3MCFA

Crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
130
Chain Sequence
MKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 3-alpha
publication title Crystal structure of human diphosphoinositol polyphosphate phosphohydrolase 3-alpha
rcsb
source organism Homo sapiens
total genus 38
structure length 130
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.6.1.52: Diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3mcfA00
1V8VA 1Q54A 3O6ZA 4S2VA 1NQYA 3DUPA 5CFJA 5IW5A 4KTBA 2YVNA 1V8UA 1XSAA 2YVOA 3GG6A 3MCFA 1V8SA 1SU2A 2VNPA 3FCMA 3OGAA 4KG3A 1HZTA 2FKBA 4C9WA 3O52A 3F6AA 3RH7A 2G74A 4NFXA 1KHZA 2QKMB 1PUNA 1SJYA 1VCDA 3J7Ye 3EF5A 3Q91A 3Q2SA 5GHMA 4JZSA 2I6KA 2FMLA 1TUMA 3X0IA 5BS6A 3H95A 1PPWA 1V8NA 3FFUA 4V14A 5C7QA 2YVPA 5I8UA 2QJTA 3HHJA 5CFIA 2YYHA 3GZ8A 4IJXA 3GWYA 1VC8A 3BHOA 3I7VA 1X83A 2DUKA 2O1CA 2PQVA 3U53A 1Q27A 1R67A 4YPRA 2O5FA 2I8UA 1V8RA 5C7TA 3P6YA 1XSBA 2PNYA 1G9QA 1KTGA 1OW2A 2JVBA 5ISYA 1V8LA 2VNQA 5LPGA 1VIQA 1KT9A 5DDGA 1IRYA 2AZWA 4N1UA 2DSCA 4JZTA 3GZ6A 2A6TA 2A8QA 3AC9A 4S2XA 5FSKA 2Q9PA 3ACAA 1V8TA 3GZ5A 2DSDA 3A6UA 3EESA 3A6TA 4HFQA 5HZXA 1NFSA 1V8MA 2B06A 1MUTA 3A6VA 1V8WA 2A8RA 3SONA 1VC9A 2G73A 2CL3A 2GT2A 5ANSA 5GHIA 3X0RA 4S2YA 5IW4A 5DPKA 2RRKA 1JRKA 5GHQA 3G0QA 1X84A 5ANVA 3SMDA 1MQWA 2QJOA 3FK9A 2DHOA 1HX3A 1MK1A 3N9UA 3I9XA 3MGMA 5GHOA 3Q2TA 5C8LA 3KVHA 3X0QA 3Q93A 5GHJA 3DKUA 5ANWA 3A6SA 3O69A 1VHGA 2W4EA 1U20A 4JZVA 1NFZA 4K6EA 2DSBA 3O8SA 3FJYA 4S2WA 1NQZA 1RRSA 5ANUA 3O61A 3Q4IA 1I9AA 1Q33A 2ICKA 3MDGA 2B0VA 5FSIA 1RRQA 1MQEA 1G0SA 3QSJA 4MPOA 2YVMA 2O5WA 3HYQA 3FSPA 4ILQA 1F3YA 4C9XA 4YPHA 3EEUA 2XSQA 4YOQA 1JKNA 3X0MA 3CNGA 2GB5A 3R03A 1K2EA 5DD4A 1PUSA 3P5TA 3ZR1A 3L85A 4KG4A 4ICKA 4DYWA 2FVVA 3SHDA 1SOIA 3X0JA 5FSMA 3MDIA 3X0NA 3X0LA 3ID9A 1X51A 3BAPA 3X0PA 3EXQA 1MP2A 1MR2A 3X0KA 3GRNA 1PUQA 2KDWA 3I7UA 3Q1PA 4N1TA 1PPXA 3COUA 4NFWA 3X0OA 1PVFA 5FSNA 1SZ3A 5GHNA 1VIUA 3BM4A 2R5WA 3WHWA 3ZR0A 2I8TA 1VHZA 3X0SA 2KDVA 5FSOA 1GA7A 3F13A 2ICJA 3N77A 1VK6A 2A8SA 4JZUA 2J8QA 3E57A 2A8TA 1RYAA 2GT4A 4ZG0A 4HVYA 4KYXA 5DEQA 1PPVA 1QVJA 1K26A 1V8IA 2B2KA 5GHPA 1V8YA 5BONA 1XSCA 1VRLA 5ANTA 2A8PA 5FSLA
