1TXZA

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp-ribose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of ADP-ribose-1''-monophosphatase (Appr-1''-pase), a ubiquitous cellular processing enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
total genus 76
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1txzA00
3GPOA 4TU0A 3KQXA 5FSVA 3VFQA 4JGKA 1HJZA 1BPMA 3Q6ZA 4ESSA 4ETJA 4ZYQA 4ZI6A 4R76A 1LAPA 2VRIA 1LAMA 4X2TA 3GQEA 5D8NA 4D86A 3EWPA 4GVVA 4JLLA 3KR4A 5E3BA 1TY8A 3IIFA 3PEIA 1ZR3A 2LGRA 2FAVA 1GYTA 4ABKA 3JRUA 4ZY0A 3SIIA 4ZX9A 1BLLE 1VHUA 4ZX8A 5CBMA 2AFCA 3V45A 4R6TA 5FSXA 3H8EA 3JZTA 5HOLA 3GPQA 3V2BA 4R7MA 3EJFA 3EKEA 5FSZA 1BPNA 3KZWA 4KSIA 4GUAA 3EWRA 2DX6A 3KQZA 1SPVA 4IQYA 4ABLA 5CMSA 1ZR5A 3GPGA 2EEEA 3SIHA 3Q71A 1NJRA 3EJGA 5CB3A 2EWBA 4ZY2A 4ETKA 5HIHA 3GQOA 4J5SA 3ETIA 1TXZA 3H8GA 4K3NA 2ACFA 5FSYA 4ZY1A 5AILA 5DUSA 4J5RA 2FG1A 4KYBA 3IJ3A 4J4ZA 5FSUA 2XD7A 3IIDA 2BFRA 3SIGA 4GVWA 4JCAA 5CB5A 1YD9A 3EWOA 1LANA 3H8FA 2J9AA 3T8WA 4J5QA 2FXKA 3EWQA 2BFQA 2X47A 4K0CA 3SIJA 4UMLA 2L8RA 3EW5A 3KR5A 1LCPA 4JVVA
chains in the Genus database with same CATH superfamily
3GPOA 4TU0A 3KQXA 5FSVA 3VFQA 4JGKA 1HJZA 1BPMA 3Q6ZA 4ESSA 4ETJA 4ZYQA 4ZI6A 4R76A 1LAPA 2VRIA 1LAMA 4X2TA 3GQEA 5D8NA 4D86A 3EWPA 4GVVA 4JLLA 3KR4A 5E3BA 1TY8A 3IIFA 3PEIA 1ZR3A 2LGRA 2FAVA 1GYTA 4ABKA 3JRUA 2JZDA 4ZY0A 3SIIA 4ZX9A 1BLLE 1VHUA 4ZX8A 5CBMA 2AFCA 3V45A 4R6TA 5FSXA 3H8EA 3JZTA 5HOLA 3GPQA 3V2BA 2JZFA 4R7MA 3EJFA 3EKEA 5FSZA 1BPNA 3KZWA 4KSIA 4GUAA 3EWRA 2DX6A 3KQZA 1SPVA 4IQYA 4ABLA 5CMSA 1ZR5A 3GPGA 2EEEA 3SIHA 3Q71A 1NJRA 2KQVA 3EJGA 5CB3A 2EWBA 4ZY2A 4ETKA 5HIHA 3GQOA 4J5SA 3ETIA 1TXZA 3H8GA 4K3NA 2ACFA 5FSYA 4ZY1A 5AILA 5DUSA 4J5RA 2FG1A 4KYBA 2RNKA 3IJ3A 4J4ZA 5FSUA 2XD7A 3IIDA 2JZEA 2BFRA 3SIGA 2W2GA 4GVWA 4JCAA 5CB5A 1YD9A 3EWOA 1LANA 3H8FA 2WCTA 2J9AA 3T8WA 4J5QA 2FXKA 3EWQA 2BFQA 2X47A 4K0CA 3SIJA 4UMLA 2L8RA 3EW5A 3KR5A 1LCPA 4JVVA
chains in the Genus database with same CATH topology
