1IRYA

Solution structure of the hmth1, a nucleotide pool sanitization enzyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
156
structure length
156
Chain Sequence
b'MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hMTH1
publication title Structure of human MTH1, a Nudix family hydrolase that selectively degrades oxidized purine nucleoside triphosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 156
sequence length 156
ec nomenclature ec 3.6.1.55: 8-oxo-dGTP diphosphatase.
pdb deposition date 2001-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 1iryA00
5CFIA 2FKBA 5HZXA 1V8NA 1V8RA 2Q9PA 1PPWA 3X0RA 1OW2A 1RYAA 3COUA 1K2EA 3ACAA 3GZ8A 4MPOA 2B2KA 2YVMA 2QJTA 3P5TA 3MDGA 1Q33A 4HVYA 2KDWA 3I7UA 1KT9A 2O5WA 4ICKA 2O5FA 3A6SA 2ICKA 5ANVA 1PUNA 4HFQA 1MQWA 3BHOA 5C8LA 1X51A 1MUTA 3Q91A 1NFSA 3ZR1A 1F3YA 3GWYA 1VHZA 4V14A 1JKNA 3N77A 1RRQA 1V8VA 5FSKA 4S2VA 3U53A 2XSQA 3X0NA 5DPKA 2O1CA 3R03A 5FSLA 3CNGA 2A8SA 1V8TA 3O52A 4JZSA 4NFWA 2B06A 1VC9A 2I8TA 4C9XA 5GHJA 1VK6A 4ZG0A 2CL3A 1VHGA 3ZR0A 3X0SA 5FSIA 3X0QA 2RRKA 3E57A 1KTGA 2A8RA 2G73A 2I8UA 1V8SA 4KG4A 4YOQA 1MP2A 2KDVA 3MGMA 1X84A 5FSNA 1KHZA 4IJXA 5GHNA 5CFJA 3GG6A 5DD4A 3F6AA 3BAPA 5GHOA 3O8SA 4K6EA 5FSOA 1XSCA 3GZ5A 4YPHA 2YYHA 4N1UA 1I9AA 1QVJA 2GT4A 2J8QA 3A6VA 4JZTA 3J7Ye 4DYWA 2GT2A 1V8IA 1SZ3A 5C7TA 3Q2TA 4KTBA 3N9UA 2FMLA 5ISYA 1VIQA 2AZWA 2JVBA 1PPVA 5DEQA 3GZ6A 5GHIA 3BM4A 3FSPA 3RH7A 3X0PA 5I8UA 3H95A 1G0SA 1GA7A 1XSBA 3EESA 1Q27A 3Q1PA 5ANUA 2DHOA 3X0LA 1V8YA 1NQZA 1HZTA 3I7VA 1IRYA 1PUSA 1U20A 3O69A 5FSMA 3F13A 3DUPA 4YPRA 2DUKA 1JRKA 5LPGA 2A8PA 2YVOA 3I9XA 5ANWA 3Q2SA 1NQYA 2QJOA 3EEUA 3FCMA 5GHQA 2QKMB 3MCFA 3Q93A 5IW4A 3A6UA 1PUQA 1X83A 2GB5A 3HHJA 1Q54A 3O6ZA 3OGAA 4S2WA 1V8WA 5GHMA 1V8MA 2VNPA 3WHWA 3DKUA 3Q4IA 2ICJA 3O61A 1RRSA 3A6TA 1K26A 3EXQA 2YVPA 4JZUA 3L85A 3FK9A 1MK1A 3X0KA 1V8UA 4N1TA 5BS6A 3GRNA 3X0IA 1TUMA 4C9WA 4KYXA 4KG3A 4S2YA 1VC8A 4ILQA 1V8LA 2R5WA 1MQEA 2W4EA 1SOIA 3P6YA 