1JKNA

Solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius complexed with atp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
165
structure length
165
Chain Sequence
GPLGSMDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFLFKFTGQDQEINLLGDGSEKPEFGEWSWVTPEQLIDLTVEFKKPVYKEVLSVFAPHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase
publication title The structure of Ap(4)A hydrolase complexed with ATP-MgF(x) reveals the basis of substrate binding.
pubmed doi rcsb
source organism Lupinus angustifolius
molecule tags Hydrolase
total genus 27
structure length 165
sequence length 165
ec nomenclature ec 3.6.1.17: Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1jknA00
5ANUA 2DSBA 5CFJA 3A6VA 4JZUA 2GT4A 4KG4A 3OGAA 1NFSA 3GG6A 1V8YA 1SZ3A 5FSMA 1V8RA 3SMDA 2FKBA 5DDGA 3G0QA 3N9UA 1V8VA 1RRQA 3HHJA 2XSQA 3O52A 2YVNA 2I8TA 4NFXA 5GHIA 3E57A 3X0QA 2O5FA 2A8PA 1VC9A 3P6YA 3H95A 3SHDA 3DKUA 5C7TA 3J7Ye 2QJTA 1V8MA 1Q54A 4YPRA 1X51A 2PNYA 1PUSA 1U20A 1SU2A 3O8SA 4JZTA 5GHPA 1MP2A 1K26A 3QSJA 5GHOA 1VCDA 2DUKA 4HFQA 2I6KA 3I9XA 1V8UA 3GRNA 1V8SA 5ANVA 3ZR1A 2FMLA 2PQVA 3ID9A 1PUQA 3MCFA 1MQWA 4V14A 1X84A 5GHMA 3ZR0A 1QVJA 1K2EA 5ANWA 3GZ8A 2O5WA 3X0IA 3CNGA 3COUA 2GT2A 3FJYA 3X0SA 4KG3A 3X0MA 1JRKA 2QKMB 2KDVA 2B06A 3FFUA 3KVHA 4JZVA 4C9XA 4N1UA 2DSDA 3X0KA 1V8NA 4YOQA 3Q1PA 1G0SA 2YVMA 1VIUA 3EXQA 4KYXA 5C7QA 3ACAA 1KT9A 1XSCA 1VIQA 2A8TA 2DHOA 1SOIA 5GHNA 3GWYA 3FK9A 5HZXA 2QJOA 2CL3A 3X0JA 2VNPA 3F6AA 3Q4IA 3X0RA 4JZSA 5IW4A 2RRKA 5FSKA 1TUMA 1V8IA 2O1CA 4HVYA 4KTBA 1PUNA 1G9QA 1PPXA 3BAPA 1IRYA 5FSNA 5IW5A 1PVFA 4K6EA 5DPKA 2YYHA 1Q27A 2I8UA 5I8UA 4DYWA 1OW2A 2AZWA 4N1TA 1R67A 4NFWA 4ICKA 3F13A 5DD4A 1MQEA 2ICKA 3P5TA 3WHWA 2B0VA 3GZ6A 1VK6A 2A8QA 1MUTA 2JVBA 1PPVA 1V8LA 3I7UA 3X0OA 4S2YA 3Q2TA 1KTGA 3O61A 1RYAA 3EEUA 1GA7A 3BHOA 3HYQA 3O6ZA 3MGMA 3O69A 3I7VA 3AC9A 4S2VA 2A8SA 2VNQA 1MR2A 1NFZA 3FCMA 5C8LA 2R5WA 1V8TA 3U53A 2G73A 4IJXA 5DEQA 4YPHA 5GHJA 3RH7A 1XSBA 3EESA 5BS6A 