3GPOA 4TU0A 3KQXA 5FSVA 3VFQA 4JGKA 1HJZA 1BPMA 3Q6ZA 4ESSA 4ETJA 4ZYQA 4ZI6A 4R76A 1LAPA 2VRIA 1LAMA 4X2TA 3GQEA 5D8NA 4D86A 3EWPA 4GVVA 4JLLA 3KR4A 5E3BA 1TY8A 3IIFA 3PEIA 1ZR3A 2LGRA 2FAVA 1GYTA 4ABKA 3JRUA 4ZY0A 3SIIA 4ZX9A 1BLLE 1VHUA 4ZX8A 5CBMA 2AFCA 3V45A 4R6TA 5FSXA 3H8EA 3JZTA 5HOLA 3GPQA 3V2BA 4R7MA 3EJFA 3EKEA 5FSZA 1BPNA 3KZWA 4KSIA 4GUAA 3EWRA 2DX6A 3KQZA 1SPVA 4IQYA 4ABLA 5CMSA 1ZR5A 3GPGA 2EEEA 3SIHA 3Q71A 1NJRA 3EJGA 5CB3A 2EWBA 4ZY2A 4ETKA 5HIHA 3GQOA 4J5SA 3ETIA 1TXZA 3H8GA 4K3NA 2ACFA 5FSYA 4ZY1A 5AILA 5DUSA 4J5RA 2FG1A 4KYBA 3IJ3A 4J4ZA 5FSUA 2XD7A 3IIDA 2BFRA 3SIGA 4GVWA 4JCAA 5CB5A 1YD9A 3EWOA 1LANA 3H8FA 2J9AA 3T8WA 4J5QA 2FXKA 3EWQA 2BFQA 2X47A 4K0CA 3SIJA 4UMLA 2L8RA 3EW5A 3KR5A 1LCPA 4JVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPO A;  4TU0 A;  3KQX A;  5FSV A;  3VFQ A;  4JGK A;  1HJZ A;  1BPM A;  3Q6Z A;  4ESS A;  4ETJ A;  4ZYQ A;  4ZI6 A;  4R76 A;  1LAP A;  2VRI A;  1LAM A;  4X2T A;  3GQE A;  5D8N A;  4D86 A;  3EWP A;  4GVV A;  4JLL A;  3KR4 A;  5E3B A;  1TY8 A;  3IIF A;  3PEI A;  1ZR3 A;  2LGR A;  2FAV A;  1GYT A;  4ABK A;  3JRU A;  4ZY0 A;  3SII A;  4ZX9 A;  1BLL E;  1VHU A;  4ZX8 A;  5CBM A;  2AFC A;  3V45 A;  4R6T A;  5FSX A;  3H8E A;  3JZT A;  5HOL A;  3GPQ A;  3V2B A;  4R7M A;  3EJF A;  3EKE A;  5FSZ A;  1BPN A;  3KZW A;  4KSI A;  4GUA A;  3EWR A;  2DX6 A;  3KQZ A;  1SPV A;  4IQY A;  4ABL A;  5CMS A;  1ZR5 A;  3GPG A;  2EEE A;  3SIH A;  3Q71 A;  1NJR A;  3EJG A;  5CB3 A;  2EWB A;  4ZY2 A;  4ETK A;  5HIH A;  3GQO A;  4J5S A;  3ETI A;  1TXZ A;  3H8G A;  4K3N A;  2ACF A;  5FSY A;  4ZY1 A;  5AIL A;  5DUS A;  4J5R A;  2FG1 A;  4KYB A;  3IJ3 A;  4J4Z A;  5FSU A;  2XD7 A;  3IID A;  2BFR A;  3SIG A;  4GVW A;  4JCA A;  5CB5 A;  1YD9 A;  3EWO A;  1LAN A;  3H8F A;  2J9A A;  3T8W A;  4J5Q A;  2FXK A;  3EWQ A;  2BFQ A;  2X47 A;  4K0C A;  3SIJ A;  4UML A;  2L8R A;  3EW5 A;  3KR5 A;  1LCP A;  4JVV A; 
#chains in the Genus database with same CATH topology
