4S2YA

Structure of e. coli rpph bound to rna and three magnesium ions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
160
structure length
155
Chain Sequence
b'MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRVCIGQKQKWFLLQLVSGDAEINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA pyrophosphohydrolase
publication title Structures of RNA Complexes with the Escherichia coli RNA Pyrophosphohydrolase RppH Unveil the Basis for Specific 5'-End-dependent mRNA Decay.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 41
structure length 155
sequence length 160
ec nomenclature ec 3.6.1.-:
pdb deposition date 2015-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 4s2yA00
2AZWA 3ID9A 1RRSA 2A8SA 2QJOA 2PQVA 2RRKA 1X83A 2O5FA 2O5WA 2R5WA 1PUQA 2JVBA 1MUTA 2YVPA 3AC9A 3F6AA 3KVHA 3OGAA 4KYXA 4KTBA 1V8NA 5FSKA 5GHIA 4S2XA 3O6ZA 4ICKA 5GHMA 2FVVA 2KDWA 2YYHA 3A6VA 5ANVA 3BAPA 1Q54A 4C9WA 3SONA 2B0VA 1K26A 1XSCA 2DUKA 3COUA 3HYQA 5FSOA 5GHNA 5LPGA 3CNGA 3O69A 1VCDA 1JKNA 3MGMA 3A6TA 1PUNA 4V14A 3A6SA 1GA7A 3I7UA 4JZUA 5FSLA 1XSAA 4DYWA 1MR2A 3HHJA 4MPOA 3X0IA 3X0OA 3BM4A 1X51A 1XSBA 4S2WA 3N9UA 1VC8A 1G9QA 5C7TA 3L85A 4N1UA 4C9XA 4ILQA 1KTGA 3GRNA 3GG6A 1V8WA 3O52A 3I7VA 3F13A 1NFZA 3Q2SA 2B06A 2ICKA 2QKMB 4KG3A 4N1TA 3MDGA 2GT4A 4HFQA 4K6EA 3U53A 2CL3A 5GHQA 3QSJA 1V8YA 3X0PA 2DHOA 3O8SA 1PPXA 1KHZA 3Q2TA 5GHJA 5GHOA 1VHGA 3GZ5A 3O61A 3I9XA 3X0QA 4YPRA 3X0SA 1MP2A 1QVJA 1SJYA 2ICJA 5DDGA 2I8UA 3FK9A 5I8UA 4NFXA 2G73A 3EEUA 3R03A 5C8LA 3X0RA 5IW5A 3Q93A 5ANUA 4S2YA 2VNPA 1NFSA 2PNYA 3A6UA 2YVMA 1VHZA 2I6KA 1V8LA 2DSCA 3ZR0A 1I9AA 4KG4A 3FJYA 1VIUA 3P5TA 1VK6A 1HX3A 3J7Ye 4JZTA 1K2EA 1R67A 2O1CA 5FSIA 1RYAA 5ANWA 3SMDA 2A6TA 5DD4A 5FSMA 1VC9A 3P6YA 1V8IA 3Q91A 3EF5A 2A8PA 1V8RA 4JZSA 3X0JA 1PUSA 2I8TA 3FSPA 2B2KA 2Q9PA 3EXQA 5ANTA 3X0LA 3RH7A 5DEQA 5ISYA 1Q33A 1G0SA 2GB5A 1NQZA 2A8TA 2W4EA 3FFUA 4NFWA 2YVOA 1VRLA 4YPHA 3MDIA 1MQEA 1IRYA 4YOQA 5CFJA 2KDVA 4IJXA 3BHOA 1OW2A 1X84A 3X0NA 