DSBA 2QKMB 5HZXA 4JZVA 1JKNA 5ANSA 2QJOA 5GHJA 3A6TA 3HYQA 4KYXA 1TUMA 2PNYA 4JZSA 3X0PA 4S2XA 5ANVA 4ILQA 1R67A 3MCFA 1V8NA 2DSDA 5C7QA 1IRYA 3N9UA 1F3YA 2A8TA 3DUPA 1NFZA 1KT9A 1V8RA 1Q54A 3Q1PA 1PPVA 1V8WA 4K6EA 3F13A 5FSKA 2B2KA 2JVBA 1HZTA 3H95A 1PUSA 1VHGA 1XSBA 1MQEA 3Q91A 2DSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDI A;  2YYH A;  2ICJ A;  4YPR A;  1K2E A;  3GWY A;  1VRL A;  3OGA A;  1MR2 A;  2B0V A;  5ANU A;  1OW2 A;  2CL3 A;  1G9Q A;  3COU A;  2FVV A;  2B06 A;  5C8L A;  2YVP A;  4N1U A;  3FCM A;  3I7U A;  3X0Q A;  2O5F A;  4S2Y A;  1XSA A;  3EES A;  4S2V A;  3X0O A;  2R5W A;  4KG4 A;  3HHJ A;  1U20 A;  4DYW A;  1VC9 A;  1V8V A;  2GT4 A;  3ZR1 A;  1NQZ A;  1GA7 A;  3I7V A;  3BHO A;  4JZT A;  4N1T A;  3WHW A;  5ANW A;  2O1C A;  3O6Z A;  4KG3 A;  5I8U A;  5BS6 A;  3QSJ A;  1PVF A;  1V8M A;  5CFJ A;  2FKB A;  3Q2T A;  1PPX A;  2AZW A;  3P5T A;  2J8Q A;  2YVM A;  3Q93 A;  3R03 A;  3U53 A;  1HX3 A;  3O52 A;  5GHI A;  4NFW A;  4C9X A;  1X51 A;  1QVJ A;  1V8I A;  3GG6 A;  2GT2 A;  1SU2 A;  3ID9 A;  3X0R A;  3X0K A;  5GHO A;  3A6V A;  2KDW A;  3X0L A;  4S2W A;  1Q27 A;  1MQW A;  5ISY A;  3G0Q A;  5DD4 A;  3P6Y A;  1X83 A;  5CFI A;  2YVN A;  3O8S A;  2A6T A;  3BM4 A;  1VIQ A;  3EEU A;  5FSI A;  2YVO A;  1VC8 A;  1JRK A;  5LPG A;  1PUN A;  3O69 A;  4ICK A;  1G0S A;  2A8P A;  1XSC A;  2KDV A;  1NQY A;  2FML A;  2GB5 A;  2Q9P A;  3DKU A;  1MP2 A;  2XSQ A;  1KHZ A;  1NFS A;  2ICK A;  2PQV A;  3ACA A;  4IJX A;  3X0S A;  4YPH A;  2A8R A;  1Q33 A;  2I6K A;  3KVH A;  1RRQ A;  3MGM A;  5ANT A;  4HFQ A;  1PUQ A;  1KTG A;  1V8S A;  1K26 A;  2G73 A;  5FSN A;  2VNP A;  5GHN A;  1V8T A;  4JZU A;  2I8T A;  2QJT A;  3FFU A;  2RRK A;  5GHQ A;  3N77 A;  1PPW A;  1VCD A;  3BAP A;  4YOQ A;  3MDG A;  1SZ3 A;  2DHO A;  4V14 A;  1RRS A;  1SJY A;  4C9W A;  3Q2S A;  4KTB A;  5BON A;  3SON A;  1V8L A;  2VNQ A;  3J7Y e;  3GZ5 A;  2O5W A;  2W4E A;  5FSO A;  1X84 A;  5FSM A;  3GZ6 A;  3FSP A;  2G74 A;  1VHZ A;  3SMD A;  1V8U A;  3EF5 A;  5IW4 A;  3GZ8 A;  1VK6 A;  3GRN A;  