3FSPA 5ISYA 2FVVA 3X0PA 1KHZA 5FSOA 2YVPA 2YVOA 5LPGA 3EF5A 5ANSA 1SJYA 2A6TA 2W4EA 1JKNA 3X0LA 1NQYA 3DUPA 3X0NA 1HX3A 1XSAA 4S2WA 5FSLA 3L85A 4ILQA 2DSCA 1VRLA 1I9AA 1VHGA 5FSIA 3SONA 1X83A 2GB5A 3Q91A 1V8WA 5CFIA 3A6UA 4S2XA 3A6SA 3MDIA 3A6TA 3BM4A 2J8QA 4MPOA 4C9WA 2B2KA 1VHZA 5GHQA 2A8RA 3MDGA 1Q33A 2G74A 1NQZA 5ANTA 1F3YA 3R03A 2ICJA 3Q93A 4ZG0A 3Q2SA 2Q9PA 3GZ5A 3N77A 1RRSA 1VC8A 1MK1A 5BONA 1PPWA 1HZTA 2KDWA
chains in the Genus database with same CATH superfamily
5ANUA 2DSBA 5CFJA 3A6VA 4JZUA 2GT4A 4KG4A 3OGAA 1NFSA 3GG6A 1V8YA 1SZ3A 5FSMA 1V8RA 3SMDA 2FKBA 5DDGA 3G0QA 3N9UA 1V8VA 1RRQA 3HHJA 2XSQA 3O52A 2YVNA 2I8TA 4NFXA 5GHIA 3E57A 3X0QA 2O5FA 2A8PA 1VC9A 3P6YA 3H95A 3SHDA 3DKUA 5C7TA 3J7Ye 2QJTA 1V8MA 1Q54A 4YPRA 1X51A 2PNYA 1PUSA 1U20A 1SU2A 3O8SA 4JZTA 5GHPA 1MP2A 1K26A 3QSJA 5GHOA 1VCDA 2DUKA 4HFQA 2I6KA 3I9XA 1V8UA 3GRNA 1V8SA 5ANVA 3ZR1A 2FMLA 2PQVA 3ID9A 1PUQA 3MCFA 1MQWA 4V14A 4J7HA 1X84A 5GHMA 3ZR0A 1QVJA 1K2EA 5ANWA 3GZ8A 2O5WA 3X0IA 3CNGA 3COUA 2GT2A 3FJYA 3X0SA 4KG3A 3X0MA 1JRKA 2QKMB 2KDVA 2B06A 3FFUA 3KVHA 4JZVA 4C9XA 4N1UA 2DSDA 3X0KA 4J7GA 1V8NA 4YOQA 3Q1PA 1G0SA 2YVMA 1VIUA 3EXQA 4KYXA 5C7QA 3ACAA 1KT9A 1XSCA 1VIQA 2A8TA 2DHOA 1SOIA 5GHNA 3GWYA 3FK9A 5HZXA 2QJOA 2CL3A 3X0JA 2VNPA 3F6AA 3Q4IA 3X0RA 4JZSA 5IW4A 2RRKA 5FSKA 1TUMA 1V8IA 2O1CA 4HVYA 4KTBA 1PUNA 1G9QA 1PPXA 2CZRA 3BAPA 1IRYA 5FSNA 5IW5A 1PVFA 4K6EA 5DPKA 2YYHA 1Q27A 2I8UA 5I8UA 4DYWA 1OW2A 2AZWA 4N1TA 1R67A 4NFWA 4ICKA 3F13A 5DD4A 1MQEA 2ICKA 3P5TA 3WHWA 2B0VA 3GZ6A 1VK6A 2A8QA 1MUTA 2JVBA 1PPVA 1V8LA 3I7UA 3X0OA 4S2YA 3Q2TA 1KTGA 3O61A 1RYAA 3EEUA 1GA7A 3BHOA 3HYQA 3O6ZA 3MGMA 3O69A 3I7VA 3AC9A 4S2VA 2A8SA 2VNQA 1MR2A 1NFZA 3FCMA 5C8LA 2R5WA 1V8TA 3U53A 2G73A 4IJXA 5DEQA 4YPHA 5GHJA 3RH7A 1XSBA 3EESA 5BS6A 3FSPA 5ISYA 2FVVA 3X0PA 1KHZA 5FSOA 2YVPA 2YVOA 5LPGA 3EF5A 5ANSA 1SJYA 2A6TA 2W4EA 1JKNA 3X0LA 1NQYA 3DUPA 3X0NA 1HX3A 1XSAA 4S2WA 5FSLA 3L85A 4ILQA 2DSCA 1VRLA 1I9AA 1VHGA 5FSIA 3SONA 1X83A 2GB5A 3Q91A 1V8WA 5CFIA 3A6UA 4S2XA 3A6SA 3MDIA 3A6TA 3BM4A 2J8QA 4MPOA 4C9WA 2B2KA 1VHZA 5GHQA 2A8RA 3MDGA 1Q33A 2G74A 1NQZA 5ANTA 1F3YA 3R03A 2ICJA 3Q93A 4ZG0A 3Q2SA 2Q9PA 3GZ5A 3N77A 1RRSA 1VC8A 1MK1A 5BONA 1PPWA 1HZTA 2KDWA