chains in the Genus database with same CATH superfamily
1V8VA 1Q54A 3O6ZA 4S2VA 1NQYA 3DUPA 5CFJA 5IW5A 4KTBA 2CZRA 2YVNA 1V8UA 1XSAA 2YVOA 3GG6A 3MCFA 1V8SA 1SU2A 2VNPA 3FCMA 3OGAA 4KG3A 1HZTA 2FKBA 4C9WA 3O52A 3F6AA 3RH7A 2G74A 4NFXA 1KHZA 2QKMB 1PUNA 1SJYA 1VCDA 3J7Ye 3EF5A 3Q91A 3Q2SA 5GHMA 4JZSA 2I6KA 2FMLA 1TUMA 3X0IA 5BS6A 3H95A 1PPWA 1V8NA 3FFUA 4V14A 5C7QA 2YVPA 5I8UA 2QJTA 3HHJA 5CFIA 2YYHA 3GZ8A 4IJXA 3GWYA 1VC8A 3BHOA 3I7VA 1X83A 2DUKA 2O1CA 2PQVA 3U53A 1Q27A 1R67A 4YPRA 2O5FA 2I8UA 1V8RA 5C7TA 3P6YA 1XSBA 2PNYA 1G9QA 1KTGA 1OW2A 2JVBA 5ISYA 1V8LA 2VNQA 5LPGA 1VIQA 1KT9A 4J7GA 5DDGA 1IRYA 2AZWA 4N1UA 2DSCA 4JZTA 3GZ6A 2A6TA 2A8QA 3AC9A 4S2XA 5FSKA 2Q9PA 3ACAA 1V8TA 3GZ5A 2DSDA 3A6UA 3EESA 3A6TA 4HFQA 5HZXA 1NFSA 1V8MA 2B06A 1MUTA 3A6VA 1V8WA 2A8RA 3SONA 1VC9A 2G73A 2CL3A 2GT2A 5ANSA 5GHIA 3X0RA 4S2YA 5IW4A 5DPKA 2RRKA 1JRKA 5GHQA 3G0QA 1X84A 5ANVA 3SMDA 1MQWA 2QJOA 3FK9A 2DHOA 1HX3A 1MK1A 3N9UA 3I9XA 3MGMA 5GHOA 3Q2TA 4J7HA 5C8LA 3KVHA 3X0QA 3Q93A 5GHJA 3DKUA 5ANWA 3A6SA 3O69A 1VHGA 2W4EA 1U20A 4JZVA 1NFZA 4K6EA 2DSBA 3O8SA 3FJYA 4S2WA 1NQZA 1RRSA 5ANUA 3O61A 3Q4IA 1I9AA 1Q33A 2ICKA 3MDGA 2B0VA 5FSIA 1RRQA 1MQEA 1G0SA 3QSJA 4MPOA 2YVMA 2O5WA 3HYQA 3FSPA 4ILQA 1F3YA 4C9XA 4YPHA 3EEUA 2XSQA 4YOQA 1JKNA 3X0MA 3CNGA 2GB5A 3R03A 1K2EA 5DD4A 1PUSA 3P5TA 3ZR1A 3L85A 4KG4A 4ICKA 4DYWA 2FVVA 3SHDA 1SOIA 3X0JA 5FSMA 3MDIA 3X0NA 3X0LA 3ID9A 1X51A 3BAPA 3X0PA 3EXQA 1MP2A 1MR2A 3X0KA 3GRNA 1PUQA 2KDWA 3I7UA 3Q1PA 4N1TA 1PPXA 3COUA 4NFWA 3X0OA 1PVFA 5FSNA 1SZ3A 5GHNA 1VIUA 3BM4A 2R5WA 3WHWA 3ZR0A 2I8TA 1VHZA 3X0SA 2KDVA 5FSOA 1GA7A 3F13A 2ICJA 3N77A 1VK6A 2A8SA 4JZUA 2J8QA 3E57A 2A8TA 1RYAA 2GT4A 4ZG0A 4HVYA 4KYXA 5DEQA 1PPVA 1QVJA 1K26A 1V8IA 2B2KA 5GHPA 1V8YA 5BONA 1XSCA 1VRLA 5ANTA 2A8PA 5FSLA