3G0QA 4JZVA 5C7QA 3ID9A 3X0MA 5ANSA 3X0OA 3X0JA 1SJYA 2I6KA 5BONA 3QSJA 2FVVA 3SMDA 4S2XA 3AC9A 1VIUA 5DDGA 3EF5A 3SHDA 2B0VA 1PPXA 1HX3A 2DSDA 1VCDA 2G74A 1XSAA 2VNQA 5GHPA 5IW5A 3MDIA 1MR2A 1NFZA 2A8QA 2DSBA 2YVNA 2A8TA 2DSCA 2PQVA 3HYQA 4NFXA 5ANTA 1R67A 3SONA 3FJYA 1SU2A 1PVFA 2A6TA 2PNYA 3FFUA 3KVHA 1G9QA 1VRLA
chains in the Genus database with same CATH superfamily
5CFIA 2FKBA 5HZXA 1V8NA 1V8RA 4J7HA 2Q9PA 1PPWA 3X0RA 1OW2A 1RYAA 3COUA 1K2EA 3ACAA 3GZ8A 4MPOA 2B2KA 2YVMA 2QJTA 3P5TA 3MDGA 1Q33A 4HVYA 2KDWA 3I7UA 1KT9A 2O5WA 4ICKA 2O5FA 3A6SA 2ICKA 5ANVA 1PUNA 4HFQA 1MQWA 3BHOA 5C8LA 1X51A 1MUTA 3Q91A 1NFSA 3ZR1A 1F3YA 3GWYA 1VHZA 4V14A 1JKNA 3N77A 1RRQA 1V8VA 5FSKA 4S2VA 3U53A 2XSQA 3X0NA 5DPKA 2O1CA 3R03A 5FSLA 3CNGA 2A8SA 1V8TA 3O52A 4JZSA 4NFWA 2B06A 1VC9A 2I8TA 4C9XA 5GHJA 1VK6A 4ZG0A 2CL3A 1VHGA 3ZR0A 3X0SA 5FSIA 3X0QA 2RRKA 3E57A 1KTGA 2A8RA 2G73A 2I8UA 1V8SA 4KG4A 4YOQA 1MP2A 2KDVA 3MGMA 1X84A 5FSNA 1KHZA 4IJXA 5GHNA 5CFJA 3GG6A 5DD4A 3F6AA 3BAPA 5GHOA 3O8SA 4K6EA 5FSOA 1XSCA 3GZ5A 4YPHA 2YYHA 4N1UA 1I9AA 1QVJA 2GT4A 2J8QA 3A6VA 4JZTA 3J7Ye 4DYWA 2GT2A 1V8IA 1SZ3A 5C7TA 3Q2TA 4KTBA 3N9UA 2FMLA 5ISYA 1VIQA 2AZWA 2JVBA 1PPVA 5DEQA 3GZ6A 5GHIA 3BM4A 3FSPA 3RH7A 3X0PA 5I8UA 3H95A 1G0SA 1GA7A 1XSBA 3EESA 1Q27A 3Q1PA 5ANUA 2DHOA 3X0LA 1V8YA 1NQZA 1HZTA 3I7VA 1IRYA 1PUSA 1U20A 3O69A 5FSMA 3F13A 3DUPA 4YPRA 2DUKA 1JRKA 5LPGA 2A8PA 2YVOA 3I9XA 5ANWA 3Q2SA 1NQYA 2QJOA 3EEUA 3FCMA 5GHQA 2QKMB 3MCFA 3Q93A 5IW4A 3A6UA 1PUQA 1X83A 2GB5A 3HHJA 1Q54A 3O6ZA 3OGAA 4S2WA 1V8WA 5GHMA 1V8MA 2VNPA 3WHWA 3DKUA 3Q4IA 2ICJA 3O61A 1RRSA 3A6TA 1K26A 3EXQA 2YVPA 4JZUA 3L85A 3FK9A 1MK1A 3X0KA 1V8UA 4N1TA 5BS6A 3GRNA 3X0IA 1TUMA 4C9WA 4KYXA 2CZRA 4KG3A 4S2YA 1VC8A 4ILQA 1V8LA 2R5WA 4J7GA 1MQEA 2W4EA 1SOIA 3P6YA 3G0QA 4JZVA 5C7QA 3ID9A 3X0MA 5ANSA 3X0OA 3X0JA 1SJYA 2I6KA 5BONA 3QSJA 2FVVA 3SMDA 4S2XA 3AC9A 1VIUA 5DDGA 3EF5A 3SHDA 2B0VA 1PPXA 1HX3A 2DSDA 1VCDA 2G74A 1XSAA 2VNQA 5GHPA 5IW5A 3MDIA 1MR2A 1NFZA 2A8QA 2DSBA 2YVNA 2A8TA 2DSCA 2PQVA 3HYQA 4NFXA 5ANTA 1R67A 3SONA 3FJYA 1SU2A 1PVFA 2A6TA 2PNYA 3FFUA 3KVHA 1G9QA 1VRLA