chains in the Genus database with same CATH topology
5ANUA 2DSBA 5CFJA 3A6VA 4JZUA 2GT4A 4KG4A 3OGAA 1NFSA 3GG6A 1V8YA 1SZ3A 5FSMA 1V8RA 3SMDA 2FKBA 5DDGA 3G0QA 3N9UA 1V8VA 1RRQA 3HHJA 2XSQA 3O52A 2YVNA 2I8TA 4NFXA 5GHIA 3E57A 3X0QA 2O5FA 2A8PA 1VC9A 3P6YA 3H95A 3SHDA 3DKUA 5C7TA 3J7Ye 2QJTA 1V8MA 1Q54A 4YPRA 1X51A 2PNYA 1PUSA 1U20A 1SU2A 3O8SA 4JZTA 5GHPA 1MP2A 1K26A 3QSJA 5GHOA 1VCDA 2DUKA 4HFQA 2I6KA 3I9XA 1V8UA 3GRNA 1V8SA 5ANVA 3ZR1A 2FMLA 2PQVA 3ID9A 1PUQA 3MCFA 1MQWA 4V14A 4J7HA 1X84A 5GHMA 3ZR0A 1QVJA 1K2EA 5ANWA 3GZ8A 2O5WA 3X0IA 3CNGA 3COUA 2GT2A 3FJYA 3X0SA 4KG3A 3X0MA 1JRKA 2QKMB 2KDVA 2B06A 3FFUA 3KVHA 4JZVA 4C9XA 4N1UA 2DSDA 3X0KA 4J7GA 1V8NA 4YOQA 3Q1PA 1G0SA 2YVMA 1VIUA 3EXQA 4KYXA 5C7QA 3ACAA 1KT9A 1XSCA 1VIQA 2A8TA 2DHOA 1SOIA 5GHNA 3GWYA 3FK9A 5HZXA 2QJOA 2CL3A 3X0JA 2VNPA 3F6AA 3Q4IA 3X0RA 4JZSA 5IW4A 2RRKA 5FSKA 1TUMA 1V8IA 2O1CA 4HVYA 4KTBA 1PUNA 1G9QA 1PPXA 2CZRA 3BAPA 1IRYA 5FSNA 5IW5A 1PVFA 4K6EA 5DPKA 2YYHA 1Q27A 2I8UA 5I8UA 4DYWA 1OW2A 2AZWA 4N1TA 1R67A 4NFWA 4ICKA 3F13A 5DD4A 1MQEA 2ICKA 3P5TA 3WHWA 2B0VA 3GZ6A 1VK6A 2A8QA 1MUTA 2JVBA 1PPVA 1V8LA 3I7UA 3X0OA 4S2YA 3Q2TA 1KTGA 3O61A 1RYAA 3EEUA 1GA7A 3BHOA 3HYQA 3O6ZA 3MGMA 3O69A 3I7VA 3AC9A 4S2VA 2A8SA 2VNQA 1MR2A 1NFZA 3FCMA 5C8LA 2R5WA 1V8TA 3U53A 2G73A 4IJXA 5DEQA 4YPHA 5GHJA 3RH7A 1XSBA 3EESA 5BS6A 3FSPA 5ISYA 2FVVA 3X0PA 1KHZA 5FSOA 2YVPA 2YVOA 5LPGA 3EF5A 5ANSA 1SJYA 2A6TA 2W4EA 1JKNA 3X0LA 1NQYA 3DUPA 3X0NA 1HX3A 1XSAA 4S2WA 5FSLA 3L85A 4ILQA 2DSCA 1VRLA 1I9AA 1VHGA 5FSIA 3SONA 1X83A 2GB5A 3Q91A 1V8WA 5CFIA 3A6UA 4S2XA 3A6SA 3MDIA 3A6TA 3BM4A 2J8QA 4MPOA 4C9WA 2B2KA 1VHZA 5GHQA 2A8RA 3MDGA 1Q33A 2G74A 1NQZA 5ANTA 1F3YA 3R03A 2ICJA 3Q93A 4ZG0A 3Q2SA 2Q9PA 3GZ5A 3N77A 1RRSA 1VC8A 1MK1A 5BONA 1PPWA 