1TXZA

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp-ribose
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of ADP-ribose-1''-monophosphatase (Appr-1''-pase), a ubiquitous cellular processing enzyme.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
total genus 76
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1txzA00
5FSYA 3JRUA 3V45A 4ZY1A 1TXZA 3VFQA 4ABKA 4KYBA 5E3BA 5CB5A 4TU0A 5HOLA 3IIDA 4J4ZA 5HIHA 2L8RA 3EJGA 3EKEA 3H8GA 4GUAA 3SIHA 2AFCA 1LAPA 4J5SA 3KR5A 3SIIA 1BPMA 3JZTA 3KZWA 2EEEA 3Q71A 4ZY2A 5FSZA 2J9AA 3EWQA 2ACFA 3PEIA 3SIJA 4ETKA 4X2TA 4K0CA 4R76A 3Q6ZA 1SPVA 2LGRA 1BPNA 4ZY0A 1LANA 4J5RA 1GYTA 3V2BA 4UMLA 4GVWA 2EWBA 4JLLA 5FSUA 4ESSA 2X47A 3KQXA 4IQYA 1HJZA 1YD9A 3GPQA 4ZX8A 3IJ3A 5CB3A 3GPOA 2XD7A 3H8EA 3EW5A 5CBMA 2FXKA 4ZX9A 4ABLA 3ETIA 1LAMA 2FAVA 4K3NA 4JCAA 4ZI6A 2BFQA 1NJRA 1ZR5A 5D8NA 4GVVA 3SIGA 5CMSA 3GPGA 4ETJA 3IIFA 5FSVA 1ZR3A 1LCPA 4D86A 4JGKA 3EWRA 2DX6A 4J5QA 1VHUA 1BLLE 4KSIA 3KQZA 2BFRA 3GQOA 3H8FA 5FSXA 4R7MA 4ZYQA 4JVVA 3EWOA 5AILA 3GQEA 2FG1A 2VRIA 3EJFA 1TY8A 3EWPA 5DUSA 3T8WA 3KR4A 4R6TA
chains in the Genus database with same CATH superfamily
5FSYA 3JRUA 3V45A 4ZY1A 1TXZA 3VFQA 4ABKA 4KYBA 5E3BA 5CB5A 4TU0A 5HOLA 3IIDA 4J4ZA 5HIHA 2KQVA 2L8RA 3EJGA 3EKEA 3H8GA 4GUAA 3SIHA 2AFCA 1LAPA 4J5SA 2W2GA 3KR5A 3SIIA 1BPMA 3JZTA 3KZWA 2EEEA 3Q71A 4ZY2A 5FSZA 2J9AA 3EWQA 2ACFA 2JZEA 3PEIA 3SIJA 4ETKA 4X2TA 2RNKA 4K0CA 4R76A 3Q6ZA 1SPVA 2LGRA 1BPNA 4ZY0A 1LANA 4J5RA 2JZFA 1GYTA 3V2BA 2WCTA 4UMLA 4GVWA 2EWBA 4JLLA 5FSUA 4ESSA 2X47A 3KQXA 4IQYA 1HJZA 1YD9A 3GPQA 4ZX8A 3IJ3A 5CB3A 3GPOA 2XD7A 2JZDA 3H8EA 3EW5A 5CBMA 2FXKA 4ZX9A 4ABLA 3ETIA 1LAMA 2FAVA 4K3NA 4JCAA 4ZI6A 2BFQA 1NJRA 1ZR5A 5D8NA 4GVVA 3SIGA 5CMSA 3GPGA 4ETJA 3IIFA 5FSVA 1ZR3A 1LCPA 4D86A 4JGKA 3EWRA 2DX6A 4J5QA 1VHUA 1BLLE 4KSIA 3KQZA 2BFRA 3GQOA 3H8FA 5FSXA 4R7MA 4ZYQA 4JVVA 3EWOA 3GQEA 5AILA 2FG1A 2VRIA 3EJFA 1TY8A 3EWPA 5DUSA 3T8WA 3KR4A 4R6TA
chains in the Genus database with same CATH topology