chains in the Genus database with same CATH topology
1V8VA 1Q54A 3O6ZA 4S2VA 1NQYA 3DUPA 5CFJA 5IW5A 4KTBA 2CZRA 2YVNA 1V8UA 1XSAA 2YVOA 3GG6A 3MCFA 1V8SA 1SU2A 2VNPA 3FCMA 3OGAA 4KG3A 1HZTA 2FKBA 4C9WA 3O52A 3F6AA 3RH7A 2G74A 4NFXA 1KHZA 2QKMB 1PUNA 1SJYA 1VCDA 3J7Ye 3EF5A 3Q91A 3Q2SA 5GHMA 4JZSA 2I6KA 2FMLA 1TUMA 3X0IA 5BS6A 3H95A 1PPWA 1V8NA 3FFUA 4V14A 5C7QA 2YVPA 5I8UA 2QJTA 3HHJA 5CFIA 2YYHA 3GZ8A 4IJXA 3GWYA 1VC8A 3BHOA 3I7VA 1X83A 2DUKA 2O1CA 2PQVA 3U53A 1Q27A 1R67A 4YPRA 2O5FA 2I8UA 1V8RA 5C7TA 3P6YA 1XSBA 2PNYA 1G9QA 1KTGA 1OW2A 2JVBA 5ISYA 1V8LA 2VNQA 5LPGA 1VIQA 1KT9A 4J7GA 5DDGA 1IRYA 2AZWA 4N1UA 2DSCA 4JZTA 3GZ6A 2A6TA 2A8QA 3AC9A 4S2XA 5FSKA 2Q9PA 3ACAA 1V8TA 3GZ5A 2DSDA 3A6UA 3EESA 3A6TA 4HFQA 5HZXA 1NFSA 1V8MA 2B06A 1MUTA 3A6VA 1V8WA 2A8RA 3SONA 1VC9A 2G73A 2CL3A 2GT2A 5ANSA 5GHIA 3X0RA 4S2YA 5IW4A 5DPKA 2RRKA 1JRKA 5GHQA 3G0QA 1X84A 5ANVA 3SMDA 1MQWA 2QJOA 3FK9A 2DHOA 1HX3A 1MK1A 3N9UA 3I9XA 3MGMA 5GHOA 3Q2TA 4J7HA 5C8LA 3KVHA 3X0QA 3Q93A 5GHJA 3DKUA 5ANWA 3A6SA 3O69A 1VHGA 2W4EA 1U20A 4JZVA 1NFZA 4K6EA 2DSBA 3O8SA 3FJYA 4S2WA 1NQZA 1RRSA 5ANUA 3O61A 3Q4IA 1I9AA 1Q33A 2ICKA 3MDGA 2B0VA 5FSIA 1RRQA 1MQEA 1G0SA 3QSJA 4MPOA 2YVMA 2O5WA 3HYQA 3FSPA 4ILQA 1F3YA 4C9XA 4YPHA 3EEUA 2XSQA 4YOQA 1JKNA 3X0MA 3CNGA 2GB5A 3R03A 1K2EA 5DD4A 1PUSA 3P5TA 3ZR1A 3L85A 4KG4A 4ICKA 4DYWA 2FVVA 3SHDA 1SOIA 3X0JA 5FSMA 3MDIA 3X0NA 3X0LA 3ID9A 1X51A 3BAPA 3X0PA 3EXQA 1MP2A 1MR2A 3X0KA 3GRNA 1PUQA 2KDWA 3I7UA 3Q1PA 4N1TA 1PPXA 3COUA 4NFWA 3X0OA 1PVFA 5FSNA 1SZ3A 5GHNA 1VIUA 3BM4A 2R5WA 3WHWA 3ZR0A 2I8TA 1VHZA 3X0SA 2KDVA 5FSOA 1GA7A 3F13A 2ICJA 3N77A 1VK6A 2A8SA 4JZUA 2J8QA 3E57A 2A8TA 1RYAA 2GT4A 4ZG0A 4HVYA 4KYXA 5DEQA 1PPVA 1QVJA 1K26A 1V8IA 2B2KA 5GHPA 1V8YA 5BONA 1XSCA 1VRLA 5ANTA 2A8PA 5FSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V8V A;  1Q54 A;  3O6Z A;  4S2V A;  1NQY A;  3DUP A;  5CFJ A;  5IW5 A;  4KTB A;  