3KR5A

Structure of a protease 4
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
total genus 181
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr5A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr5A02
4ESSA 3GQEA 3PFOA 4Z65A 2F8HA 2PJ3A 3PFEA 3SJXA 2QJ8A 4PPZA 2GU2A 5K8PA 2I3CA 2J9AA 3FF3A 5E3BA 3N5FA 4BD9A 3B3CA 5DUSA 4F9VA 3FEDA 3KZWA 4PQAA 3L2NA 2XEIA 5D8NA 5LYIA 3PB4X 1F2PA 3IEHA 4X2TA 4J5QA 3PB7X 4JVVA 4F8ZA 3MRUA 2PVVA 1XJOA 5DS0A 2BCOA 8CPAA 2PJCA 3S9MA 2C6PA 5ELYA 3GPGA 3IIBA 1TKFA 3SJGA 3NH5A 2AFMA 1R3NA 3WT4A 2XD7A 2OOTA 5FSVA 2IJZA 2CIJA 1ZR5A 1XRYA 3FMCA 4R7MA 1ARLA 1HDQA 4P4FA 1NSAA 5CPAA 2AFSA 4JZ0A 2RFHA 6CPAA 3B3SA 5K8OA 1LAMA 4GVWA 3B3VA 3PBBA 3SIHA 1Y7EA 2FAVA 4P6YA 4EFDA 4UMLA 5CB5A 1CBXA 3VATA 4WJBA 5LRGA 4MRIA 2PE3A 2IMOA 4JGKA 5JGFA 5LYLA 4R76A 2ZEPA 2ZEDA 2GLFA 3D7HA 3V7ZA 5LRKA 4IAVA 3EWQA 3K2KA 4PXCA 2QYVA 4AXVA 2DEAA 3GQOA 4B6ZA 1RTQA 4MCSA 5HOLA 3RZAA 4H2KA 2Q51A 3KQXA 5K8NA 1YW6A 1R43A 1YW4A 3K9TA 1PCAA 2V8GA 3CPXA 5HVGA 4KYBA 3H8EA 2O4HA 1QQ9A 3NH8A 4R8FA 1F57A 4MCRA 1TKJA 1TKHA 5HXDA 1JQGA 4OKOA 2C6CA 2ACFA 4FWUA 1BAVA 4YU9A 4A39A 1XBUA 2AFOA 4OMEA 2PJBA 3V2BA 1Y0YA 2PRQA 4GVVA 5FSXA 4NFRA 4OC4A 1IGBA 3EWPA 5CBMA 1VHEA 3PB6X 4PXEA 3D7DA 3H8GA 2NYQA 3ISXA 1QMUA 4NGSA 3VH9A 3PB8X 5IB9A 3D68A 3NA6A 2PJ2A 1VIXA 4ZX8A 1LAPA 2HB6A 4P4EA 1YMEA 4EMEA 2PIZA 1BPMA 4NJRA 2ZEMA 3VARA 1LANA 2AFUA 1SPVA 1HEEA 4ZY0A 2BOAA 2PJ0A 1VHUA 3V45A 3MN8A 3FECA 4NGTA 1H8LA 4NJQA 2BO9A 2CF4A 2PJ9A 2OR4A 1ZG7A 1ZG8A 5FSZA 4ZX9A 3JZTA 4OP4A 3S9LA 1NJRA 4OC5A 4MHZA 2PIYA 3BXMA 5J1QA 1HDUA 1YD9A 2QVPA 3NH4A 3SIGA 3WABA 1ZLHA 3IO1A 2C6GA 2PVWA 4NGMA 1HJZA 1ELLP 1FNOA 4X3RA 1OBRA 3FEEA 4ZYQA 2IQ6A 1F2OA 1Z8LA 4MCPA 4MHPA 3TC8A 3KR5A 5I4MA 5AILA 3BHXA 2GLJA 3IIDA 4ZY1A 3ETIA 2Q4ZA 3SJFA 5HIHA 4P4DA 3B3WA 3H8FA 2ABZA 1ZR3A 4YWYA 1ELMP 4OC1A 2ZEOA 2AFXA 4TNUA 4MCQA 3B7IA 3D66A 3WC7A 2AFWA 4G1PA 1ZG9A 2JEWA 1YLOA 4OIDA 4TU0A 5CB3A 4OC0A 2AFCA 2PCUA 4RUHA 2V8DA 1Q7LA 1AYEA 3EJFA 4PXBA 1AMPA 2PJ1A 4EWTA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 3FH4A 3I1UA 3Q71A 1CP7A 3PRTA 4UEZA 3RBUA 3EJGA 4NGQA 3BI1A 2X47A 2PJ8A 2V8VA 4O23A 2JBJA 4GM5A 1EE3P 1DTDA 3KL9A 3KR4A 2VL1A 4MMOA 4IK2A 4MHYA 3B3TA 2FXKA 4FUUA 4P4IA 5FSUA 1GYTA 2ANPA 3SJEA 1BLLE 3EW5A 3V38A 3FX6A 3S9NA 2ZEEA 2RB7A 5THWA 2BFQA 4OC3A 2ZEFA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 1XMBA 2V8HA 4ZI6A 2PJAA 4ZY2A 4P45A 3B2YA 5HVFA 5LRJA 2ZOFA 3GB0A 4JCAA 1CPXA 1PYTB 3CDXA 3VFQA 4A94A 1TY8A 1VGYA 4UIAA 3SIJA 4P44A 4MXUA 2GREA 4NGPA 4DJLA 1IY7A 2WYRA 4A38A 4OIWA 3RAMA 3IFEA 4KSIA 1UWYA 3SIIA 4D86A 5JM6A 2DX6A 3TX8A 4Q7AA 2PJ5A 4LQGA 5JH9A 2Q43A 3KGQA 3KHXA 5F09A 2POKA 1BPNA 3EWOA 3LWUA 4P10A 5FSYA 4PXDA 3CT9A 4X8IA 1Z5RA 4J4ZA 4DYOA 2L8RA 3BI0A 3D4UA 1TF9A 3KQZA 4JYWA 3D67A 3GUXA 2V77A 2EK9A 5CMSA 4W9YA 4ETJA 1CX8A 3Q6ZA 3PBEA 1FT7A 3LMSA 4R6TA 4P4BA 4P4JA 1ARMA 2O53A 2F7VA 3B35A 3DLJA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 