3ZR1A 3GZ6A 1PPVA 3X0KA 1F3YA 1JRKA 3GZ8A 3G0QA 1RRQA 1PPWA 1PVFA 1SOIA 1V8SA 1VIQA 2A8RA 2QJTA 3ACAA 1MK1A 1NQYA 3E57A 3X0MA 1U20A 1Q27A 1SZ3A 1MQWA 1V8MA 3SHDA 1SU2A 2G74A 1KT9A 2VNQA 3EESA 3DUPA 5ANSA 3WHWA 3GWYA 2YVNA 4ZG0A 2DSDA 2J8QA 1TUMA 2GT2A 2XSQA 5GHPA 5CFIA 5FSNA 5C7QA 5HZXA 3FCMA 5IW4A 4JZVA 3MCFA 3Q4IA 5BONA 2FKBA 3H95A 1HZTA 3Q1PA 2A8QA 3N77A 5BS6A 4S2VA 3DKUA 4HVYA 5DPKA 1V8UA 1V8TA 1V8VA 2DSBA 2FMLA
chains in the Genus database with same CATH superfamily
2AZWA 3ID9A 1RRSA 2A8SA 2QJOA 2PQVA 2RRKA 1X83A 2O5FA 2O5WA 2R5WA 1PUQA 2JVBA 1MUTA 2YVPA 3AC9A 3F6AA 3KVHA 3OGAA 4KYXA 4KTBA 1V8NA 5FSKA 5GHIA 4S2XA 3O6ZA 4ICKA 5GHMA 2FVVA 2KDWA 2YYHA 3A6VA 5ANVA 3BAPA 1Q54A 4C9WA 3SONA 2B0VA 1K26A 1XSCA 2DUKA 3COUA 3HYQA 5FSOA 5GHNA 5LPGA 3CNGA 3O69A 1VCDA 1JKNA 3MGMA 3A6TA 1PUNA 4V14A 3A6SA 1GA7A 3I7UA 4JZUA 5FSLA 1XSAA 4DYWA 1MR2A 3HHJA 4MPOA 3X0IA 3X0OA 3BM4A 1X51A 1XSBA 4S2WA 3N9UA 1VC8A 1G9QA 5C7TA 3L85A 4N1UA 4C9XA 4ILQA 1KTGA 3GRNA 3GG6A 1V8WA 3O52A 3I7VA 3F13A 1NFZA 3Q2SA 2B06A 2ICKA 2QKMB 4KG3A 4N1TA 2CZRA 3MDGA 2GT4A 4HFQA 4K6EA 3U53A 2CL3A 5GHQA 3QSJA 1V8YA 3X0PA 2DHOA 3O8SA 1PPXA 1KHZA 3Q2TA 5GHJA 5GHOA 1VHGA 3GZ5A 3O61A 3I9XA 3X0QA 4YPRA 3X0SA 1MP2A 1QVJA 1SJYA 2ICJA 5DDGA 2I8UA 3FK9A 5I8UA 4NFXA 2G73A 3EEUA 3R03A 5C8LA 3X0RA 5IW5A 3Q93A 5ANUA 4S2YA 2VNPA 1NFSA 2PNYA 3A6UA 2YVMA 1VHZA 2I6KA 1V8LA 2DSCA 3ZR0A 1I9AA 4KG4A 3FJYA 1VIUA 3P5TA 1VK6A 1HX3A 3J7Ye 4JZTA 1K2EA 1R67A 2O1CA 5FSIA 1RYAA 5ANWA 3SMDA 2A6TA 5DD4A 5FSMA 1VC9A 3P6YA 1V8IA 3Q91A 3EF5A 2A8PA 1V8RA 4JZSA 3X0JA 1PUSA 2I8TA 3FSPA 2B2KA 2Q9PA 3EXQA 5ANTA 3X0LA 3RH7A 4J7GA 5DEQA 5ISYA 1Q33A 1G0SA 2GB5A 1NQZA 2A8TA 2W4EA 3FFUA 4NFWA 2YVOA 1VRLA 4YPHA 3MDIA 1MQEA 1IRYA 4YOQA 5CFJA 2KDVA 4IJXA 3BHOA 1OW2A 1X84A 3X0NA 3ZR1A 3GZ6A 1PPVA 3X0KA 1F3YA 1JRKA 3GZ8A 3G0QA 1RRQA 1PPWA 1PVFA 1SOIA 1V8SA 1VIQA 2A8RA 2QJTA 3ACAA 1MK1A 1NQYA 3E57A 3X0MA 1U20A 1Q27A 1SZ3A 1MQWA 1V8MA 3SHDA 1SU2A 2G74A 1KT9A 2VNQA 3EESA 3DUPA 5ANSA 3WHWA 3GWYA 2YVNA 4ZG0A 2DSDA 2J8QA 1TUMA 2GT2A 2XSQA 5GHPA 5CFIA 4J7HA 5FSNA 5C7QA 5HZXA 3FCMA 5IW4A 4JZVA 3MCFA 3Q4IA 5BONA 2FKBA 3H95A 1HZTA 3Q1PA 2A8QA 3N77A 5BS6A 4S2VA 3DKUA 4HVYA 5DPKA 1V8UA 1V8TA 1V8VA 2DSBA 2FMLA