1HZTA 2KDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANU A;  2DSB A;  5CFJ A;  3A6V A;  4JZU A;  2GT4 A;  4KG4 A;  3OGA A;  1NFS A;  3GG6 A;  1V8Y A;  1SZ3 A;  5FSM A;  1V8R A;  3SMD A;  2FKB A;  5DDG A;  3G0Q A;  3N9U A;  1V8V A;  1RRQ A;  3HHJ A;  2XSQ A;  3O52 A;  2YVN A;  2I8T A;  4NFX A;  5GHI A;  3E57 A;  3X0Q A;  2O5F A;  2A8P A;  1VC9 A;  3P6Y A;  3H95 A;  3SHD A;  3DKU A;  5C7T A;  3J7Y e;  2QJT A;  1V8M A;  1Q54 A;  4YPR A;  1X51 A;  2PNY A;  1PUS A;  1U20 A;  1SU2 A;  3O8S A;  4JZT A;  5GHP A;  1MP2 A;  1K26 A;  3QSJ A;  5GHO A;  1VCD A;  2DUK A;  4HFQ A;  2I6K A;  3I9X A;  1V8U A;  3GRN A;  1V8S A;  5ANV A;  3ZR1 A;  2FML A;  2PQV A;  3ID9 A;  1PUQ A;  3MCF A;  1MQW A;  4V14 A;  1X84 A;  5GHM A;  3ZR0 A;  1QVJ A;  1K2E A;  5ANW A;  3GZ8 A;  2O5W A;  3X0I A;  3CNG A;  3COU A;  2GT2 A;  3FJY A;  3X0S A;  4KG3 A;  3X0M A;  1JRK A;  2QKM B;  2KDV A;  2B06 A;  3FFU A;  3KVH A;  4JZV A;  4C9X A;  4N1U A;  2DSD A;  3X0K A;  1V8N A;  4YOQ A;  3Q1P A;  1G0S A;  2YVM A;  1VIU A;  3EXQ A;  4KYX A;  5C7Q A;  3ACA A;  1KT9 A;  1XSC A;  1VIQ A;  2A8T A;  2DHO A;  1SOI A;  5GHN A;  3GWY A;  3FK9 A;  5HZX A;  2QJO A;  2CL3 A;  3X0J A;  2VNP A;  3F6A A;  3Q4I A;  3X0R A;  4JZS A;  5IW4 A;  2RRK A;  5FSK A;  1TUM A;  1V8I A;  2O1C A;  4HVY A;  4KTB A;  1PUN A;  1G9Q A;  1PPX A;  3BAP A;  1IRY A;  5FSN A;  5IW5 A;  1PVF A;  4K6E A;  5DPK A;  2YYH A;  1Q27 A;  2I8U A;  5I8U A;  4DYW A;  1OW2 A;  2AZW A;  4N1T A;  1R67 A;  4NFW A;  4ICK A;  3F13 A;  5DD4 A;  1MQE A;  2ICK A;  3P5T A;  3WHW A;  2B0V A;  3GZ6 A;  1VK6 A;  2A8Q A;  1MUT A;  2JVB A;  1PPV A;  1V8L A;  3I7U A;  3X0O A;  4S2Y A;  3Q2T A;  1KTG A;  3O61 A;  1RYA A;  3EEU A;  1GA7 A;  3BHO A;  3HYQ A;  3O6Z A;  3MGM A;  3O69 A;  3I7V A;  3AC9 A;  4S2V A;  2A8S A;  2VNQ A;  1MR2 A;  1NFZ A;  3FCM A;  5C8L A;  2R5W A;  1V8T A;  3U53 A;  2G73 A;  4IJX A;  5DEQ A;  4YPH A;  5GHJ A;  3RH7 A;  1XSB A;  3EES A;  5BS6 A;  3FSP A;  5ISY A;  