1KWMA 4UIBA 2FVGA 4FAIA 5LYDA 2PJ6A 4NGRA 2ZEHA 3SI1A 3GLJA 4WWVA 3CPAA 3IIFA 3NFZA 4A37A 2XEGA 2WZNA 4OC2A 3GPQA 3EWRA 4TWEA 3JRUA 3FJUA 4DUKA 1XFOA 1YSJA 3PB9X 5LYFA 2EEEA 3HUVA 2ZELA 4J5SA 3D7FA 1LCPA 3SI2A 3DGVA 4ABLA 1Z2LA 2EK8A 3WC5A 2AFZA 2ZEGA 3WC6A 4ETKA 3D7GA 4CPAA 2CTCA 2EWBA 2LGRA 1ZLIA 4UF4A 4IQYA 1TXRA 2HC9A 2JBKA 4MHNA 1TXZA 2PJ7A 1CP6A 3EKEA 1LFWA 3T8WA 3FVLA 2VRIA 1CPSA 3ISZA 5D29A 4IHMA 3KI9A 3IC1A 3PEIA 4ONWA 4JLLA 2XEFA 3KHZA 2XEJA 5K8MA 4J5RA 2G9DA 4UEFA 2BFRA 3GPOA 2CTBA 4K0CA 4K3NA 3SI0A 2PJ4A 1TF8A 4NGNA 1VHOA 4GUAA 4ABKA 1DE4C 3HLPA 3KASA 2FG1A
chains in the Genus database with same CATH superfamily
4ESSA 4CAEA 3R95A 3GQEA 4UFWA 3R9FA 3PFOA 4Z65A 3QAYA 2F8HA 2PJ3A 3PFEA 3SJXA 2QECA 2QJ8A 4PPZA 1M1DA 2GU2A 5K8PA 2I3CA 3EC4A 4KORA 1UFHA 2J9AA 3EFAA 4M3SA 3FF3A 5E3BA 1QSRA 2EUIA 3N5FA 1KUXA 5DUSA 1BOBA 2G3TA 3B3CA 3KZWA 3FEDA 3L2NA 2B5GA 4KVXA 4PQAA 2K5TA 2XEIA 5D8NA 1CJWA 5LYIA 3PB4X 4IF5A 1Q2DA 1F2PA 3DNSA 3NE8A 3IEHA 4J5QA 4X2TA 3PB7X 1NSLA 4JVVA 2Q4VA 2WPWA 2YGWA 4F8ZA 3MRUA 2PVVA 4F9VA 2B58A 3TFYA 2Z3LA 4KOXA 1XJOA 4B5OA 5DS0A 2BCOA 2EO8A 8CPAA 3R9EA 2PJCA 4CGPA 3D3SA 3S9MA 2C6PA 5ELYA 3GPGA 5GCNA 5C82A 3P2HA 3DR6A 3IIBA 1TKFA 1YK3A 3SJGA 3NH5A 3GY9A 4MBUA 2BEIA 3PGPA 5F48A 2AFMA 1R3NA 3WT4A 2ZW6A 2XD7A 3IU1A 4HNYB 2OOTA 4NF1A 5FSVA 2IJZA 2CIJA 2B4BA 1ZR5A 2FSRA 1XRYA 2VXKA 3I9SA 4KOSA 2Z11A 1YVKA 5E96A 3FMCA 4R7MA 5EBVA 4CYNA 4HNWB 4K30A 5AG4A 1XF8A 1ARLA 1HDQA 2AE6A 2GANA 4P4FA 4C68A 4CAXA 3BJ8A 2D4PA 1NSAA 2J8RA 4M6GA 2DF5A 1Z4EA 5CPAA 2AFSA 1SQHA 1MJ9A 2GFQA 4JZ0A 3TTHA 2RFHA 4U9YA 6CPAA 3B3SA 5K8OA 3GKRA 1LAMA 1PU9A 2REFA 4GVWA 3B3VA 4B13A 4RI1A 5IX3A 2PDOA 1KUYA 3PBBA 3SIHA 1Y7EA 3VWEA 2FAVA 4P6YA 4EFDA 1Y9KA 4PSXA 4UMLA 5CB5A 1CBXA 3VATA 2CNSA 1GHEA 4GS4A 1X10A 1XOVA 4WJBA 5F46A 4LX9A 5LRGA 3LACA 5ISVA 2B4DA 4E8OA 4MRIA 2PE3A 5EC4A 2IMOA 2W2GA 4JGKA 4UWJA 4B5PA 4KS9A 4AVCA 5JGFA 5LYLA 4R76A 2ZEPA 2ZEDA 4RN7A 2G3AA 2GLFA 3D7HA 4MFJA 4Y49C 3V7ZA 3W6SA 5A27A 4IAVA 5LRKA 2PR8A 3EWQA 5G20A 3S6GA 3K2KA 4PXCA 2OH1A 1Z8WA 2QYVA 1X12A 2DEAA 4AXVA 3GQOA 4CS0B 4AVBA 1RTQA 4A31A 4B6ZA 2RNKA 4MCSA 4EVYA 5HOLA 3RZAA 4H2KA 1TIQA 2Q51A 3KQXA 4XPLA 4C7HA 1YW6A 2AJ6A 1R43A 5K8NA 4F0YA 1YW4A 3K9TA 5H84A 1PCAA 2V8GA 3CPXA 5HVGA 4QC6A 4KYBA 2OZHA 2ZXVA 2KQVA 5F47A 4CGMA 3H8EA 2O4HA 1QQ9A 3NH8A 4YFJA 4R8FA 4YRHA 1F57A 4MCRA 2Y0MA 1TKJA 4JJXA 5KTDA 5JQ4A 1TKHA 5HXDA 1IYLA 1JQGA 4OKOA 2C6CA 2ACFA 4FWUA 4MFLA 1BAVA 2B3VA 2ARHA 4KOUA 3FYNA 4MFQA 4MI4A 1XBUA 2AFOA 2Z3NA 4OMEA 2PJBA 3V2BA 4R3KA 4A39A 4L8AA 1Y0YA 2FIWA 4GVVA 2PRQA 4B11A 5FSXA 3E0KA 2Z3MA 1NE9A 1IGBA 4NFRA 3EWPA 4OC4A 5IB0A 4CGOA 5CBMA 1VHEA 3BJ7A 3FB3A 4XPDB 1MJAA 3PB6X 1S60A 4KVME 4LQ6A 4PXEA 1KUVA 3D7DA 3H8GA 4BD9A 2NYQA 3ISXA 1YX0A 1QMUA 4L89A 4NGSA 4QVTA 2REEA 3SXOA 3BLNA 3T9YA 1M4IA 2I79A 3PB8X 3VH9A 2YNCC 4C7IA 3D68A 3NA6A 1OZPA 2PJ2A 4R57A 1VIXA 5IB9A 4AVAA 2VI7A 4UFXA 2BUEA 4MFKA 2OZGA 4ZX8A 