5DEQ A;  1SOI A;  1MUT A;  5GHP A;  1V8Y A;  2A8S A;  3L85 A;  5DPK A;  1RYA A;  1VIU A;  3AC9 A;  3EXQ A;  3E57 A;  3FJY A;  4HVY A;  3A6S A;  2DUK A;  2I8U A;  3F6A A;  2A8Q A;  4MPO A;  3RH7 A;  3FK9 A;  3X0J A;  5GHM A;  3O61 A;  3I9X A;  5DDG A;  5C7T A;  5IW5 A;  3CNG A;  4ZG0 A;  4NFX A;  5FSL A;  3X0N A;  1MK1 A;  3ZR0 A;  3A6U A;  3SHD A;  1I9A A;  3X0M A;  3X0I A;  3Q4I A;  2DSB A;  2QKM B;  5HZX A;  4JZV A;  1JKN A;  5ANS A;  2QJO A;  5GHJ A;  3A6T A;  3HYQ A;  4KYX A;  1TUM A;  2PNY A;  4JZS A;  3X0P A;  4S2X A;  5ANV A;  4ILQ A;  1R67 A;  3MCF A;  1V8N A;  2DSD A;  5C7Q A;  1IRY A;  3N9U A;  1F3Y A;  2A8T A;  3DUP A;  1NFZ A;  1KT9 A;  1V8R A;  1Q54 A;  3Q1P A;  1PPV A;  1V8W A;  4K6E A;  3F13 A;  5FSK A;  2B2K A;  2JVB A;  1HZT A;  3H95 A;  1PUS A;  1VHG A;  1XSB A;  1MQE A;  3Q91 A;  2DSC A; 
#chains in the Genus database with same CATH topology
 3MDI A;  2YYH A;  2ICJ A;  4YPR A;  1K2E A;  3GWY A;  1VRL A;  3OGA A;  1MR2 A;  2B0V A;  5ANU A;  1OW2 A;  2CL3 A;  1G9Q A;  3COU A;  2FVV A;  2B06 A;  5C8L A;  2YVP A;  4N1U A;  3FCM A;  3I7U A;  3X0Q A;  2O5F A;  4S2Y A;  1XSA A;  3EES A;  4S2V A;  3X0O A;  2R5W A;  4KG4 A;  3HHJ A;  1U20 A;  4DYW A;  1VC9 A;  1V8V A;  2GT4 A;  3ZR1 A;  1NQZ A;  1GA7 A;  3I7V A;  3BHO A;  4JZT A;  4N1T A;  3WHW A;  5ANW A;  2O1C A;  3O6Z A;  4KG3 A;  5I8U A;  5BS6 A;  3QSJ A;  1PVF A;  1V8M A;  5CFJ A;  2FKB A;  3Q2T A;  1PPX A;  2AZW A;  3P5T A;  2J8Q A;  2YVM A;  3Q93 A;  3R03 A;  3U53 A;  1HX3 A;  3O52 A;  5GHI A;  4NFW A;  4C9X A;  1X51 A;  1QVJ A;  1V8I A;  3GG6 A;  2GT2 A;  1SU2 A;  3ID9 A;  3X0R A;  4J7H A;  5GHO A;  3X0K A;  3A6V A;  2KDW A;  3X0L A;  4S2W A;  1Q27 A;  1MQW A;  5ISY A;  3G0Q A;  5DD4 A;  3P6Y A;  1X83 A;  5CFI A;  2YVN A;  3O8S A;  2A6T A;  3BM4 A;  1VIQ A;  3EEU A;  5FSI A;  2YVO A;  1VC8 A;  1JRK A;  5LPG A;  1PUN A;  3O69 A;  4ICK A;  1G0S A;  2A8P A;  1XSC A;  2KDV A;  1NQY A;  2FML A;  2GB5 A;  2Q9P A;  3DKU A;  1MP2 A;  2XSQ A;  1KHZ A;  1NFS A;  2ICK A;  2PQV A;  3ACA A;  4IJX A;  3X0S