2FVV A;  3X0P A;  1KHZ A;  5FSO A;  2YVP A;  2YVO A;  5LPG A;  3EF5 A;  5ANS A;  1SJY A;  2A6T A;  2W4E A;  1JKN A;  3X0L A;  1NQY A;  3DUP A;  3X0N A;  1HX3 A;  1XSA A;  4S2W A;  5FSL A;  3L85 A;  4ILQ A;  2DSC A;  1VRL A;  1I9A A;  1VHG A;  5FSI A;  3SON A;  1X83 A;  2GB5 A;  3Q91 A;  1V8W A;  5CFI A;  3A6U A;  4S2X A;  3A6S A;  3MDI A;  3A6T A;  3BM4 A;  2J8Q A;  4MPO A;  4C9W A;  2B2K A;  1VHZ A;  5GHQ A;  2A8R A;  3MDG A;  1Q33 A;  2G74 A;  1NQZ A;  5ANT A;  1F3Y A;  3R03 A;  2ICJ A;  3Q93 A;  4ZG0 A;  3Q2S A;  2Q9P A;  3GZ5 A;  3N77 A;  1RRS A;  1VC8 A;  1MK1 A;  5BON A;  1PPW A;  1HZT A;  2KDW A; 
#chains in the Genus database with same CATH topology
 5ANU A;  2DSB A;  5CFJ A;  3A6V A;  4JZU A;  2GT4 A;  4KG4 A;  3OGA A;  1NFS A;  3GG6 A;  1V8Y A;  1SZ3 A;  5FSM A;  1V8R A;  3SMD A;  2FKB A;  5DDG A;  3G0Q A;  3N9U A;  1V8V A;  1RRQ A;  3HHJ A;  2XSQ A;  3O52 A;  2YVN A;  2I8T A;  4NFX A;  5GHI A;  3E57 A;  3X0Q A;  2O5F A;  2A8P A;  1VC9 A;  3P6Y A;  3H95 A;  3SHD A;  3DKU A;  5C7T A;  3J7Y e;  2QJT A;  1V8M A;  1Q54 A;  4YPR A;  1X51 A;  2PNY A;  1PUS A;  1U20 A;  1SU2 A;  3O8S A;  4JZT A;  5GHP A;  1MP2 A;  1K26 A;  3QSJ A;  5GHO A;  1VCD A;  2DUK A;  4HFQ A;  2I6K A;  3I9X A;  1V8U A;  3GRN A;  1V8S A;  5ANV A;  3ZR1 A;  2FML A;  2PQV A;  3ID9 A;  1PUQ A;  3MCF A;  1MQW A;  4V14 A;  4J7H A;  1X84 A;  5GHM A;  3ZR0 A;  1QVJ A;  1K2E A;  5ANW A;  3GZ8 A;  2O5W A;  3X0I A;  3CNG A;  3COU A;  2GT2 A;  3FJY A;  3X0S A;  4KG3 A;  3X0M A;  1JRK A;  2QKM B;  2KDV A;  2B06 A;  3FFU A;  3KVH A;  4JZV A;  4C9X A;  4N1U A;  2DSD A;  3X0K A;  4J7G A;  1V8N A;  4YOQ A;  3Q1P A;  1G0S A;  2YVM A;  1VIU A;  3EXQ A;  4KYX A;  5C7Q A;  3ACA A;  1KT9 A;  1XSC A;  1VIQ A;  2A8T A;  2DHO A;  1SOI A;  5GHN A;  3GWY A;  3FK9 A;  5HZX A;  2QJO A;  2CL3 A;  3X0J A;  2VNP A;  3F6A A;  3Q4I A;  3X0R A;  4JZS A;  5IW4 A;  2RRK A;  5FSK A;  1TUM A;  1V8I A;  2O1C A;  4HVY A;  4KTB A;  1PUN A;  1G9Q A;  1PPX A;  