3D2PA 1YVOA 2Q04A 2VZYA 1LAPA 5DWMA 4KUAA 4AG7A 5HMNA 1V0CA 3OWCA 4GXHA 3PP9A 4MFZA 2HB6A 1Q2YA 1YMEA 3R1KA 4M6IA 4P4EA 4A95A 4EMEA 4R87A 2PIZA 2ODFA 3JUWA 4JXRA 1Y7RA 1BPMA 4ZGYB 4AB7A 3F0AA 4NJRA 2ZEMA 3KKWA 3VARA 1LANA 2AFUA 2WCTA 1SPVA 4JLYA 1HEEA 1QSMA 4ZY0A 2BOAA 2PJ0A 3CXQA 3JTKA 2J8NA 5G22A 4KLVA 5EMIA 1VHUA 1P0HA 4Q36A 3V45A 3MN8A 2JDCA 4PK3A 5AGEA 3UY5A 3FECA 4NGTA 2B3UA 2VZZA 1H8LA 4NJQA 3GYAA 2ZW5A 2BO9A 2CF4A 2PJ9A 2OR4A 1ZG7A 1ZG8A 3FBUA 5FSZA 4JXQA 4ZX9A 3JZTA 3D2MA 5AG7A 2DPTA 5DWNA 4OP4A 4IUSA 4A2ZA 2PC1A 3S6HA 3TO9A 3S9LA 3EXNA 4KSFA 1Q2CA 1NJRA 4OC5A 4E2AA 4MHZA 2PIYA 2HV2A 4XNHB 3BXMA 2QMLA 1HDUA 5J1QA 1YD9A 2QVPA 3NH4A 4H6ZA 3SIGA 2PR1A 3WABA 1ZLHA 2BL1A 2C6GA 2Q0YA 3I3GA 3IO1A 3T90A 4C2XA 4U9ZA 2PVWA 1J4JA 4NGMA 1S3ZA 4CYQA 5CNPA 1WWZA 1HJZA 1ELLP 1FNOA 4QB9A 1OBRA 4X3RA 4B14A 3FEEA 4ZYQA 2IQ6A 1F2OA 3DR8A 5KTCA 1Z8LA 4MCPA 2ZW7A 4MHPA 3TOAA 3TOBA 2FL4A 1WK4A 3EY5A 3TO6A 3ZZIA 2JEVA 3TC8A 3B8GA 3IU2A 1B87A 3KR5A 5I4MA 5AILA 3BHXA 2GLJA 4UWIA 3IIDA 4ZY1A 3ETIA 1B6BA 2Q4ZA 4MFPA 3SJFA 4ONUA 5HIHA 4P4DA 3B3WA 3H8FA 4CYPA 2ABZA 1ZR3A 4YWYA 1JWQA 3QAHA 4CAVA 1ELMP 1LRZA 4OC1A 1A2ZA 2AFXA 1Y9WA 2ZEOA 4TNUA 4A32A 4MCQA 3ZJ0A 1IOIA 1MJBA 1S7KA 3B7IA 3D66A 3WC7A 1IYKA 2AFWA 1U6MA 4G1PA 4H6UA 1VKCA 1S7FA 4FD4A 1ZG9A 2JEWA 1YLOA 4KOYA 4OIDA 2OB0A 2FXFA 4TU0A 5CB3A 2JLMA 4OC0A 2AFCA 2PCUA 4HNXB 4J3GA 4LUAA 3R96A 3SXNA 4RUHA 2V8DA 4UFVA 1KZFA 1Q7LA 1AYEA 4KLWA 2Z10A 1RXTA 3EJFA 2GE3A 4PXBA 1AMPA 2PJ1A 1P4NA 4EWTA 2WSAA 3IGRA 4ORFA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 2JDDA 3FH4A 3I1UA 3Q71A 3S6KA 1CP7A 2DPSA 1XE4A 3PRTA 4MY3A 4DNCA 2IL4A 4UEZA 3RBUA 1YR0A 2FT0A 5C88A 1YQEA 3EJGA 3CZXA 4NGQA 3BI1A 1NMTA 2X47A 2PJ8A 2V8VA 3JVNA 1MK4A 2R7HA 4O23A 4CGNA 2RC4A 3CXSA 1ON0A 2JBJA 2Z3OA 2H5MA 4GM5A 1BO4A 1EE3P 2YNDA 3V8IA 1DTDA 3KL9A 3KR4A 1S5KA 2VL1A 2ZPAA 5J8CA 4MMOA 2Z0ZA 2X7BA 4IK2A 2R8VA 4MHYA 3B3TA 2PRBA 2FXKA 4FUUA 3TCVA 1XIXA 4P4IA 4BINA 5FSUA 1GYTA 4KSAA 1ZO0A 2ANPA 3SJEA 4HKFA 1BLLE 2A4NA 3EW5A 3TT2A 4AG9A 2R98A 3F5BA 3V38A 3FX6A 3S9NA 2FCKA 2ZEEA 2RB7A 5THWA 2CNTA 4YGOA 2BFQA 4R3LA 4OC3A 2ZEFA 3G8WA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 4C2YA 1XMBA 2V8HA 4ZBGA 4ZI6A 2CNMA 3MGDA 5F49A 1I12A 2PJAA 4KUBA 4ZY2A 4P45A 3B2YA 3GIUA 5HVFA 4CYOA 3SHPA 5LRJA 2ZOFA 3GB0A 4CGLA 2PQ8A 4I49A 4UA3A 4JCAA 1CPXA 3P2FA 4MHDA 4FD5A 1PYTB 3CDXA 5HH1A 1RO5A 3VFQA 4A94A 1TY8A 1VGYA 4UIAA 3SIJA 2Q44A 4JWPA 5AG5A 4C2ZA 4P44A 4MXUA 1I21A 2GREA 4M6HA 4NGPA 2ATRA 1M4GA 1IB1E 4UBRA 4DJLA 1IY7A 3K9UA 2WYRA 2OU2A 3R9GA 2VEZA 4OIWA 3RAMA 4A38A 3IFEA 4KSIA 3G3SA 1UWYA 4KOTA 3TO7A 4B12A 2OZUA 3SIIA 4D86A 1FY7A 2P6FA 2P6EA 3H4QA 3F8KA 5JM6A 2FIAA 2Q4YA 2DX6A 5G1ZA 5BWAB 1IIDA 3TX8A 4Q7AA 2J8MA 2PJ5A 4LQGA 3DDDA 2Q43A 4M85A 2BSWA 2VQYA 2YNEA 3KGQA 4KOWA 3KHXA 4PK2A 4F0XA 3A9LA 5F09A 2POKA 4YU9A 1BPNA 3EWOA 3EO4A 3LWUA 4P10A 2HQYA 5FSYA 2FS5A 4PXDA 3CT9A 4X8IA 1Z5RA 4KVOE 5JPHA 4J4ZA 1VHSA 