chains in the Genus database with same CATH topology
5CFIA 2FKBA 5HZXA 1V8NA 1V8RA 4J7HA 2Q9PA 1PPWA 3X0RA 1OW2A 1RYAA 3COUA 1K2EA 3ACAA 3GZ8A 4MPOA 2B2KA 2YVMA 2QJTA 3P5TA 3MDGA 1Q33A 4HVYA 2KDWA 3I7UA 1KT9A 2O5WA 4ICKA 2O5FA 3A6SA 2ICKA 5ANVA 1PUNA 4HFQA 1MQWA 3BHOA 5C8LA 1X51A 1MUTA 3Q91A 1NFSA 3ZR1A 1F3YA 3GWYA 1VHZA 4V14A 1JKNA 3N77A 1RRQA 1V8VA 5FSKA 4S2VA 3U53A 2XSQA 3X0NA 5DPKA 2O1CA 3R03A 5FSLA 3CNGA 2A8SA 1V8TA 3O52A 4JZSA 4NFWA 2B06A 1VC9A 2I8TA 4C9XA 5GHJA 1VK6A 4ZG0A 2CL3A 1VHGA 3ZR0A 3X0SA 5FSIA 3X0QA 2RRKA 3E57A 1KTGA 2A8RA 2G73A 2I8UA 1V8SA 4KG4A 4YOQA 1MP2A 2KDVA 3MGMA 1X84A 5FSNA 1KHZA 4IJXA 5GHNA 5CFJA 3GG6A 5DD4A 3F6AA 3BAPA 5GHOA 3O8SA 4K6EA 5FSOA 1XSCA 3GZ5A 4YPHA 2YYHA 4N1UA 1I9AA 1QVJA 2GT4A 2J8QA 3A6VA 4JZTA 3J7Ye 4DYWA 2GT2A 1V8IA 1SZ3A 5C7TA 3Q2TA 4KTBA 3N9UA 2FMLA 5ISYA 1VIQA 2AZWA 2JVBA 1PPVA 5DEQA 3GZ6A 5GHIA 3BM4A 3FSPA 3RH7A 3X0PA 5I8UA 3H95A 1G0SA 1GA7A 1XSBA 3EESA 1Q27A 3Q1PA 5ANUA 2DHOA 3X0LA 1V8YA 1NQZA 1HZTA 3I7VA 1IRYA 1PUSA 1U20A 3O69A 5FSMA 3F13A 3DUPA 4YPRA 2DUKA 1JRKA 5LPGA 2A8PA 2YVOA 3I9XA 5ANWA 3Q2SA 1NQYA 2QJOA 3EEUA 3FCMA 5GHQA 2QKMB 3MCFA 3Q93A 5IW4A 3A6UA 1PUQA 1X83A 2GB5A 3HHJA 1Q54A 3O6ZA 3OGAA 4S2WA 1V8WA 5GHMA 1V8MA 2VNPA 3WHWA 3DKUA 3Q4IA 2ICJA 3O61A 1RRSA 3A6TA 1K26A 3EXQA 2YVPA 4JZUA 3L85A 3FK9A 1MK1A 3X0KA 1V8UA 4N1TA 5BS6A 3GRNA 3X0IA 1TUMA 4C9WA 4KYXA 2CZRA 4KG3A 4S2YA 1VC8A 4ILQA 1V8LA 2R5WA 4J7GA 1MQEA 2W4EA 1SOIA 3P6YA 3G0QA 4JZVA 5C7QA 3ID9A 3X0MA 5ANSA 3X0OA 3X0JA 1SJYA 2I6KA 5BONA 3QSJA 2FVVA 3SMDA 4S2XA 3AC9A 1VIUA 5DDGA 3EF5A 3SHDA 2B0VA 1PPXA 1HX3A 2DSDA 1VCDA 2G74A 1XSAA 2VNQA 5GHPA 5IW5A 3MDIA 1MR2A 1NFZA 2A8QA 2DSBA 2YVNA 2A8TA 2DSCA 2PQVA 3HYQA 4NFXA 5ANTA 1R67A 3SONA 3FJYA 1SU2A 1PVFA 2A6TA 2PNYA 3FFUA 3KVHA 1G9QA 1VRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFI A;  2FKB A;  5HZX A;  1V8N A;  1V8R A;  2Q9P A;  1PPW A;  3X0R A;  1OW2 A;  1RYA A;  3COU A;  1K2E A;  3ACA A;  3GZ8 A;  4MPO A;  2B2K A;  2YVM A;  2QJT A;  3P5T A;  3MDG A;  1Q33 A;  4HVY A;  2KDW A;  3I7U A;  1KT9 A;  2O5W A;  4ICK A;  2O5F A;  3A6S A;  2ICK A;  5ANV A;  1PUN A;  4HFQ A;  1MQW A;  3BHO A;  5C8L A;  1X51 A;  1MUT A;  3Q91 A;  1NFS A;  3ZR1 A;  1F3Y A;  3GWY A;  1VHZ A;  4V14 A;  1JKN A;  3N77 A;  1RRQ A;  1V8V A;  5FSK A;  4S2V A;  3U53 A;  2XSQ A;  3X0N A;  5DPK A;  2O1C A;  3R03 A;  5FSL A;  3CNG A;  2A8S A;  1V8T A;  3O52 A;  4JZS A;  4NFW A;  2B06 A;  1VC9 A;  2I8T A;  4C9X A;  5GHJ A;  1VK6 A;  4ZG0 A;  2CL3 A;  1VHG A;  3ZR0 A;  3X0S A;  5FSI A;  3X0Q A;  2RRK A;  3E57 A;  1KTG A;  2A8R A;  2G73 A;  2I8U A;  1V8S A;  4KG4 A;  4YOQ A;  1MP2 A;  2KDV A;  3MGM A;  1X84 A;  5FSN A;  1KHZ A;  4IJX A;  5GHN A;  5CFJ A;  3GG6 A;  5DD4 A;  3F6A A;  3BAP A;  5GHO A;  3O8S A;  4K6E A;  5FSO A;  1XSC A;  3GZ5 A;  4YPH A;  2YYH A;  4N1U A;  1I9A A;  1QVJ A;  2GT4 A;  2J8Q A;  3A6V A;  4JZT A;  3J7Y e;  4DYW A;  2GT2 A;  1V8I A;  1SZ3 A;  5C7T A;  3Q2T A;  4KTB A;  3N9U A;  2FML A;  5ISY A;  1VIQ A;  2AZW A;  2JVB A;  1PPV A;  5DEQ A;  3GZ6 A;  5GHI A;  3BM4 A;  3FSP A;  3RH7 A;  3X0P A;  5I8U A;  3H95 A;  1G0S A;  1GA7 A;  1XSB A;  3EES A;  1Q27 A;  3Q1P A;  5ANU A;  2DHO A;  3X0L A;  1V8Y A;  1NQZ A;  1HZT A;  3I7V A;  1IRY A;  1PUS A;  1U20 A;  3O69 A;  5FSM A;  3F13 A;  3DUP A;  4YPR A;  2DUK A;  1JRK A;  5LPG A;  2A8P A;  2YVO A;  3I9X A;  5ANW A;  3Q2S A;  1NQY A;  2QJO A;  3EEU A;  3FCM A;  5GHQ A;  2QKM B;  3MCF A;  3Q93 A;  5IW4 A;  3A6U A;  1PUQ A;  1X83 A;  2GB5 A;  3HHJ A;  1Q54 A;  3O6Z A;  3OGA A;  4S2W A;  1V8W A;  5GHM A;  1V8M A;  2VNP A;  3WHW A;  3DKU A;  3Q4I A;  2ICJ A;  3O61 A;  1RRS A;  3A6T A;  1K26 A;  3EXQ A;  2YVP A;  4JZU A;  3L85 A;  3FK9 A;  1MK1 A;  3X0K A;  1V8U A;  4N1T A;  5BS6 A;  3GRN A;  3X0I A;  1TUM A;  4C9W A;  4KYX A;  4KG3 