2YVN A;  1V8U A;  1XSA A;  2YVO A;  3GG6 A;  3MCF A;  1V8S A;  1SU2 A;  2VNP A;  3FCM A;  3OGA A;  4KG3 A;  1HZT A;  2FKB A;  4C9W A;  3O52 A;  3F6A A;  3RH7 A;  2G74 A;  4NFX A;  1KHZ A;  2QKM B;  1PUN A;  1SJY A;  1VCD A;  3J7Y e;  3EF5 A;  3Q91 A;  3Q2S A;  5GHM A;  4JZS A;  2I6K A;  2FML A;  1TUM A;  3X0I A;  5BS6 A;  3H95 A;  1PPW A;  1V8N A;  3FFU A;  4V14 A;  5C7Q A;  2YVP A;  5I8U A;  2QJT A;  3HHJ A;  5CFI A;  2YYH A;  3GZ8 A;  4IJX A;  3GWY A;  1VC8 A;  3BHO A;  3I7V A;  1X83 A;  2DUK A;  2O1C A;  2PQV A;  3U53 A;  1Q27 A;  1R67 A;  4YPR A;  2O5F A;  2I8U A;  1V8R A;  5C7T A;  3P6Y A;  1XSB A;  2PNY A;  1G9Q A;  1KTG A;  1OW2 A;  2JVB A;  5ISY A;  1V8L A;  2VNQ A;  5LPG A;  1VIQ A;  1KT9 A;  5DDG A;  1IRY A;  2AZW A;  4N1U A;  2DSC A;  4JZT A;  3GZ6 A;  2A6T A;  2A8Q A;  3AC9 A;  4S2X A;  5FSK A;  2Q9P A;  3ACA A;  1V8T A;  3GZ5 A;  2DSD A;  3A6U A;  3EES A;  3A6T A;  4HFQ A;  5HZX A;  1NFS A;  1V8M A;  2B06 A;  1MUT A;  3A6V A;  1V8W A;  2A8R A;  3SON A;  1VC9 A;  2G73 A;  2CL3 A;  2GT2 A;  5ANS A;  5GHI A;  3X0R A;  4S2Y A;  5IW4 A;  5DPK A;  2RRK A;  1JRK A;  5GHQ A;  3G0Q A;  1X84 A;  5ANV A;  3SMD A;  1MQW A;  2QJO A;  3FK9 A;  2DHO A;  1HX3 A;  1MK1 A;  3N9U A;  3I9X A;  3MGM A;  5GHO A;  3Q2T A;  5C8L A;  3KVH A;  3X0Q A;  3Q93 A;  5GHJ A;  3DKU A;  5ANW A;  3A6S A;  3O69 A;  1VHG A;  2W4E A;  1U20 A;  4JZV A;  1NFZ A;  4K6E A;  2DSB A;  3O8S A;  3FJY A;  4S2W A;  1NQZ A;  1RRS A;  5ANU A;  3O61 A;  3Q4I A;  1I9A A;  1Q33 A;  2ICK A;  3MDG A;  2B0V A;  5FSI A;  1RRQ A;  1MQE A;  1G0S A;  3QSJ A;  4MPO A;  2YVM A;  2O5W A;  3HYQ A;  3FSP A;  4ILQ A;  1F3Y A;  4C9X A;  4YPH A;  3EEU A;  2XSQ A;  4YOQ A;  1JKN A;  3X0M A;  3CNG A;  2GB5 A;  3R03 A;  1K2E A;  5DD4 A;  1PUS A;  3P5T A;  3ZR1 A;  3L85 A;  4KG4 A;  4ICK A;  4DYW A;  2FVV A;  3SHD A;  1SOI A;  3X0J A;  5FSM A;  3MDI A;  3X0N A;  3X0L A;  3ID9 A;  1X51 A;  3BAP A;  3X0P A;  3EXQ A;  