1YREA 4H89A 4DYOA 3N7ZA 2L8RA 1QSTA 3BI0A 3FXTA 3D4UA 3H5ZA 4Q38A 1TF9A 1Z4RA 3KQZA 4JYWA 3D67A 3GUXA 2EK9A 2V77A 5CMSA 1IOFA 2NMTA 1K4JA 4W9YA 2JZEA 4NEXA 4HPSA 4ETJA 1CX8A 3IWGA 3Q6ZA 4OAEA 4XPDC 2B5GB 4Y49B 3PBEA 2KCWA 1FT7A 3LMSA 4R6TA 2D4OA 4QBJA 4P4BA 3IWEA 4P4JA 1ARMA 1QSOA 2O53A 2F7VA 3B35A 3DLJA 4MY0A 4CAFA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 4PV6A 2ZW4A 3FNCA 5KTAA 1KWMA 4NSQA 4UIBA 2FVGA 4UCNA 4FAIA 5LYDA 1IICA 2PJ6A 5FVJA 4F6AA 4NGRA 1M4DA 2ZEHA 4A33A 2G0BA 3SI1A 3GLJA 4WWVA 3CPAA 2HUZA 4XPKA 4CRYB 3IIFA 3NFZA 3W6XA 4A37A 2QIRA 2WZNA 2XEGA 4OC2A 3GPQA 3EWRA 4TWEA 1PUAA 4CRZB 4NCZA 2R1IA 3JRUA 1S7NA 3FJUA 4PSWA 4UCPA 3FIXA 4DUKA 1QSNA 4JD6A 1XFOA 4II9A 1YSJA 4RS2A 3DSBA 3QB8A 2FE7A 3RYOA 4FD7A 1XMTA 1IU8A 3PB9X 2YNCA 4R9MA 5IV0A 5LYFA 2EEEA 1I1DA 5I0CA 3HUVA 2WPXA 2ZELA 1Z9UA 4B10A 1Z8XA 4J5SA 3D7FA 1LCPA 5G21A 3SI2A 4BBHA 1YLEA 3DGVA 2F5IA 4ABLA 1Z2LA 2Q7SA 2GIVA 4OADA 3PZJA 2EK8A 4MJ8A 3WC5A 3TE4A 2AFZA 2ZEGA 3WC6A 4ETKA 4KOVA 3D7GA 4A30A 3NE7A 4CPAA 2CTCA 3S6FA 1R57A 2EWBA 3RNZA 3CXPA 2LGRA 1ZLIA 2B4DB 4UF4A 2PSWA 3FRMA 4IQYA 1TXRA 1L0CA 2HC9A 2JBKA 4MHNA 1TXZA 4B5PB 2PJ7A 3D8PA 1CP6A 3LD2A 4OLLA 3EKEA 1LFWA 3T8WA 2P0WA 2Z3KA 3FVLA 2VRIA 4BMHA 1CPSA 1XEBA 2C27A 3ISZA 4U5YA 3WR7A 4XNHC 5J8FA 3LODA 3RO0A 5D29A 1CM0A 4IHMA 1N71A 2EVNA 3KI9A 3IC1A 4QUSA 3PEIA 2I00A 2WUUA 4ONWA 2VBQA 4X5KA 3VWDA 3W91A 2JZFA 4JLLA 2CY2A 2XEFA 3KHZA 4NXYA 2O28A 5H86A 1S7LA 2XEJA 2Q7BA 4J5RA 5K8MA 1AUGA 2DXQA 2G9DA 5A28A 4UCMA 4UEFA 2P6GA 4KZTA 5AG6A 2BFRA 4FD6A 3GPOA 2CTBA 4K0CA 2EBJA 4K3NA 4CAWA 1M44A 3C26A 2Z3PA 2PJ4A 1YGHA 3SI0A 4E0AA 1Z8TA 1TF8A 2CXAA 5JH9A 4NGNA 1VHOA 4GUAA 2JZDA 4ABKA 1DE4C 3HLPA 3KASA 2FG1A
chains in the Genus database with same CATH topology
4ESSA 3GQEA 3PFOA 4Z65A 2F8HA 2PJ3A 3PFEA 3SJXA 2QJ8A 4PPZA 2GU2A 5K8PA 2I3CA 2J9AA 3FF3A 5E3BA 3N5FA 4BD9A 3B3CA 5DUSA 4F9VA 3FEDA 3KZWA 4PQAA 3L2NA 2XEIA 5D8NA 5LYIA 3PB4X 1F2PA 3IEHA 4X2TA 4J5QA 3PB7X 4JVVA 4F8ZA 3MRUA 2PVVA 1XJOA 5DS0A 2BCOA 8CPAA 2PJCA 3S9MA 2C6PA 5ELYA 3GPGA 3IIBA 1TKFA 3SJGA 3NH5A 2AFMA 1R3NA 3WT4A 2XD7A 2OOTA 5FSVA 2IJZA 2CIJA 1ZR5A 1XRYA 3FMCA 4R7MA 1ARLA 1HDQA 4P4FA 1NSAA 5CPAA 2AFSA 4JZ0A 2RFHA 6CPAA 3B3SA 5K8OA 1LAMA 4GVWA 3B3VA 3PBBA 3SIHA 1Y7EA 2FAVA 4P6YA 4EFDA 4UMLA 5CB5A 1CBXA 3VATA 4WJBA 5LRGA 4MRIA 2PE3A 2IMOA 4JGKA 5JGFA 5LYLA 4R76A 2ZEPA 2ZEDA 2GLFA 3D7HA 3V7ZA 5LRKA 4IAVA 3EWQA 3K2KA 4PXCA 2QYVA 4AXVA 2DEAA 3GQOA 4B6ZA 1RTQA 4MCSA 5HOLA 3RZAA 4H2KA 2Q51A 3KQXA 5K8NA 1YW6A 1R43A 1YW4A 3K9TA 1PCAA 2V8GA 3CPXA 5HVGA 4KYBA 3H8EA 2O4HA 1QQ9A 3NH8A 4R8FA 1F57A 4MCRA 1TKJA 1TKHA 5HXDA 1JQGA 4OKOA 2C6CA 2ACFA 4FWUA 1BAVA 4YU9A 4A39A 1XBUA 2AFOA 4OMEA 2PJBA 3V2BA 1Y0YA 2PRQA 4GVVA 5FSXA 4NFRA 4OC4A 1IGBA 3EWPA 5CBMA 1VHEA 3PB6X 4PXEA 3D7DA 3H8GA 2NYQA 3ISXA 1QMUA 4NGSA 3VH9A 3PB8X 5IB9A 3D68A 3NA6A 2PJ2A 1VIXA 4ZX8A 1LAPA 2HB6A 4P4EA 1YMEA 4EMEA 2PIZA 1BPMA 4NJRA 2ZEMA 3VARA 1LANA 2AFUA 1SPVA 1HEEA 