chains in the Genus database with same CATH topology
2AZWA 3ID9A 1RRSA 2A8SA 2QJOA 2PQVA 2RRKA 1X83A 2O5FA 2O5WA 2R5WA 1PUQA 2JVBA 1MUTA 2YVPA 3AC9A 3F6AA 3KVHA 3OGAA 4KYXA 4KTBA 1V8NA 5FSKA 5GHIA 4S2XA 3O6ZA 4ICKA 5GHMA 2FVVA 2KDWA 2YYHA 3A6VA 5ANVA 3BAPA 1Q54A 4C9WA 3SONA 2B0VA 1K26A 1XSCA 2DUKA 3COUA 3HYQA 5FSOA 5GHNA 5LPGA 3CNGA 3O69A 1VCDA 1JKNA 3MGMA 3A6TA 1PUNA 4V14A 3A6SA 1GA7A 3I7UA 4JZUA 5FSLA 1XSAA 4DYWA 1MR2A 3HHJA 4MPOA 3X0IA 3X0OA 3BM4A 1X51A 1XSBA 4S2WA 3N9UA 1VC8A 1G9QA 5C7TA 3L85A 4N1UA 4C9XA 4ILQA 1KTGA 3GRNA 3GG6A 1V8WA 3O52A 3I7VA 3F13A 1NFZA 3Q2SA 2B06A 2ICKA 2QKMB 4KG3A 4N1TA 2CZRA 3MDGA 2GT4A 4HFQA 4K6EA 3U53A 2CL3A 5GHQA 3QSJA 1V8YA 3X0PA 2DHOA 3O8SA 1PPXA 1KHZA 3Q2TA 5GHJA 5GHOA 1VHGA 3GZ5A 3O61A 3I9XA 3X0QA 4YPRA 3X0SA 1MP2A 1QVJA 1SJYA 2ICJA 5DDGA 2I8UA 3FK9A 5I8UA 4NFXA 2G73A 3EEUA 3R03A 5C8LA 3X0RA 5IW5A 3Q93A 5ANUA 4S2YA 2VNPA 1NFSA 2PNYA 3A6UA 2YVMA 1VHZA 2I6KA 1V8LA 2DSCA 3ZR0A 1I9AA 4KG4A 3FJYA 1VIUA 3P5TA 1VK6A 1HX3A 3J7Ye 4JZTA 1K2EA 1R67A 2O1CA 5FSIA 1RYAA 5ANWA 3SMDA 2A6TA 5DD4A 5FSMA 1VC9A 3P6YA 1V8IA 3Q91A 3EF5A 2A8PA 1V8RA 4JZSA 3X0JA 1PUSA 2I8TA 3FSPA 2B2KA 2Q9PA 3EXQA 5ANTA 3X0LA 3RH7A 4J7GA 5DEQA 5ISYA 1Q33A 1G0SA 2GB5A 1NQZA 2A8TA 2W4EA 3FFUA 4NFWA 2YVOA 1VRLA 4YPHA 3MDIA 1MQEA 1IRYA 4YOQA 5CFJA 2KDVA 4IJXA 3BHOA 1OW2A 1X84A 3X0NA 3ZR1A 3GZ6A 1PPVA 3X0KA 1F3YA 1JRKA 3GZ8A 3G0QA 1RRQA 1PPWA 1PVFA 1SOIA 1V8SA 1VIQA 2A8RA 2QJTA 3ACAA 1MK1A 1NQYA 3E57A 3X0MA 1U20A 1Q27A 1SZ3A 1MQWA 1V8MA 3SHDA 1SU2A 2G74A 1KT9A 2VNQA 3EESA 3DUPA 5ANSA 3WHWA 3GWYA 2YVNA 4ZG0A 2DSDA 2J8QA 1TUMA 2GT2A 2XSQA 5GHPA 5CFIA 4J7HA 5FSNA 5C7QA 5HZXA 3FCMA 5IW4A 4JZVA 3MCFA 3Q4IA 5BONA 2FKBA 3H95A 1HZTA 3Q1PA 2A8QA 3N77A 5BS6A 4S2VA 3DKUA 4HVYA 5DPKA 1V8UA 1V8TA 1V8VA 