A;  4S2Y A;  1VC8 A;  4ILQ A;  1V8L A;  2R5W A;  1MQE A;  2W4E A;  1SOI A;  3P6Y A;  3G0Q A;  4JZV A;  5C7Q A;  3ID9 A;  3X0M A;  5ANS A;  3X0O A;  3X0J A;  1SJY A;  2I6K A;  5BON A;  3QSJ A;  2FVV A;  3SMD A;  4S2X A;  3AC9 A;  1VIU A;  5DDG A;  3EF5 A;  3SHD A;  2B0V A;  1PPX A;  1HX3 A;  2DSD A;  1VCD A;  2G74 A;  1XSA A;  2VNQ A;  5GHP A;  5IW5 A;  3MDI A;  1MR2 A;  1NFZ A;  2A8Q A;  2DSB A;  2YVN A;  2A8T A;  2DSC A;  2PQV A;  3HYQ A;  4NFX A;  5ANT A;  1R67 A;  3SON A;  3FJY A;  1SU2 A;  1PVF A;  2A6T A;  2PNY A;  3FFU A;  3KVH A;  1G9Q A;  1VRL A; 
#chains in the Genus database with same CATH topology
 5CFI A;  2FKB A;  5HZX A;  1V8N A;  1V8R A;  4J7H A;  2Q9P A;  1PPW A;  3X0R A;  1OW2 A;  1RYA A;  3COU A;  1K2E A;  3ACA A;  3GZ8 A;  4MPO A;  2B2K A;  2YVM A;  2QJT A;  3P5T A;  3MDG A;  1Q33 A;  4HVY A;  2KDW A;  3I7U A;  1KT9 A;  2O5W A;  4ICK A;  2O5F A;  3A6S A;  2ICK A;  5ANV A;  1PUN A;  4HFQ A;  1MQW A;  3BHO A;  5C8L A;  1X51 A;  1MUT A;  3Q91 A;  1NFS A;  3ZR1 A;  1F3Y A;  3GWY A;  1VHZ A;  4V14 A;  1JKN A;  3N77 A;  1RRQ A;  1V8V A;  5FSK A;  4S2V A;  3U53 A;  2XSQ A;  3X0N A;  5DPK A;  2O1C A;  3R03 A;  5FSL A;  3CNG A;  2A8S A;  1V8T A;  3O52 A;  4JZS A;  4NFW A;  2B06 A;  1VC9 A;  2I8T A;  4C9X A;  5GHJ A;  1VK6 A;  4ZG0 A;  2CL3 A;  1VHG A;  3ZR0 A;  3X0S A;  5FSI A;  3X0Q A;  2RRK A;  3E57 A;  1KTG A;  2A8R A;  2G73 A;  2I8U A;  1V8S A;  4KG4 A;  4YOQ A;  1MP2 A;  2KDV A;  3MGM A;  1X84 A;  5FSN A;  1KHZ A;  4IJX A;  5GHN A;  5CFJ A;  3GG6 A;  5DD4 A;  3F6A A;  3BAP A;  5GHO A;  3O8S A;  4K6E A;  5FSO A;  1XSC A;  3GZ5 A;  4YPH A;  2YYH A;  4N1U A;  1I9A A;  1QVJ A;  2GT4 A;  2J8Q A;  3A6V A;  4JZT A;  3J7Y e;  4DYW A;  2GT2 A;  1V8I A;  1SZ3 A;  5C7T A;  3Q2T A;  4KTB A;  3N9U A;  2FML A;  5ISY A;  1VIQ A;  2AZW A;  2JVB A;  1PPV A;  5DEQ A;  3GZ6 A;  5GHI A;  3BM4 A;  3FSP A;  3RH7 A;  3X0P A;  5I8U A;  3H95 A;  1G0S A;  1GA7 A;  1XSB A;  3EES A;  1Q27 