1MP2 A;  1MR2 A;  3X0K A;  3GRN A;  1PUQ A;  2KDW A;  3I7U A;  3Q1P A;  4N1T A;  1PPX A;  3COU A;  4NFW A;  3X0O A;  1PVF A;  5FSN A;  1SZ3 A;  5GHN A;  1VIU A;  3BM4 A;  2R5W A;  3WHW A;  3ZR0 A;  2I8T A;  1VHZ A;  3X0S A;  2KDV A;  5FSO A;  1GA7 A;  3F13 A;  2ICJ A;  3N77 A;  1VK6 A;  2A8S A;  4JZU A;  2J8Q A;  3E57 A;  2A8T A;  1RYA A;  2GT4 A;  4ZG0 A;  4HVY A;  4KYX A;  5DEQ A;  1PPV A;  1QVJ A;  1K26 A;  1V8I A;  2B2K A;  5GHP A;  1V8Y A;  5BON A;  1XSC A;  1VRL A;  5ANT A;  2A8P A;  5FSL A; 
#chains in the Genus database with same CATH topology
 1V8V A;  1Q54 A;  3O6Z A;  4S2V A;  1NQY A;  3DUP A;  5CFJ A;  5IW5 A;  4KTB A;  2CZR A;  2YVN A;  1V8U A;  1XSA A;  2YVO A;  3GG6 A;  3MCF A;  1V8S A;  1SU2 A;  2VNP A;  3FCM A;  3OGA A;  4KG3 A;  1HZT A;  2FKB A;  4C9W A;  3O52 A;  3F6A A;  3RH7 A;  2G74 A;  4NFX A;  1KHZ A;  2QKM B;  1PUN A;  1SJY A;  1VCD A;  3J7Y e;  3EF5 A;  3Q91 A;  3Q2S A;  5GHM A;  4JZS A;  2I6K A;  2FML A;  1TUM A;  3X0I A;  5BS6 A;  3H95 A;  1PPW A;  1V8N A;  3FFU A;  4V14 A;  5C7Q A;  2YVP A;  5I8U A;  2QJT A;  3HHJ A;  5CFI A;  2YYH A;  3GZ8 A;  4IJX A;  3GWY A;  1VC8 A;  3BHO A;  3I7V A;  1X83 A;  2DUK A;  2O1C A;  2PQV A;  3U53 A;  1Q27 A;  1R67 A;  4YPR A;  2O5F A;  2I8U A;  1V8R A;  5C7T A;  3P6Y A;  1XSB A;  2PNY A;  1G9Q A;  1KTG A;  1OW2 A;  2JVB A;  5ISY A;  1V8L A;  2VNQ A;  5LPG A;  1VIQ A;  1KT9 A;  4J7G A;  5DDG A;  1IRY A;  2AZW A;  4N1U A;  2DSC A;  4JZT A;  3GZ6 A;  2A6T A;  2A8Q A;  3AC9 A;  4S2X A;  5FSK A;  2Q9P A;  3ACA A;  1V8T A;  3GZ5 A;  2DSD A;  3A6U A;  3EES A;  3A6T A;  4HFQ A;  5HZX A;  1NFS A;  1V8M A;  2B06 A;  1MUT A;  3A6V A;  1V8W A;  2A8R A;  3SON A;  1VC9 A;  2G73 A;  2CL3 A;  2GT2 A;  5ANS A;  5GHI A;  3X0R A;  4S2Y A;  5IW4 A;  5DPK A;  2RRK A;  1JRK A;  5GHQ A;  3G0Q A;  1X84 A;  5ANV A;  3SMD A;  1MQW A;  2QJO A;  3FK9 A;  2DHO A;  1HX3 A;  1MK1 A;  3N9U A;  3I9X A;  3MGM A;  5GHO A;  3Q2T A;  