4ZY0A 2BOAA 2PJ0A 1VHUA 3V45A 3MN8A 3FECA 4NGTA 1H8LA 4NJQA 2BO9A 2CF4A 2PJ9A 2OR4A 1ZG7A 1ZG8A 5FSZA 4ZX9A 3JZTA 4OP4A 3S9LA 1NJRA 4OC5A 4MHZA 2PIYA 3BXMA 5J1QA 1HDUA 1YD9A 2QVPA 3NH4A 3SIGA 3WABA 1ZLHA 3IO1A 2C6GA 2PVWA 4NGMA 1HJZA 1ELLP 1FNOA 4X3RA 1OBRA 3FEEA 4ZYQA 2IQ6A 1F2OA 1Z8LA 4MCPA 4MHPA 3TC8A 3KR5A 5I4MA 5AILA 3BHXA 2GLJA 3IIDA 4ZY1A 3ETIA 2Q4ZA 3SJFA 5HIHA 4P4DA 3B3WA 3H8FA 2ABZA 1ZR3A 4YWYA 1ELMP 4OC1A 2ZEOA 2AFXA 4TNUA 4MCQA 3B7IA 3D66A 3WC7A 2AFWA 4G1PA 1ZG9A 2JEWA 1YLOA 4OIDA 4TU0A 5CB3A 4OC0A 2AFCA 2PCUA 4RUHA 2V8DA 1Q7LA 1AYEA 3EJFA 4PXBA 1AMPA 2PJ1A 4EWTA 4F9UA 1CG2A 2ZOGA 3IJ3A 2NSMA 3FH4A 3I1UA 3Q71A 1CP7A 3PRTA 4UEZA 3RBUA 3EJGA 4NGQA 3BI1A 2X47A 2PJ8A 2V8VA 4O23A 2JBJA 4GM5A 1EE3P 1DTDA 3KL9A 3KR4A 2VL1A 4MMOA 4IK2A 4MHYA 3B3TA 2FXKA 4FUUA 4P4IA 5FSUA 1GYTA 2ANPA 3SJEA 1BLLE 3EW5A 3V38A 3FX6A 3S9NA 2ZEEA 2RB7A 5THWA 2BFQA 4OC3A 2ZEFA 4FBEA 2C1CA 7CPAA 4UEEA 1M4LA 1XMBA 2V8HA 4ZI6A 2PJAA 4ZY2A 4P45A 3B2YA 5HVFA 5LRJA 2ZOFA 3GB0A 4JCAA 1CPXA 1PYTB 3CDXA 3VFQA 4A94A 1TY8A 1VGYA 4UIAA 3SIJA 4P44A 4MXUA 2GREA 4NGPA 4DJLA 1IY7A 2WYRA 4A38A 4OIWA 3RAMA 3IFEA 4KSIA 1UWYA 3SIIA 4D86A 5JM6A 2DX6A 3TX8A 4Q7AA 2PJ5A 4LQGA 5JH9A 2Q43A 3KGQA 3KHXA 5F09A 2POKA 1BPNA 3EWOA 3LWUA 4P10A 5FSYA 4PXDA 3CT9A 4X8IA 1Z5RA 4J4ZA 4DYOA 2L8RA 3BI0A 3D4UA 1TF9A 3KQZA 4JYWA 3D67A 3GUXA 2V77A 2EK9A 5CMSA 4W9YA 4ETJA 1CX8A 3Q6ZA 3PBEA 1FT7A 3LMSA 4R6TA 4P4BA 4P4JA 1ARMA 2O53A 2F7VA 3B35A 3DLJA 5HVHA 1LOKA 3IWWA 2ZENA 1Y0RA 3QNVA 1KWMA 4UIBA 2FVGA 4FAIA 5LYDA 2PJ6A 4NGRA 2ZEHA 3SI1A 3GLJA 4WWVA 3CPAA 3IIFA 3NFZA 4A37A 2XEGA 2WZNA 4OC2A 3GPQA 3EWRA 4TWEA 3JRUA 3FJUA 4DUKA 1XFOA 1YSJA 3PB9X 5LYFA 2EEEA 3HUVA 2ZELA 4J5SA 3D7FA 1LCPA 3SI2A 3DGVA 4ABLA 1Z2LA 2EK8A 3WC5A 2AFZA 2ZEGA 3WC6A 4ETKA 3D7GA 4CPAA 2CTCA 2EWBA 2LGRA 1ZLIA 4UF4A 4IQYA 1TXRA 2HC9A 2JBKA 4MHNA 1TXZA 2PJ7A 1CP6A 3EKEA 1LFWA 3T8WA 3FVLA 2VRIA 1CPSA 3ISZA 5D29A 4IHMA 3KI9A 3IC1A 3PEIA 4ONWA 4JLLA 2XEFA 3KHZA 2XEJA 5K8MA 4J5RA 2G9DA 4UEFA 2BFRA 3GPOA 2CTBA 4K0CA 4K3NA 3SI0A 2PJ4A 1TF8A 4NGNA 1VHOA 4GUAA 4ABKA 1DE4C 3HLPA 3KASA 2FG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ESS A;  3GQE A;  3PFO A;  4Z65 A;  2F8H A;  2PJ3 A;  3PFE A;  3SJX A;  2QJ8 A;  4PPZ A;  2GU2 A;  5K8P A;  2I3C A;  2J9A A;  3FF3 A;  5E3B A;  3N5F A;  4BD9 A;  3B3C A;  5DUS A;  4F9V A;  3FED A;  3KZW A;  4PQA A;  3L2N A;  2XEI A;  5D8N A;  5LYI A;  3PB4 X;  1F2P A;  3IEH A;  4X2T A;  4J5Q A;  3PB7 X;  4JVV A;  4F8Z A;  3MRU A;  2PVV A;  1XJO A;  5DS0 A;  2BCO A;  8CPA A;  2PJC A;  3S9M A;  2C6P A;  5ELY A;  3GPG A;  3IIB A;  1TKF A;  3SJG A;  3NH5 A;  2AFM A;  1R3N A;  3WT4 A;  2XD7 A;  2OOT A;  5FSV A;  2IJZ A;  2CIJ A;  1ZR5 A;  1XRY A;  3FMC A;  4R7M A;  1ARL A;  1HDQ A;  4P4F A;  1NSA A;  5CPA A;  2AFS A;  4JZ0 A;  2RFH A;  6CPA A;  3B3S A;  5K8O A;  1LAM A;  4GVW A;  3B3V A;  3PBB A;  3SIH A;  1Y7E A;  2FAV A;  4P6Y A;  4EFD A;  4UML A;  5CB5 A;  1CBX A;  