A;  3Q1P A;  5ANU A;  2DHO A;  3X0L A;  1V8Y A;  1NQZ A;  1HZT A;  3I7V A;  1IRY A;  1PUS A;  1U20 A;  3O69 A;  5FSM A;  3F13 A;  3DUP A;  4YPR A;  2DUK A;  1JRK A;  5LPG A;  2A8P A;  2YVO A;  3I9X A;  5ANW A;  3Q2S A;  1NQY A;  2QJO A;  3EEU A;  3FCM A;  5GHQ A;  2QKM B;  3MCF A;  3Q93 A;  5IW4 A;  3A6U A;  1PUQ A;  1X83 A;  2GB5 A;  3HHJ A;  1Q54 A;  3O6Z A;  3OGA A;  4S2W A;  1V8W A;  5GHM A;  1V8M A;  2VNP A;  3WHW A;  3DKU A;  3Q4I A;  2ICJ A;  3O61 A;  1RRS A;  3A6T A;  1K26 A;  3EXQ A;  2YVP A;  4JZU A;  3L85 A;  3FK9 A;  1MK1 A;  3X0K A;  1V8U A;  4N1T A;  5BS6 A;  3GRN A;  3X0I A;  1TUM A;  4C9W A;  4KYX A;  2CZR A;  4KG3 A;  4S2Y A;  1VC8 A;  4ILQ A;  1V8L A;  2R5W A;  4J7G A;  1MQE A;  2W4E A;  1SOI A;  3P6Y A;  3G0Q A;  4JZV A;  5C7Q A;  3ID9 A;  3X0M A;  5ANS A;  3X0O A;  3X0J A;  1SJY A;  2I6K A;  5BON A;  3QSJ A;  2FVV A;  3SMD A;  4S2X A;  3AC9 A;  1VIU A;  5DDG A;  3EF5 A;  3SHD A;  2B0V A;  1PPX A;  1HX3 A;  2DSD A;  1VCD A;  2G74 A;  1XSA A;  2VNQ A;  5GHP A;  5IW5 A;  3MDI A;  1MR2 A;  1NFZ A;  2A8Q A;  2DSB A;  2YVN A;  2A8T A;  2DSC A;  2PQV A;  3HYQ A;  4NFX A;  5ANT A;  1R67 A;  3SON A;  3FJY A;  1SU2 A;  1PVF A;  2A6T A;  2PNY A;  3FFU A;  3KVH A;  1G9Q A;  1VRL A; 
#chains in the Genus database with same CATH homology
 5CFI A;  2FKB A;  5HZX A;  1V8N A;  1V8R A;  4J7H A;  2Q9P A;  1PPW A;  3X0R A;  1OW2 A;  1RYA A;  3COU A;  1K2E A;  3ACA A;  3GZ8 A;  4MPO A;  2B2K A;  2YVM A;  2QJT A;  3P5T A;  3MDG A;  1Q33 A;  4HVY A;  2KDW A;  3I7U A;  1KT9 A;  2O5W A;  4ICK A;  2O5F A;  3A6S A;  2ICK A;  5ANV A;  1PUN A;  4HFQ A;  1MQW A;  3BHO A;  5C8L A;  1X51 A;  1MUT A;  3Q91 A;  1NFS A;  3ZR1 A;  1F3Y A;  3GWY A;  1VHZ A;  4V14 A;  1JKN A;  3N77 A;  1RRQ A;  1V8V A;  5FSK A;  4S2V A;  3U53 A;  2XSQ A;  3X0N A;  5DPK A;  2O1C A;  3R03 A;  5FSL A;  3CNG A;  2A8S A;  1V8T A;  3O52 A;  4JZS A;  4NFW A;  2B06 A;  1VC9 A;  2I8T A;  4C9X A;  5GHJ A;  1VK6 A;  4ZG0 