2DSBA 2FMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZW A;  3ID9 A;  1RRS A;  2A8S A;  2QJO A;  2PQV A;  2RRK A;  1X83 A;  2O5F A;  2O5W A;  2R5W A;  1PUQ A;  2JVB A;  1MUT A;  2YVP A;  3AC9 A;  3F6A A;  3KVH A;  3OGA A;  4KYX A;  4KTB A;  1V8N A;  5FSK A;  5GHI A;  4S2X A;  3O6Z A;  4ICK A;  5GHM A;  2FVV A;  2KDW A;  2YYH A;  3A6V A;  5ANV A;  3BAP A;  1Q54 A;  4C9W A;  3SON A;  2B0V A;  1K26 A;  1XSC A;  2DUK A;  3COU A;  3HYQ A;  5FSO A;  5GHN A;  5LPG A;  3CNG A;  3O69 A;  1VCD A;  1JKN A;  3MGM A;  3A6T A;  1PUN A;  4V14 A;  3A6S A;  1GA7 A;  3I7U A;  4JZU A;  5FSL A;  1XSA A;  4DYW A;  1MR2 A;  3HHJ A;  4MPO A;  3X0I A;  3X0O A;  3BM4 A;  1X51 A;  1XSB A;  4S2W A;  3N9U A;  1VC8 A;  1G9Q A;  5C7T A;  3L85 A;  4N1U A;  4C9X A;  4ILQ A;  1KTG A;  3GRN A;  3GG6 A;  1V8W A;  3O52 A;  3I7V A;  3F13 A;  1NFZ A;  3Q2S A;  2B06 A;  2ICK A;  2QKM B;  4KG3 A;  4N1T A;  3MDG A;  2GT4 A;  4HFQ A;  4K6E A;  3U53 A;  2CL3 A;  5GHQ A;  3QSJ A;  1V8Y A;  3X0P A;  2DHO A;  3O8S A;  1PPX A;  1KHZ A;  3Q2T A;  5GHJ A;  5GHO A;  1VHG A;  3GZ5 A;  3O61 A;  3I9X A;  3X0Q A;  4YPR A;  3X0S A;  1MP2 A;  1QVJ A;  1SJY A;  2ICJ A;  5DDG A;  2I8U A;  3FK9 A;  5I8U A;  4NFX A;  2G73 A;  3EEU A;  3R03 A;  5C8L A;  3X0R A;  5IW5 A;  3Q93 A;  5ANU A;  4S2Y A;  2VNP A;  1NFS A;  2PNY A;  3A6U A;  2YVM A;  1VHZ A;  2I6K A;  1V8L A;  2DSC A;  3ZR0 A;  1I9A A;  4KG4 A;  3FJY A;  1VIU A;  3P5T A;  1VK6 A;  1HX3 A;  3J7Y e;  4JZT A;  1K2E A;  1R67 A;  2O1C A;  5FSI A;  1RYA A;  5ANW A;  3SMD A;  2A6T A;  5DD4 A;  5FSM A;  1VC9 A;  3P6Y A;  1V8I A;  3Q91 A;  3EF5 A;  2A8P A;  1V8R A;  4JZS A;  3X0J A;  1PUS A;  2I8T A;  3FSP A;  2B2K A;  2Q9P A;  3EXQ A;  5ANT A;  3X0L A;  3RH7 A;  5DEQ A;  5ISY A;  1Q33 A;  1G0S A;  2GB5 A;  1NQZ A;  2A8T A;  2W4E A;  3FFU A;  4NFW A;  2YVO A;  1VRL A;  4YPH A;  3MDI A;  1MQE A;  1IRY A;  4YOQ A;  5CFJ A;  2KDV A;  4IJX A;  3BHO A;  1OW2 A;  1X84 A;  3X0N A;  3ZR1 A;  3GZ6 A;  