A;  2CZR A;  4YPH A;  2A8R A;  1Q33 A;  2I6K A;  3KVH A;  1RRQ A;  3MGM A;  5ANT A;  4HFQ A;  1PUQ A;  1KTG A;  1V8S A;  1K26 A;  2G73 A;  5FSN A;  2VNP A;  5GHN A;  1V8T A;  4JZU A;  2I8T A;  2QJT A;  3FFU A;  2RRK A;  5GHQ A;  3N77 A;  1PPW A;  1VCD A;  3BAP A;  4YOQ A;  3MDG A;  1SZ3 A;  2DHO A;  4V14 A;  1RRS A;  1SJY A;  4C9W A;  3Q2S A;  4KTB A;  5BON A;  3SON A;  1V8L A;  2VNQ A;  3J7Y e;  3GZ5 A;  2O5W A;  2W4E A;  5FSO A;  1X84 A;  5FSM A;  3GZ6 A;  3FSP A;  2G74 A;  1VHZ A;  3SMD A;  1V8U A;  3EF5 A;  5IW4 A;  3GZ8 A;  1VK6 A;  3GRN A;  5DEQ A;  1SOI A;  1MUT A;  5GHP A;  1V8Y A;  2A8S A;  3L85 A;  5DPK A;  1RYA A;  1VIU A;  4J7G A;  3AC9 A;  3EXQ A;  3E57 A;  3FJY A;  4HVY A;  3A6S A;  2DUK A;  2I8U A;  3F6A A;  2A8Q A;  4MPO A;  3RH7 A;  3FK9 A;  3X0J A;  5GHM A;  3O61 A;  3I9X A;  5DDG A;  5C7T A;  5IW5 A;  3CNG A;  4ZG0 A;  4NFX A;  5FSL A;  3X0N A;  1MK1 A;  3ZR0 A;  3A6U A;  3SHD A;  1I9A A;  3X0M A;  3X0I A;  3Q4I A;  2DSB A;  2QKM B;  5HZX A;  4JZV A;  1JKN A;  5ANS A;  2QJO A;  5GHJ A;  3A6T A;  3HYQ A;  4KYX A;  1TUM A;  2PNY A;  4JZS A;  3X0P A;  4S2X A;  5ANV A;  4ILQ A;  1R67 A;  3MCF A;  1V8N A;  2DSD A;  5C7Q A;  1IRY A;  3N9U A;  1F3Y A;  2A8T A;  3DUP A;  1NFZ A;  1KT9 A;  1V8R A;  1Q54 A;  3Q1P A;  1PPV A;  1V8W A;  4K6E A;  3F13 A;  5FSK A;  2B2K A;  2JVB A;  1HZT A;  3H95 A;  1PUS A;  1VHG A;  1XSB A;  1MQE A;  3Q91 A;  2DSC A; 
#chains in the Genus database with same CATH homology
 3MDI A;  2YYH A;  2ICJ A;  4YPR A;  1K2E A;  3GWY A;  1VRL A;  3OGA A;  1MR2 A;  2B0V A;  5ANU A;  1OW2 A;  2CL3 A;  1G9Q A;  3COU A;  2FVV A;  2B06 A;  5C8L A;  2YVP A;  4N1U A;  3FCM A;  3I7U A;  3X0Q A;  2O5F A;  4S2Y A;  1XSA A;  3EES A;  4S2V A;  3X0O A;  2R5W A;  4KG4 A;  3HHJ A;  1U20 A;  4DYW A;  1VC9 A;  1V8V A;  2GT4 A;  3ZR1 A;  1NQZ A;  1GA7 A;  3I7V A;  3BHO A;  4JZT A;  4N1T A;  3WHW A;  5ANW A;  2O1C A;  3O6Z A;  4KG3 A;  5I8U A;  5BS6 A;  3QSJ A;  1PVF A;  1V8M A;  5CFJ A;  2FKB A;  3Q2T A;  1PPX A;  2AZW A;  3P5T A;  2J8Q A;  2YVM A;  