2CZR A;  3BAP A;  1IRY A;  5FSN A;  5IW5 A;  1PVF A;  4K6E A;  5DPK A;  2YYH A;  1Q27 A;  2I8U A;  5I8U A;  4DYW A;  1OW2 A;  2AZW A;  4N1T A;  1R67 A;  4NFW A;  4ICK A;  3F13 A;  5DD4 A;  1MQE A;  2ICK A;  3P5T A;  3WHW A;  2B0V A;  3GZ6 A;  1VK6 A;  2A8Q A;  1MUT A;  2JVB A;  1PPV A;  1V8L A;  3I7U A;  3X0O A;  4S2Y A;  3Q2T A;  1KTG A;  3O61 A;  1RYA A;  3EEU A;  1GA7 A;  3BHO A;  3HYQ A;  3O6Z A;  3MGM A;  3O69 A;  3I7V A;  3AC9 A;  4S2V A;  2A8S A;  2VNQ A;  1MR2 A;  1NFZ A;  3FCM A;  5C8L A;  2R5W A;  1V8T A;  3U53 A;  2G73 A;  4IJX A;  5DEQ A;  4YPH A;  5GHJ A;  3RH7 A;  1XSB A;  3EES A;  5BS6 A;  3FSP A;  5ISY A;  2FVV A;  3X0P A;  1KHZ A;  5FSO A;  2YVP A;  2YVO A;  5LPG A;  3EF5 A;  5ANS A;  1SJY A;  2A6T A;  2W4E A;  1JKN A;  3X0L A;  1NQY A;  3DUP A;  3X0N A;  1HX3 A;  1XSA A;  4S2W A;  5FSL A;  3L85 A;  4ILQ A;  2DSC A;  1VRL A;  1I9A A;  1VHG A;  5FSI A;  3SON A;  1X83 A;  2GB5 A;  3Q91 A;  1V8W A;  5CFI A;  3A6U A;  4S2X A;  3A6S A;  3MDI A;  3A6T A;  3BM4 A;  2J8Q A;  4MPO A;  4C9W A;  2B2K A;  1VHZ A;  5GHQ A;  2A8R A;  3MDG A;  1Q33 A;  2G74 A;  1NQZ A;  5ANT A;  1F3Y A;  3R03 A;  2ICJ A;  3Q93 A;  4ZG0 A;  3Q2S A;  2Q9P A;  3GZ5 A;  3N77 A;  1RRS A;  1VC8 A;  1MK1 A;  5BON A;  1PPW A;  1HZT A;  2KDW A; 
#chains in the Genus database with same CATH homology
 5ANU A;  2DSB A;  5CFJ A;  3A6V A;  4JZU A;  2GT4 A;  4KG4 A;  3OGA A;  1NFS A;  3GG6 A;  1V8Y A;  1SZ3 A;  5FSM A;  1V8R A;  3SMD A;  2FKB A;  5DDG A;  3G0Q A;  3N9U A;  1V8V A;  1RRQ A;  3HHJ A;  2XSQ A;  3O52 A;  2YVN A;  2I8T A;  4NFX A;  5GHI A;  3E57 A;  3X0Q A;  2O5F A;  2A8P A;  1VC9 A;  3P6Y A;  3H95 A;  3SHD A;  3DKU A;  5C7T A;  3J7Y e;  2QJT A;  1V8M A;  1Q54 A;  4YPR A;  1X51 A;  2PNY A;  1PUS A;  1U20 A;  1SU2 A;  3O8S A;  4JZT A;  5GHP A;  1MP2 A;  1K26 A;  3QSJ A;  5GHO A;  1VCD A;  2DUK A;  4HFQ A;  2I6K A;  3I9X A;  1V8U A;  3GRN A;  1V8S A;  5ANV A;  3ZR1 A;  2FML A;  2PQV A;  3ID9 A;  1PUQ A;  3MCF