1PPV A;  3X0K A;  1F3Y A;  1JRK A;  3GZ8 A;  3G0Q A;  1RRQ A;  1PPW A;  1PVF A;  1SOI A;  1V8S A;  1VIQ A;  2A8R A;  2QJT A;  3ACA A;  1MK1 A;  1NQY A;  3E57 A;  3X0M A;  1U20 A;  1Q27 A;  1SZ3 A;  1MQW A;  1V8M A;  3SHD A;  1SU2 A;  2G74 A;  1KT9 A;  2VNQ A;  3EES A;  3DUP A;  5ANS A;  3WHW A;  3GWY A;  2YVN A;  4ZG0 A;  2DSD A;  2J8Q A;  1TUM A;  2GT2 A;  2XSQ A;  5GHP A;  5CFI A;  5FSN A;  5C7Q A;  5HZX A;  3FCM A;  5IW4 A;  4JZV A;  3MCF A;  3Q4I A;  5BON A;  2FKB A;  3H95 A;  1HZT A;  3Q1P A;  2A8Q A;  3N77 A;  5BS6 A;  4S2V A;  3DKU A;  4HVY A;  5DPK A;  1V8U A;  1V8T A;  1V8V A;  2DSB A;  2FML A; 
#chains in the Genus database with same CATH topology
 2AZW A;  3ID9 A;  1RRS A;  2A8S A;  2QJO A;  2PQV A;  2RRK A;  1X83 A;  2O5F A;  2O5W A;  2R5W A;  1PUQ A;  2JVB A;  1MUT A;  2YVP A;  3AC9 A;  3F6A A;  3KVH A;  3OGA A;  4KYX A;  4KTB A;  1V8N A;  5FSK A;  5GHI A;  4S2X A;  3O6Z A;  4ICK A;  5GHM A;  2FVV A;  2KDW A;  2YYH A;  3A6V A;  5ANV A;  3BAP A;  1Q54 A;  4C9W A;  3SON A;  2B0V A;  1K26 A;  1XSC A;  2DUK A;  3COU A;  3HYQ A;  5FSO A;  5GHN A;  5LPG A;  3CNG A;  3O69 A;  1VCD A;  1JKN A;  3MGM A;  3A6T A;  1PUN A;  4V14 A;  3A6S A;  1GA7 A;  3I7U A;  4JZU A;  5FSL A;  1XSA A;  4DYW A;  1MR2 A;  3HHJ A;  4MPO A;  3X0I A;  3X0O A;  3BM4 A;  1X51 A;  1XSB A;  4S2W A;  3N9U A;  1VC8 A;  1G9Q A;  5C7T A;  3L85 A;  4N1U A;  4C9X A;  4ILQ A;  1KTG A;  3GRN A;  3GG6 A;  1V8W A;  3O52 A;  3I7V A;  3F13 A;  1NFZ A;  3Q2S A;  2B06 A;  2ICK A;  2QKM B;  4KG3 A;  4N1T A;  2CZR A;  3MDG A;  2GT4 A;  4HFQ A;  4K6E A;  3U53 A;  2CL3 A;  5GHQ A;  3QSJ A;  1V8Y A;  3X0P A;  2DHO A;  3O8S A;  1PPX A;  1KHZ A;  3Q2T A;  5GHJ A;  5GHO A;  1VHG A;  3GZ5 A;  3O61 A;  3I9X A;  3X0Q A;  4YPR A;  3X0S A;  1MP2 A;  1QVJ A;  1SJY A;  2ICJ A;  5DDG A;  2I8U A;  3FK9 A;  5I8U A;  4NFX A;  2G73 A;  3EEU A;  3R03 A;  5C8L A;  3X0R A;  5IW5 A;  3Q93 A;  5ANU A;  4S2Y A;  2VNP A;  1NFS A;  2PNY A;  3A6U A;  2YVM A;  