3Q93 A;  3R03 A;  3U53 A;  1HX3 A;  3O52 A;  5GHI A;  4NFW A;  4C9X A;  1X51 A;  1QVJ A;  1V8I A;  3GG6 A;  2GT2 A;  1SU2 A;  3ID9 A;  3X0R A;  4J7H A;  5GHO A;  3X0K A;  3A6V A;  2KDW A;  3X0L A;  4S2W A;  1Q27 A;  1MQW A;  5ISY A;  3G0Q A;  5DD4 A;  3P6Y A;  1X83 A;  5CFI A;  2YVN A;  3O8S A;  2A6T A;  3BM4 A;  1VIQ A;  3EEU A;  5FSI A;  2YVO A;  1VC8 A;  1JRK A;  5LPG A;  1PUN A;  3O69 A;  4ICK A;  1G0S A;  2A8P A;  1XSC A;  2KDV A;  1NQY A;  2FML A;  2GB5 A;  2Q9P A;  3DKU A;  1MP2 A;  2XSQ A;  1KHZ A;  1NFS A;  2ICK A;  2PQV A;  3ACA A;  4IJX A;  3X0S A;  2CZR A;  4YPH A;  2A8R A;  1Q33 A;  2I6K A;  3KVH A;  1RRQ A;  3MGM A;  5ANT A;  4HFQ A;  1PUQ A;  1KTG A;  1V8S A;  1K26 A;  2G73 A;  5FSN A;  2VNP A;  5GHN A;  1V8T A;  4JZU A;  2I8T A;  2QJT A;  3FFU A;  2RRK A;  5GHQ A;  3N77 A;  1PPW A;  1VCD A;  3BAP A;  4YOQ A;  3MDG A;  1SZ3 A;  2DHO A;  4V14 A;  1RRS A;  1SJY A;  4C9W A;  3Q2S A;  4KTB A;  5BON A;  3SON A;  1V8L A;  2VNQ A;  3J7Y e;  3GZ5 A;  2O5W A;  2W4E A;  5FSO A;  1X84 A;  5FSM A;  3GZ6 A;  3FSP A;  2G74 A;  1VHZ A;  3SMD A;  1V8U A;  3EF5 A;  5IW4 A;  3GZ8 A;  1VK6 A;  3GRN A;  5DEQ A;  1SOI A;  1MUT A;  5GHP A;  1V8Y A;  2A8S A;  3L85 A;  5DPK A;  1RYA A;  1VIU A;  4J7G A;  3AC9 A;  3EXQ A;  3E57 A;  3FJY A;  4HVY A;  3A6S A;  2DUK A;  2I8U A;  3F6A A;  2A8Q A;  4MPO A;  3RH7 A;  3FK9 A;  3X0J A;  5GHM A;  3O61 A;  3I9X A;  5DDG A;  5C7T A;  5IW5 A;  3CNG A;  4ZG0 A;  4NFX A;  5FSL A;  3X0N A;  1MK1 A;  3ZR0 A;  3A6U A;  3SHD A;  1I9A A;  3X0M A;  3X0I A;  3Q4I A;  2DSB A;  2QKM B;  5HZX A;  4JZV A;  1JKN A;  5ANS A;  2QJO A;  5GHJ A;  3A6T A;  3HYQ A;  4KYX A;  1TUM A;  2PNY A;  4JZS A;  3X0P A;  4S2X A;  5ANV A;  4ILQ A;  1R67 A;  3MCF A;  1V8N A;  2DSD A;  5C7Q A;  1IRY A;  3N9U A;  1F3Y A;  2A8T A;  3DUP A;  1NFZ A;  1KT9 A;  1V8R A;  1Q54 A;  3Q1P A;  1PPV A;  1V8W A;  4K6E A;  3F13 A;  5FSK A;  2B2K A;  2JVB A;  1HZT A;  3H95 A;  1PUS A;  1VHG A;  1XSB A;  1MQE A;  3Q91 A;  2DSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...