3VAT A;  4WJB A;  5LRG A;  4MRI A;  2PE3 A;  2IMO A;  4JGK A;  5JGF A;  5LYL A;  4R76 A;  2ZEP A;  2ZED A;  2GLF A;  3D7H A;  3V7Z A;  5LRK A;  4IAV A;  3EWQ A;  3K2K A;  4PXC A;  2QYV A;  4AXV A;  2DEA A;  3GQO A;  4B6Z A;  1RTQ A;  4MCS A;  5HOL A;  3RZA A;  4H2K A;  2Q51 A;  3KQX A;  5K8N A;  1YW6 A;  1R43 A;  1YW4 A;  3K9T A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  4KYB A;  3H8E A;  2O4H A;  1QQ9 A;  3NH8 A;  4R8F A;  1F57 A;  4MCR A;  1TKJ A;  1TKH A;  5HXD A;  1JQG A;  4OKO A;  2C6C A;  2ACF A;  4FWU A;  1BAV A;  4YU9 A;  4A39 A;  1XBU A;  2AFO A;  4OME A;  2PJB A;  3V2B A;  1Y0Y A;  2PRQ A;  4GVV A;  5FSX A;  4NFR A;  4OC4 A;  1IGB A;  3EWP A;  5CBM A;  1VHE A;  3PB6 X;  4PXE A;  3D7D A;  3H8G A;  2NYQ A;  3ISX A;  1QMU A;  4NGS A;  3VH9 A;  3PB8 X;  5IB9 A;  3D68 A;  3NA6 A;  2PJ2 A;  1VIX A;  4ZX8 A;  1LAP A;  2HB6 A;  4P4E A;  1YME A;  4EME A;  2PIZ A;  1BPM A;  4NJR A;  2ZEM A;  3VAR A;  1LAN A;  2AFU A;  1SPV A;  1HEE A;  4ZY0 A;  2BOA A;  2PJ0 A;  1VHU A;  3V45 A;  3MN8 A;  3FEC A;  4NGT A;  1H8L A;  4NJQ A;  2BO9 A;  2CF4 A;  2PJ9 A;  2OR4 A;  1ZG7 A;  1ZG8 A;  5FSZ A;  4ZX9 A;  3JZT A;  4OP4 A;  3S9L A;  1NJR A;  4OC5 A;  4MHZ A;  2PIY A;  3BXM A;  5J1Q A;  1HDU A;  1YD9 A;  2QVP A;  3NH4 A;  3SIG A;  3WAB A;  1ZLH A;  3IO1 A;  2C6G A;  2PVW A;  4NGM A;  1HJZ A;  1ELL P;  1FNO A;  4X3R A;  1OBR A;  3FEE A;  4ZYQ A;  2IQ6 A;  1F2O A;  1Z8L A;  4MCP A;  4MHP A;  3TC8 A;  3KR5 A;  5I4M A;  5AIL A;  3BHX A;  2GLJ A;  3IID A;  4ZY1 A;  3ETI A;  2Q4Z A;  3SJF A;  5HIH A;  4P4D A;  3B3W A;  3H8F A;  2ABZ A;  1ZR3 A;  4YWY A;  1ELM P;  4OC1 A;  2ZEO A;  2AFX A;  4TNU A;  4MCQ A;  3B7I A;  3D66 A;  3WC7 A;  2AFW A;  4G1P A;  1ZG9 A;  2JEW A;  1YLO A;  4OID A;  4TU0 A;  5CB3 A;  4OC0 A;  2AFC A;  2PCU A;  4RUH A;  2V8D A;  1Q7L A;  1AYE A;  3EJF A;  4PXB A;  1AMP A;  2PJ1 A;  4EWT A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  3FH4 A;  3I1U A;  3Q71 A;  1CP7 A;  3PRT A;  4UEZ A;  3RBU A;  3EJG A;  4NGQ A;  3BI1 A;  2X47 A;  2PJ8 A;  2V8V A;  4O23 A;  2JBJ A;  4GM5 A;  1EE3 P;  1DTD A;  3KL9 A;  3KR4 A;  2VL1 A;  4MMO A;  4IK2 A;  4MHY A;  3B3T A;  2FXK A;  4FUU A;  4P4I A;  5FSU A;  1GYT A;  2ANP A;  3SJE A;  1BLL E;  3EW5 A;  3V38 A;  3FX6 A;  3S9N A;  2ZEE A;  2RB7 A;  5THW A;  2BFQ A;  4OC3 A;  2ZEF A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  1XMB A;  2V8H A;  4ZI6 A;  2PJA A;  4ZY2 A;  4P45 A;  3B2Y A;  5HVF A;  5LRJ A;  2ZOF A;  3GB0 A;  4JCA A;  1CPX A;  1PYT B;  3CDX A;  3VFQ A;  4A94 A;  1TY8 A;  1VGY A;  4UIA A;  3SIJ A;  4P44 A;  4MXU A;  2GRE A;  4NGP A;  4DJL A;  1IY7 A;  2WYR A;  4A38 A;  4OIW A;  3RAM A;  3IFE A;  4KSI A;  1UWY A;  3SII A;  4D86 A;  5JM6 A;  2DX6 A;  3TX8 A;  4Q7A A;  2PJ5 A;  4LQG A;  5JH9 A;  2Q43 A;  3KGQ A;  3KHX A;  5F09 A;  2POK A;  1BPN A;  3EWO A;  3LWU A;  4P10 A;  5FSY A;  4PXD A;  3CT9 A;  4X8I A;  1Z5R A;  4J4Z A;  