4J7H A;  5C8L A;  3KVH A;  3X0Q A;  3Q93 A;  5GHJ A;  3DKU A;  5ANW A;  3A6S A;  3O69 A;  1VHG A;  2W4E A;  1U20 A;  4JZV A;  1NFZ A;  4K6E A;  2DSB A;  3O8S A;  3FJY A;  4S2W A;  1NQZ A;  1RRS A;  5ANU A;  3O61 A;  3Q4I A;  1I9A A;  1Q33 A;  2ICK A;  3MDG A;  2B0V A;  5FSI A;  1RRQ A;  1MQE A;  1G0S A;  3QSJ A;  4MPO A;  2YVM A;  2O5W A;  3HYQ A;  3FSP A;  4ILQ A;  1F3Y A;  4C9X A;  4YPH A;  3EEU A;  2XSQ A;  4YOQ A;  1JKN A;  3X0M A;  3CNG A;  2GB5 A;  3R03 A;  1K2E A;  5DD4 A;  1PUS A;  3P5T A;  3ZR1 A;  3L85 A;  4KG4 A;  4ICK A;  4DYW A;  2FVV A;  3SHD A;  1SOI A;  3X0J A;  5FSM A;  3MDI A;  3X0N A;  3X0L A;  3ID9 A;  1X51 A;  3BAP A;  3X0P A;  3EXQ A;  1MP2 A;  1MR2 A;  3X0K A;  3GRN A;  1PUQ A;  2KDW A;  3I7U A;  3Q1P A;  4N1T A;  1PPX A;  3COU A;  4NFW A;  3X0O A;  1PVF A;  5FSN A;  1SZ3 A;  5GHN A;  1VIU A;  3BM4 A;  2R5W A;  3WHW A;  3ZR0 A;  2I8T A;  1VHZ A;  3X0S A;  2KDV A;  5FSO A;  1GA7 A;  3F13 A;  2ICJ A;  3N77 A;  1VK6 A;  2A8S A;  4JZU A;  2J8Q A;  3E57 A;  2A8T A;  1RYA A;  2GT4 A;  4ZG0 A;  4HVY A;  4KYX A;  5DEQ A;  1PPV A;  1QVJ A;  1K26 A;  1V8I A;  2B2K A;  5GHP A;  1V8Y A;  5BON A;  1XSC A;  1VRL A;  5ANT A;  2A8P A;  5FSL A; 
#chains in the Genus database with same CATH homology
 1V8V A;  1Q54 A;  3O6Z A;  4S2V A;  1NQY A;  3DUP A;  5CFJ A;  5IW5 A;  4KTB A;  2CZR A;  2YVN A;  1V8U A;  1XSA A;  2YVO A;  3GG6 A;  3MCF A;  1V8S A;  1SU2 A;  2VNP A;  3FCM A;  3OGA A;  4KG3 A;  1HZT A;  2FKB A;  4C9W A;  3O52 A;  3F6A A;  3RH7 A;  2G74 A;  4NFX A;  1KHZ A;  2QKM B;  1PUN A;  1SJY A;  1VCD A;  3J7Y e;  3EF5 A;  3Q91 A;  3Q2S A;  5GHM A;  4JZS A;  2I6K A;  2FML A;  1TUM A;  3X0I A;  5BS6 A;  3H95 A;  1PPW A;  1V8N A;  3FFU A;  4V14 A;  5C7Q A;  2YVP A;  5I8U A;  2QJT A;  3HHJ A;  5CFI A;  2YYH A;  3GZ8 A;  4IJX A;  3GWY A;  1VC8 A;  3BHO A;  3I7V A;  1X83 A;  2DUK A;  2O1C A;  2PQV A;  3U53 A;  1Q27 A;  1R67 A;  4YPR A;  2O5F A;  2I8U