1VHZ A;  2I6K A;  1V8L A;  2DSC A;  3ZR0 A;  1I9A A;  4KG4 A;  3FJY A;  1VIU A;  3P5T A;  1VK6 A;  1HX3 A;  3J7Y e;  4JZT A;  1K2E A;  1R67 A;  2O1C A;  5FSI A;  1RYA A;  5ANW A;  3SMD A;  2A6T A;  5DD4 A;  5FSM A;  1VC9 A;  3P6Y A;  1V8I A;  3Q91 A;  3EF5 A;  2A8P A;  1V8R A;  4JZS A;  3X0J A;  1PUS A;  2I8T A;  3FSP A;  2B2K A;  2Q9P A;  3EXQ A;  5ANT A;  3X0L A;  3RH7 A;  4J7G A;  5DEQ A;  5ISY A;  1Q33 A;  1G0S A;  2GB5 A;  1NQZ A;  2A8T A;  2W4E A;  3FFU A;  4NFW A;  2YVO A;  1VRL A;  4YPH A;  3MDI A;  1MQE A;  1IRY A;  4YOQ A;  5CFJ A;  2KDV A;  4IJX A;  3BHO A;  1OW2 A;  1X84 A;  3X0N A;  3ZR1 A;  3GZ6 A;  1PPV A;  3X0K A;  1F3Y A;  1JRK A;  3GZ8 A;  3G0Q A;  1RRQ A;  1PPW A;  1PVF A;  1SOI A;  1V8S A;  1VIQ A;  2A8R A;  2QJT A;  3ACA A;  1MK1 A;  1NQY A;  3E57 A;  3X0M A;  1U20 A;  1Q27 A;  1SZ3 A;  1MQW A;  1V8M A;  3SHD A;  1SU2 A;  2G74 A;  1KT9 A;  2VNQ A;  3EES A;  3DUP A;  5ANS A;  3WHW A;  3GWY A;  2YVN A;  4ZG0 A;  2DSD A;  2J8Q A;  1TUM A;  2GT2 A;  2XSQ A;  5GHP A;  5CFI A;  4J7H A;  5FSN A;  5C7Q A;  5HZX A;  3FCM A;  5IW4 A;  4JZV A;  3MCF A;  3Q4I A;  5BON A;  2FKB A;  3H95 A;  1HZT A;  3Q1P A;  2A8Q A;  3N77 A;  5BS6 A;  4S2V A;  3DKU A;  4HVY A;  5DPK A;  1V8U A;  1V8T A;  1V8V A;  2DSB A;  2FML A; 
#chains in the Genus database with same CATH homology
 2AZW A;  3ID9 A;  1RRS A;  2A8S A;  2QJO A;  2PQV A;  2RRK A;  1X83 A;  2O5F A;  2O5W A;  2R5W A;  1PUQ A;  2JVB A;  1MUT A;  2YVP A;  3AC9 A;  3F6A A;  3KVH A;  3OGA A;  4KYX A;  4KTB A;  1V8N A;  5FSK A;  5GHI A;  4S2X A;  3O6Z A;  4ICK A;  5GHM A;  2FVV A;  2KDW A;  2YYH A;  3A6V A;  5ANV A;  3BAP A;  1Q54 A;  4C9W A;  3SON A;  2B0V A;  1K26 A;  1XSC A;  2DUK A;  3COU A;  3HYQ A;  5FSO A;  5GHN A;  5LPG A;  3CNG A;  3O69 A;  1VCD A;  1JKN A;  3MGM A;  3A6T A;  1PUN A;  4V14 A;  3A6S A;  1GA7 A;  3I7U A;  4JZU A;  5FSL A;  1XSA A;  4DYW A;  1MR2 A;  3HHJ A;  4MPO A;  3X0I A;  3X0O A;  3BM4 A;  1X51 A;  1XSB A;  4S2W