4DYO A;  2L8R A;  3BI0 A;  3D4U A;  1TF9 A;  3KQZ A;  4JYW A;  3D67 A;  3GUX A;  2V77 A;  2EK9 A;  5CMS A;  4W9Y A;  4ETJ A;  1CX8 A;  3Q6Z A;  3PBE A;  1FT7 A;  3LMS A;  4R6T A;  4P4B A;  4P4J A;  1ARM A;  2O53 A;  2F7V A;  3B35 A;  3DLJ A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  1KWM A;  4UIB A;  2FVG A;  4FAI A;  5LYD A;  2PJ6 A;  4NGR A;  2ZEH A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  3IIF A;  3NFZ A;  4A37 A;  2XEG A;  2WZN A;  4OC2 A;  3GPQ A;  3EWR A;  4TWE A;  3JRU A;  3FJU A;  4DUK A;  1XFO A;  1YSJ A;  3PB9 X;  5LYF A;  2EEE A;  3HUV A;  2ZEL A;  4J5S A;  3D7F A;  1LCP A;  3SI2 A;  3DGV A;  4ABL A;  1Z2L A;  2EK8 A;  3WC5 A;  2AFZ A;  2ZEG A;  3WC6 A;  4ETK A;  3D7G A;  4CPA A;  2CTC A;  2EWB A;  2LGR A;  1ZLI A;  4UF4 A;  4IQY A;  1TXR A;  2HC9 A;  2JBK A;  4MHN A;  1TXZ A;  2PJ7 A;  1CP6 A;  3EKE A;  1LFW A;  3T8W A;  3FVL A;  2VRI A;  1CPS A;  3ISZ A;  5D29 A;  4IHM A;  3KI9 A;  3IC1 A;  3PEI A;  4ONW A;  4JLL A;  2XEF A;  3KHZ A;  2XEJ A;  5K8M A;  4J5R A;  2G9D A;  4UEF A;  2BFR A;  3GPO A;  2CTB A;  4K0C A;  4K3N A;  3SI0 A;  2PJ4 A;  1TF8 A;  4NGN A;  1VHO A;  4GUA A;  4ABK A;  1DE4 C;  3HLP A;  3KAS A;  2FG1 A; 
#chains in the Genus database with same CATH topology
 4ESS A;  4CAE A;  3R95 A;  3GQE A;  4UFW A;  3R9F A;  3PFO A;  4Z65 A;  3QAY A;  2F8H A;  2PJ3 A;  3PFE A;  3SJX A;  2QEC A;  2QJ8 A;  4PPZ A;  1M1D A;  2GU2 A;  5K8P A;  2I3C A;  3EC4 A;  4KOR A;  1UFH A;  2J9A A;  3EFA A;  4M3S A;  3FF3 A;  5E3B A;  1QSR A;  2EUI A;  3N5F A;  1KUX A;  5DUS A;  1BOB A;  2G3T A;  3B3C A;  3KZW A;  3FED A;  3L2N A;  2B5G A;  4KVX A;  4PQA A;  2K5T A;  2XEI A;  5D8N A;  1CJW A;  5LYI A;  3PB4 X;  4IF5 A;  1Q2D A;  1F2P A;  3DNS A;  3NE8 A;  3IEH A;  4J5Q A;  4X2T A;  3PB7 X;  1NSL A;  4JVV A;  2Q4V A;  2WPW A;  2YGW A;  4F8Z A;  3MRU A;  2PVV A;  4F9V A;  2B58 A;  3TFY A;  2Z3L A;  4KOX A;  1XJO A;  4B5O A;  5DS0 A;  2BCO A;  2EO8 A;  8CPA A;  3R9E A;  2PJC A;  4CGP A;  3D3S A;  3S9M A;  2C6P A;  5ELY A;  3GPG A;  5GCN A;  5C82 A;  3P2H A;  3DR6 A;  3IIB A;  1TKF A;  1YK3 A;  3SJG A;  3NH5 A;  3GY9 A;  4MBU A;  2BEI A;  3PGP A;  5F48 A;  2AFM A;  1R3N A;  3WT4 A;  2ZW6 A;  2XD7 A;  3IU1 A;  4HNY B;  2OOT A;  4NF1 A;  5FSV A;  2IJZ A;  2CIJ A;  2B4B A;  1ZR5 A;  2FSR A;  1XRY A;  2VXK A;  3I9S A;  4KOS A;  2Z11 A;  1YVK A;  5E96 A;  3FMC A;  4R7M A;  5EBV A;  4CYN A;  4HNW B;  4K30 A;  5AG4 A;  1XF8 A;  1ARL A;  1HDQ A;  2AE6 A;  2GAN A;  4P4F A;  4C68 A;  4CAX A;  3BJ8 A;  2D4P A;  1NSA A;  2J8R A;  4M6G A;  2DF5 A;  1Z4E A;  5CPA A;  2AFS A;  1SQH A;  1MJ9 A;  2GFQ A;  4JZ0 A;  3TTH A;  2RFH A;  4U9Y A;  6CPA A;  3B3S A;  5K8O A;  3GKR A;  1LAM A;  1PU9 A;  2REF A;  4GVW A;  3B3V A;  4B13 A;  4RI1 A;  5IX3 A;  2PDO A;  1KUY A;  3PBB A;  3SIH A;  1Y7E A;  3VWE A;  2FAV A;  4P6Y A;  4EFD A;  1Y9K A;  4PSX A;  4UML A;  5CB5 A;  1CBX A;  3VAT A;  2CNS A;  1GHE A;  