A;  1MQW A;  4V14 A;  4J7H A;  1X84 A;  5GHM A;  3ZR0 A;  1QVJ A;  1K2E A;  5ANW A;  3GZ8 A;  2O5W A;  3X0I A;  3CNG A;  3COU A;  2GT2 A;  3FJY A;  3X0S A;  4KG3 A;  3X0M A;  1JRK A;  2QKM B;  2KDV A;  2B06 A;  3FFU A;  3KVH A;  4JZV A;  4C9X A;  4N1U A;  2DSD A;  3X0K A;  4J7G A;  1V8N A;  4YOQ A;  3Q1P A;  1G0S A;  2YVM A;  1VIU A;  3EXQ A;  4KYX A;  5C7Q A;  3ACA A;  1KT9 A;  1XSC A;  1VIQ A;  2A8T A;  2DHO A;  1SOI A;  5GHN A;  3GWY A;  3FK9 A;  5HZX A;  2QJO A;  2CL3 A;  3X0J A;  2VNP A;  3F6A A;  3Q4I A;  3X0R A;  4JZS A;  5IW4 A;  2RRK A;  5FSK A;  1TUM A;  1V8I A;  2O1C A;  4HVY A;  4KTB A;  1PUN A;  1G9Q A;  1PPX A;  2CZR A;  3BAP A;  1IRY A;  5FSN A;  5IW5 A;  1PVF A;  4K6E A;  5DPK A;  2YYH A;  1Q27 A;  2I8U A;  5I8U A;  4DYW A;  1OW2 A;  2AZW A;  4N1T A;  1R67 A;  4NFW A;  4ICK A;  3F13 A;  5DD4 A;  1MQE A;  2ICK A;  3P5T A;  3WHW A;  2B0V A;  3GZ6 A;  1VK6 A;  2A8Q A;  1MUT A;  2JVB A;  1PPV A;  1V8L A;  3I7U A;  3X0O A;  4S2Y A;  3Q2T A;  1KTG A;  3O61 A;  1RYA A;  3EEU A;  1GA7 A;  3BHO A;  3HYQ A;  3O6Z A;  3MGM A;  3O69 A;  3I7V A;  3AC9 A;  4S2V A;  2A8S A;  2VNQ A;  1MR2 A;  1NFZ A;  3FCM A;  5C8L A;  2R5W A;  1V8T A;  3U53 A;  2G73 A;  4IJX A;  5DEQ A;  4YPH A;  5GHJ A;  3RH7 A;  1XSB A;  3EES A;  5BS6 A;  3FSP A;  5ISY A;  2FVV A;  3X0P A;  1KHZ A;  5FSO A;  2YVP A;  2YVO A;  5LPG A;  3EF5 A;  5ANS A;  1SJY A;  2A6T A;  2W4E A;  1JKN A;  3X0L A;  1NQY A;  3DUP A;  3X0N A;  1HX3 A;  1XSA A;  4S2W A;  5FSL A;  3L85 A;  4ILQ A;  2DSC A;  1VRL A;  1I9A A;  1VHG A;  5FSI A;  3SON A;  1X83 A;  2GB5 A;  3Q91 A;  1V8W A;  5CFI A;  3A6U A;  4S2X A;  3A6S A;  3MDI A;  3A6T A;  3BM4 A;  2J8Q A;  4MPO A;  4C9W A;  2B2K A;  1VHZ A;  5GHQ A;  2A8R A;  3MDG A;  1Q33 A;  2G74 A;  1NQZ A;  5ANT A;  1F3Y A;  3R03 A;  2ICJ A;  3Q93 A;  4ZG0 A;  3Q2S A;  2Q9P A;  3GZ5 A;  3N77 A;  1RRS A;  1VC8 A;  1MK1 A;  5BON A;  1PPW A;  1HZT A;  2KDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...