A;  3N9U A;  1VC8 A;  1G9Q A;  5C7T A;  3L85 A;  4N1U A;  4C9X A;  4ILQ A;  1KTG A;  3GRN A;  3GG6 A;  1V8W A;  3O52 A;  3I7V A;  3F13 A;  1NFZ A;  3Q2S A;  2B06 A;  2ICK A;  2QKM B;  4KG3 A;  4N1T A;  2CZR A;  3MDG A;  2GT4 A;  4HFQ A;  4K6E A;  3U53 A;  2CL3 A;  5GHQ A;  3QSJ A;  1V8Y A;  3X0P A;  2DHO A;  3O8S A;  1PPX A;  1KHZ A;  3Q2T A;  5GHJ A;  5GHO A;  1VHG A;  3GZ5 A;  3O61 A;  3I9X A;  3X0Q A;  4YPR A;  3X0S A;  1MP2 A;  1QVJ A;  1SJY A;  2ICJ A;  5DDG A;  2I8U A;  3FK9 A;  5I8U A;  4NFX A;  2G73 A;  3EEU A;  3R03 A;  5C8L A;  3X0R A;  5IW5 A;  3Q93 A;  5ANU A;  4S2Y A;  2VNP A;  1NFS A;  2PNY A;  3A6U A;  2YVM A;  1VHZ A;  2I6K A;  1V8L A;  2DSC A;  3ZR0 A;  1I9A A;  4KG4 A;  3FJY A;  1VIU A;  3P5T A;  1VK6 A;  1HX3 A;  3J7Y e;  4JZT A;  1K2E A;  1R67 A;  2O1C A;  5FSI A;  1RYA A;  5ANW A;  3SMD A;  2A6T A;  5DD4 A;  5FSM A;  1VC9 A;  3P6Y A;  1V8I A;  3Q91 A;  3EF5 A;  2A8P A;  1V8R A;  4JZS A;  3X0J A;  1PUS A;  2I8T A;  3FSP A;  2B2K A;  2Q9P A;  3EXQ A;  5ANT A;  3X0L A;  3RH7 A;  4J7G A;  5DEQ A;  5ISY A;  1Q33 A;  1G0S A;  2GB5 A;  1NQZ A;  2A8T A;  2W4E A;  3FFU A;  4NFW A;  2YVO A;  1VRL A;  4YPH A;  3MDI A;  1MQE A;  1IRY A;  4YOQ A;  5CFJ A;  2KDV A;  4IJX A;  3BHO A;  1OW2 A;  1X84 A;  3X0N A;  3ZR1 A;  3GZ6 A;  1PPV A;  3X0K A;  1F3Y A;  1JRK A;  3GZ8 A;  3G0Q A;  1RRQ A;  1PPW A;  1PVF A;  1SOI A;  1V8S A;  1VIQ A;  2A8R A;  2QJT A;  3ACA A;  1MK1 A;  1NQY A;  3E57 A;  3X0M A;  1U20 A;  1Q27 A;  1SZ3 A;  1MQW A;  1V8M A;  3SHD A;  1SU2 A;  2G74 A;  1KT9 A;  2VNQ A;  3EES A;  3DUP A;  5ANS A;  3WHW A;  3GWY A;  2YVN A;  4ZG0 A;  2DSD A;  2J8Q A;  1TUM A;  2GT2 A;  2XSQ A;  5GHP A;  5CFI A;  4J7H A;  5FSN A;  5C7Q A;  5HZX A;  3FCM A;  5IW4 A;  4JZV A;  3MCF A;  3Q4I A;  5BON A;  2FKB A;  3H95 A;  1HZT A;  3Q1P A;  2A8Q A;  3N77 A;  5BS6 A;  4S2V A;  3DKU A;  4HVY A;  5DPK A;  1V8U A;  1V8T A;  1V8V A;  2DSB A;  2FML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...