 3GPO A;  4TU0 A;  3KQX A;  5FSV A;  3VFQ A;  4JGK A;  1HJZ A;  1BPM A;  3Q6Z A;  4ESS A;  4ETJ A;  4ZYQ A;  4ZI6 A;  4R76 A;  1LAP A;  2VRI A;  1LAM A;  4X2T A;  3GQE A;  5D8N A;  4D86 A;  3EWP A;  4GVV A;  4JLL A;  3KR4 A;  5E3B A;  1TY8 A;  3IIF A;  3PEI A;  1ZR3 A;  2LGR A;  2FAV A;  1GYT A;  4ABK A;  3JRU A;  2JZD A;  4ZY0 A;  3SII A;  4ZX9 A;  1BLL E;  1VHU A;  4ZX8 A;  5CBM A;  2AFC A;  3V45 A;  4R6T A;  5FSX A;  3H8E A;  3JZT A;  5HOL A;  3GPQ A;  3V2B A;  2JZF A;  4R7M A;  3EJF A;  3EKE A;  5FSZ A;  1BPN A;  3KZW A;  4KSI A;  4GUA A;  3EWR A;  2DX6 A;  3KQZ A;  1SPV A;  4IQY A;  4ABL A;  5CMS A;  1ZR5 A;  3GPG A;  2EEE A;  3SIH A;  3Q71 A;  1NJR A;  2KQV A;  3EJG A;  5CB3 A;  2EWB A;  4ZY2 A;  4ETK A;  5HIH A;  3GQO A;  4J5S A;  3ETI A;  1TXZ A;  3H8G A;  4K3N A;  2ACF A;  5FSY A;  4ZY1 A;  5AIL A;  5DUS A;  4J5R A;  2FG1 A;  4KYB A;  2RNK A;  3IJ3 A;  4J4Z A;  5FSU A;  2XD7 A;  3IID A;  2JZE A;  2BFR A;  3SIG A;  2W2G A;  4GVW A;  4JCA A;  5CB5 A;  1YD9 A;  3EWO A;  1LAN A;  3H8F A;  2WCT A;  2J9A A;  3T8W A;  4J5Q A;  2FXK A;  3EWQ A;  2BFQ A;  2X47 A;  4K0C A;  3SIJ A;  4UML A;  2L8R A;  3EW5 A;  3KR5 A;  1LCP A;  4JVV A; 
#chains in the Genus database with same CATH homology
 3GPO A;  4TU0 A;  3KQX A;  5FSV A;  3VFQ A;  4JGK A;  1HJZ A;  1BPM A;  3Q6Z A;  4ESS A;  4ETJ A;  4ZYQ A;  4ZI6 A;  4R76 A;  1LAP A;  2VRI A;  1LAM A;  4X2T A;  3GQE A;  5D8N A;  4D86 A;  3EWP A;  4GVV A;  4JLL A;  3KR4 A;  5E3B A;  1TY8 A;  3IIF A;  3PEI A;  1ZR3 A;  2LGR A;  2FAV A;  1GYT A;  4ABK A;  3JRU A;  4ZY0 A;  3SII A;  4ZX9 A;  1BLL E;  1VHU A;  4ZX8 A;  5CBM A;  2AFC A;  3V45 A;  4R6T A;  5FSX A;  3H8E A;  3JZT A;  5HOL A;  3GPQ A;  3V2B A;  4R7M A;  3EJF A;  3EKE A;  5FSZ A;  1BPN A;  3KZW A;  4KSI A;  4GUA A;  3EWR A;  2DX6 A;  3KQZ A;  1SPV A;  4IQY A;  4ABL A;  5CMS A;  1ZR5 A;  3GPG A;  2EEE A;  3SIH A;  3Q71 A;  1NJR A;  3EJG A;  5CB3 A;  2EWB A;  4ZY2 A;  4ETK A;  5HIH A;  3GQO A;  4J5S A;  3ETI A;  1TXZ A;  3H8G A;  4K3N A;  2ACF A;  5FSY A;  4ZY1 A;  5AIL A;  5DUS A;  4J5R A;  2FG1 A;  4KYB A;  3IJ3 A;  4J4Z A;  5FSU A;  2XD7 A;  3IID A;  2BFR A;  3SIG A;  4GVW A;  4JCA A;  5CB5 A;  1YD9 A;  3EWO A;  1LAN A;  3H8F A;  2J9A A;  3T8W A;  4J5Q A;  2FXK A;  3EWQ A;  2BFQ A;  2X47 A;  4K0C A;  3SIJ A;  4UML A;  2L8R A;  3EW5 A;  3KR5 A;  1LCP A;  4JVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...