A;  2CL3 A;  1VHG A;  3ZR0 A;  3X0S A;  5FSI A;  3X0Q A;  2RRK A;  3E57 A;  1KTG A;  2A8R A;  2G73 A;  2I8U A;  1V8S A;  4KG4 A;  4YOQ A;  1MP2 A;  2KDV A;  3MGM A;  1X84 A;  5FSN A;  1KHZ A;  4IJX A;  5GHN A;  5CFJ A;  3GG6 A;  5DD4 A;  3F6A A;  3BAP A;  5GHO A;  3O8S A;  4K6E A;  5FSO A;  1XSC A;  3GZ5 A;  4YPH A;  2YYH A;  4N1U A;  1I9A A;  1QVJ A;  2GT4 A;  2J8Q A;  3A6V A;  4JZT A;  3J7Y e;  4DYW A;  2GT2 A;  1V8I A;  1SZ3 A;  5C7T A;  3Q2T A;  4KTB A;  3N9U A;  2FML A;  5ISY A;  1VIQ A;  2AZW A;  2JVB A;  1PPV A;  5DEQ A;  3GZ6 A;  5GHI A;  3BM4 A;  3FSP A;  3RH7 A;  3X0P A;  5I8U A;  3H95 A;  1G0S A;  1GA7 A;  1XSB A;  3EES A;  1Q27 A;  3Q1P A;  5ANU A;  2DHO A;  3X0L A;  1V8Y A;  1NQZ A;  1HZT A;  3I7V A;  1IRY A;  1PUS A;  1U20 A;  3O69 A;  5FSM A;  3F13 A;  3DUP A;  4YPR A;  2DUK A;  1JRK A;  5LPG A;  2A8P A;  2YVO A;  3I9X A;  5ANW A;  3Q2S A;  1NQY A;  2QJO A;  3EEU A;  3FCM A;  5GHQ A;  2QKM B;  3MCF A;  3Q93 A;  5IW4 A;  3A6U A;  1PUQ A;  1X83 A;  2GB5 A;  3HHJ A;  1Q54 A;  3O6Z A;  3OGA A;  4S2W A;  1V8W A;  5GHM A;  1V8M A;  2VNP A;  3WHW A;  3DKU A;  3Q4I A;  2ICJ A;  3O61 A;  1RRS A;  3A6T A;  1K26 A;  3EXQ A;  2YVP A;  4JZU A;  3L85 A;  3FK9 A;  1MK1 A;  3X0K A;  1V8U A;  4N1T A;  5BS6 A;  3GRN A;  3X0I A;  1TUM A;  4C9W A;  4KYX A;  2CZR A;  4KG3 A;  4S2Y A;  1VC8 A;  4ILQ A;  1V8L A;  2R5W A;  4J7G A;  1MQE A;  2W4E A;  1SOI A;  3P6Y A;  3G0Q A;  4JZV A;  5C7Q A;  3ID9 A;  3X0M A;  5ANS A;  3X0O A;  3X0J A;  1SJY A;  2I6K A;  5BON A;  3QSJ A;  2FVV A;  3SMD A;  4S2X A;  3AC9 A;  1VIU A;  5DDG A;  3EF5 A;  3SHD A;  2B0V A;  1PPX A;  1HX3 A;  2DSD A;  1VCD A;  2G74 A;  1XSA A;  2VNQ A;  5GHP A;  5IW5 A;  3MDI A;  1MR2 A;  1NFZ A;  2A8Q A;  2DSB A;  2YVN A;  2A8T A;  2DSC A;  2PQV A;  3HYQ A;  4NFX A;  5ANT A;  1R67 A;  3SON A;  3FJY A;  1SU2 A;  1PVF A;  2A6T A;  2PNY A;  3FFU A;  3KVH A;  1G9Q A;  1VRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...