5FSYA 3JRUA 3V45A 4ZY1A 1TXZA 3VFQA 4ABKA 4KYBA 5E3BA 5CB5A 4TU0A 5HOLA 3IIDA 4J4ZA 5HIHA 2L8RA 3EJGA 3EKEA 3H8GA 4GUAA 3SIHA 2AFCA 1LAPA 4J5SA 3KR5A 3SIIA 1BPMA 3JZTA 3KZWA 2EEEA 3Q71A 4ZY2A 5FSZA 2J9AA 3EWQA 2ACFA 3PEIA 3SIJA 4ETKA 4X2TA 4K0CA 4R76A 3Q6ZA 1SPVA 2LGRA 1BPNA 4ZY0A 1LANA 4J5RA 1GYTA 3V2BA 4UMLA 4GVWA 2EWBA 4JLLA 5FSUA 4ESSA 2X47A 3KQXA 4IQYA 1HJZA 1YD9A 3GPQA 4ZX8A 3IJ3A 5CB3A 3GPOA 2XD7A 3H8EA 3EW5A 5CBMA 2FXKA 4ZX9A 4ABLA 3ETIA 1LAMA 2FAVA 4K3NA 4JCAA 4ZI6A 2BFQA 1NJRA 1ZR5A 5D8NA 4GVVA 3SIGA 5CMSA 3GPGA 4ETJA 3IIFA 5FSVA 1ZR3A 1LCPA 4D86A 4JGKA 3EWRA 2DX6A 4J5QA 1VHUA 1BLLE 4KSIA 3KQZA 2BFRA 3GQOA 3H8FA 5FSXA 4R7MA 4ZYQA 4JVVA 3EWOA 5AILA 3GQEA 2FG1A 2VRIA 3EJFA 1TY8A 3EWPA 5DUSA 3T8WA 3KR4A 4R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSY A;  3JRU A;  3V45 A;  4ZY1 A;  1TXZ A;  3VFQ A;  4ABK A;  4KYB A;  5E3B A;  5CB5 A;  4TU0 A;  5HOL A;  3IID A;  4J4Z A;  5HIH A;  2L8R A;  3EJG A;  3EKE A;  3H8G A;  4GUA A;  3SIH A;  2AFC A;  1LAP A;  4J5S A;  3KR5 A;  3SII A;  1BPM A;  3JZT A;  3KZW A;  2EEE A;  3Q71 A;  4ZY2 A;  5FSZ A;  2J9A A;  3EWQ A;  2ACF A;  3PEI A;  3SIJ A;  4ETK A;  4X2T A;  4K0C A;  4R76 A;  3Q6Z A;  1SPV A;  2LGR A;  1BPN A;  4ZY0 A;  1LAN A;  4J5R A;  1GYT A;  3V2B A;  4UML A;  4GVW A;  2EWB A;  4JLL A;  5FSU A;  4ESS A;  2X47 A;  3KQX A;  4IQY A;  1HJZ A;  1YD9 A;  3GPQ A;  4ZX8 A;  3IJ3 A;  5CB3 A;  3GPO A;  2XD7 A;  3H8E A;  3EW5 A;  5CBM A;  2FXK A;  4ZX9 A;  4ABL A;  3ETI A;  1LAM A;  2FAV A;  4K3N A;  4JCA A;  4ZI6 A;  2BFQ A;  1NJR A;  1ZR5 A;  5D8N A;  4GVV A;  3SIG A;  5CMS A;  3GPG A;  4ETJ A;  3IIF A;  5FSV A;  1ZR3 A;  1LCP A;  4D86 A;  4JGK A;  3EWR A;  2DX6 A;  4J5Q A;  1VHU A;  1BLL E;  4KSI A;  3KQZ A;  2BFR A;  3GQO A;  3H8F A;  5FSX A;  4R7M A;  4ZYQ A;  4JVV A;  3EWO A;  5AIL A;  3GQE A;  2FG1 A;  2VRI A;  3EJF A;  1TY8 A;  3EWP A;  5DUS A;  3T8W A;  3KR4 A;  4R6T A; 
#chains in the Genus database with same CATH topology