A;  1V8R A;  5C7T A;  3P6Y A;  1XSB A;  2PNY A;  1G9Q A;  1KTG A;  1OW2 A;  2JVB A;  5ISY A;  1V8L A;  2VNQ A;  5LPG A;  1VIQ A;  1KT9 A;  4J7G A;  5DDG A;  1IRY A;  2AZW A;  4N1U A;  2DSC A;  4JZT A;  3GZ6 A;  2A6T A;  2A8Q A;  3AC9 A;  4S2X A;  5FSK A;  2Q9P A;  3ACA A;  1V8T A;  3GZ5 A;  2DSD A;  3A6U A;  3EES A;  3A6T A;  4HFQ A;  5HZX A;  1NFS A;  1V8M A;  2B06 A;  1MUT A;  3A6V A;  1V8W A;  2A8R A;  3SON A;  1VC9 A;  2G73 A;  2CL3 A;  2GT2 A;  5ANS A;  5GHI A;  3X0R A;  4S2Y A;  5IW4 A;  5DPK A;  2RRK A;  1JRK A;  5GHQ A;  3G0Q A;  1X84 A;  5ANV A;  3SMD A;  1MQW A;  2QJO A;  3FK9 A;  2DHO A;  1HX3 A;  1MK1 A;  3N9U A;  3I9X A;  3MGM A;  5GHO A;  3Q2T A;  4J7H A;  5C8L A;  3KVH A;  3X0Q A;  3Q93 A;  5GHJ A;  3DKU A;  5ANW A;  3A6S A;  3O69 A;  1VHG A;  2W4E A;  1U20 A;  4JZV A;  1NFZ A;  4K6E A;  2DSB A;  3O8S A;  3FJY A;  4S2W A;  1NQZ A;  1RRS A;  5ANU A;  3O61 A;  3Q4I A;  1I9A A;  1Q33 A;  2ICK A;  3MDG A;  2B0V A;  5FSI A;  1RRQ A;  1MQE A;  1G0S A;  3QSJ A;  4MPO A;  2YVM A;  2O5W A;  3HYQ A;  3FSP A;  4ILQ A;  1F3Y A;  4C9X A;  4YPH A;  3EEU A;  2XSQ A;  4YOQ A;  1JKN A;  3X0M A;  3CNG A;  2GB5 A;  3R03 A;  1K2E A;  5DD4 A;  1PUS A;  3P5T A;  3ZR1 A;  3L85 A;  4KG4 A;  4ICK A;  4DYW A;  2FVV A;  3SHD A;  1SOI A;  3X0J A;  5FSM A;  3MDI A;  3X0N A;  3X0L A;  3ID9 A;  1X51 A;  3BAP A;  3X0P A;  3EXQ A;  1MP2 A;  1MR2 A;  3X0K A;  3GRN A;  1PUQ A;  2KDW A;  3I7U A;  3Q1P A;  4N1T A;  1PPX A;  3COU A;  4NFW A;  3X0O A;  1PVF A;  5FSN A;  1SZ3 A;  5GHN A;  1VIU A;  3BM4 A;  2R5W A;  3WHW A;  3ZR0 A;  2I8T A;  1VHZ A;  3X0S A;  2KDV A;  5FSO A;  1GA7 A;  3F13 A;  2ICJ A;  3N77 A;  1VK6 A;  2A8S A;  4JZU A;  2J8Q A;  3E57 A;  2A8T A;  1RYA A;  2GT4 A;  4ZG0 A;  4HVY A;  4KYX A;  5DEQ A;  1PPV A;  1QVJ A;  1K26 A;  1V8I A;  2B2K A;  5GHP A;  1V8Y A;  5BON A;  1XSC A;  1VRL A;  5ANT A;  2A8P A;  5FSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...