 5FSY A;  3JRU A;  3V45 A;  4ZY1 A;  1TXZ A;  3VFQ A;  4ABK A;  4KYB A;  5E3B A;  5CB5 A;  4TU0 A;  5HOL A;  3IID A;  4J4Z A;  5HIH A;  2KQV A;  2L8R A;  3EJG A;  3EKE A;  3H8G A;  4GUA A;  3SIH A;  2AFC A;  1LAP A;  4J5S A;  2W2G A;  3KR5 A;  3SII A;  1BPM A;  3JZT A;  3KZW A;  2EEE A;  3Q71 A;  4ZY2 A;  5FSZ A;  2J9A A;  3EWQ A;  2ACF A;  2JZE A;  3PEI A;  3SIJ A;  4ETK A;  4X2T A;  2RNK A;  4K0C A;  4R76 A;  3Q6Z A;  1SPV A;  2LGR A;  1BPN A;  4ZY0 A;  1LAN A;  4J5R A;  2JZF A;  1GYT A;  3V2B A;  2WCT A;  4UML A;  4GVW A;  2EWB A;  4JLL A;  5FSU A;  4ESS A;  2X47 A;  3KQX A;  4IQY A;  1HJZ A;  1YD9 A;  3GPQ A;  4ZX8 A;  3IJ3 A;  5CB3 A;  3GPO A;  2XD7 A;  2JZD A;  3H8E A;  3EW5 A;  5CBM A;  2FXK A;  4ZX9 A;  4ABL A;  3ETI A;  1LAM A;  2FAV A;  4K3N A;  4JCA A;  4ZI6 A;  2BFQ A;  1NJR A;  1ZR5 A;  5D8N A;  4GVV A;  3SIG A;  5CMS A;  3GPG A;  4ETJ A;  3IIF A;  5FSV A;  1ZR3 A;  1LCP A;  4D86 A;  4JGK A;  3EWR A;  2DX6 A;  4J5Q A;  1VHU A;  1BLL E;  4KSI A;  3KQZ A;  2BFR A;  3GQO A;  3H8F A;  5FSX A;  4R7M A;  4ZYQ A;  4JVV A;  3EWO A;  3GQE A;  5AIL A;  2FG1 A;  2VRI A;  3EJF A;  1TY8 A;  3EWP A;  5DUS A;  3T8W A;  3KR4 A;  4R6T A; 
#chains in the Genus database with same CATH homology
 5FSY A;  3JRU A;  3V45 A;  4ZY1 A;  1TXZ A;  3VFQ A;  4ABK A;  4KYB A;  5E3B A;  5CB5 A;  4TU0 A;  5HOL A;  3IID A;  4J4Z A;  5HIH A;  2L8R A;  3EJG A;  3EKE A;  3H8G A;  4GUA A;  3SIH A;  2AFC A;  1LAP A;  4J5S A;  3KR5 A;  3SII A;  1BPM A;  3JZT A;  3KZW A;  2EEE A;  3Q71 A;  4ZY2 A;  5FSZ A;  2J9A A;  3EWQ A;  2ACF A;  3PEI A;  3SIJ A;  4ETK A;  4X2T A;  4K0C A;  4R76 A;  3Q6Z A;  1SPV A;  2LGR A;  1BPN A;  4ZY0 A;  1LAN A;  4J5R A;  1GYT A;  3V2B A;  4UML A;  4GVW A;  2EWB A;  4JLL A;  5FSU A;  4ESS A;  2X47 A;  3KQX A;  4IQY A;  1HJZ A;  1YD9 A;  3GPQ A;  4ZX8 A;  3IJ3 A;  5CB3 A;  3GPO A;  2XD7 A;  3H8E A;  3EW5 A;  5CBM A;  2FXK A;  4ZX9 A;  4ABL A;  3ETI A;  1LAM A;  2FAV A;  4K3N A;  4JCA A;  4ZI6 A;  2BFQ A;  1NJR A;  1ZR5 A;  5D8N A;  4GVV A;  3SIG A;  5CMS A;  3GPG A;  4ETJ A;  3IIF A;  5FSV A;  1ZR3 A;  1LCP A;  4D86 A;  4JGK A;  3EWR A;  2DX6 A;  4J5Q A;  1VHU A;  1BLL E;  4KSI A;  3KQZ A;  2BFR A;  3GQO A;  3H8F A;  5FSX A;  4R7M A;  4ZYQ A;  4JVV A;  3EWO A;  5AIL A;  3GQE A;  2FG1 A;  2VRI A;  3EJF A;  1TY8 A;  3EWP A;  5DUS A;  3T8W A;  3KR4 A;  4R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...