4GS4 A;  1X10 A;  1XOV A;  4WJB A;  5F46 A;  4LX9 A;  5LRG A;  3LAC A;  5ISV A;  2B4D A;  4E8O A;  4MRI A;  2PE3 A;  5EC4 A;  2IMO A;  2W2G A;  4JGK A;  4UWJ A;  4B5P A;  4KS9 A;  4AVC A;  5JGF A;  5LYL A;  4R76 A;  2ZEP A;  2ZED A;  4RN7 A;  2G3A A;  2GLF A;  3D7H A;  4MFJ A;  4Y49 C;  3V7Z A;  3W6S A;  5A27 A;  4IAV A;  5LRK A;  2PR8 A;  3EWQ A;  5G20 A;  3S6G A;  3K2K A;  4PXC A;  2OH1 A;  1Z8W A;  2QYV A;  1X12 A;  2DEA A;  4AXV A;  3GQO A;  4CS0 B;  4AVB A;  1RTQ A;  4A31 A;  4B6Z A;  2RNK A;  4MCS A;  4EVY A;  5HOL A;  3RZA A;  4H2K A;  1TIQ A;  2Q51 A;  3KQX A;  4XPL A;  4C7H A;  1YW6 A;  2AJ6 A;  1R43 A;  5K8N A;  4F0Y A;  1YW4 A;  3K9T A;  5H84 A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  4QC6 A;  4KYB A;  2OZH A;  2ZXV A;  2KQV A;  5F47 A;  4CGM A;  3H8E A;  2O4H A;  1QQ9 A;  3NH8 A;  4YFJ A;  4R8F A;  4YRH A;  1F57 A;  4MCR A;  2Y0M A;  1TKJ A;  4JJX A;  5KTD A;  5JQ4 A;  1TKH A;  5HXD A;  1IYL A;  1JQG A;  4OKO A;  2C6C A;  2ACF A;  4FWU A;  4MFL A;  1BAV A;  2B3V A;  2ARH A;  4KOU A;  3FYN A;  4MFQ A;  4MI4 A;  1XBU A;  2AFO A;  2Z3N A;  4OME A;  2PJB A;  3V2B A;  4R3K A;  4A39 A;  4L8A A;  1Y0Y A;  2FIW A;  4GVV A;  2PRQ A;  4B11 A;  5FSX A;  3E0K A;  2Z3M A;  1NE9 A;  1IGB A;  4NFR A;  3EWP A;  4OC4 A;  5IB0 A;  4CGO A;  5CBM A;  1VHE A;  3BJ7 A;  3FB3 A;  4XPD B;  1MJA A;  3PB6 X;  1S60 A;  4KVM E;  4LQ6 A;  4PXE A;  1KUV A;  3D7D A;  3H8G A;  4BD9 A;  2NYQ A;  3ISX A;  1YX0 A;  1QMU A;  4L89 A;  4NGS A;  4QVT A;  2REE A;  3SXO A;  3BLN A;  3T9Y A;  1M4I A;  2I79 A;  3PB8 X;  3VH9 A;  2YNC C;  4C7I A;  3D68 A;  3NA6 A;  1OZP A;  2PJ2 A;  4R57 A;  1VIX A;  5IB9 A;  4AVA A;  2VI7 A;  4UFX A;  2BUE A;  4MFK A;  2OZG A;  4ZX8 A;  3D2P A;  1YVO A;  2Q04 A;  2VZY A;  1LAP A;  5DWM A;  4KUA A;  4AG7 A;  5HMN A;  1V0C A;  3OWC A;  4GXH A;  3PP9 A;  4MFZ A;  2HB6 A;  1Q2Y A;  1YME A;  3R1K A;  4M6I A;  4P4E A;  4A95 A;  4EME A;  4R87 A;  2PIZ A;  2ODF A;  3JUW A;  4JXR A;  1Y7R A;  1BPM A;  4ZGY B;  4AB7 A;  3F0A A;  4NJR A;  2ZEM A;  3KKW A;  3VAR A;  1LAN A;  2AFU A;  2WCT A;  1SPV A;  4JLY A;  1HEE A;  1QSM A;  4ZY0 A;  2BOA A;  2PJ0 A;  3CXQ A;  3JTK A;  2J8N A;  5G22 A;  4KLV A;  5EMI A;  1VHU A;  1P0H A;  4Q36 A;  3V45 A;  3MN8 A;  2JDC A;  4PK3 A;  5AGE A;  3UY5 A;  3FEC A;  4NGT A;  2B3U A;  2VZZ A;  1H8L A;  4NJQ A;  3GYA A;  2ZW5 A;  2BO9 A;  2CF4 A;  2PJ9 A;  2OR4 A;  1ZG7 A;  1ZG8 A;  3FBU A;  5FSZ A;  4JXQ A;  4ZX9 A;  3JZT A;  3D2M A;  5AG7 A;  2DPT A;  5DWN A;  4OP4 A;  4IUS A;  4A2Z A;  2PC1 A;  3S6H A;  3TO9 A;  3S9L A;  3EXN A;  4KSF A;  1Q2C A;  1NJR A;  4OC5 A;  4E2A A;  4MHZ A;  2PIY A;  2HV2 A;  4XNH B;  3BXM A;  2QML A;  1HDU A;  5J1Q A;  1YD9 A;  2QVP A;  3NH4 A;  4H6Z A;  3SIG A;  2PR1 A;  3WAB A;  1ZLH A;  2BL1 A;  2C6G A;  2Q0Y A;  3I3G A;  3IO1 A;  3T90 A;  4C2X A;  4U9Z A;  2PVW A;  1J4J A;  4NGM A;  1S3Z A;  4CYQ A;  5CNP A;  1WWZ A;  1HJZ A;  1ELL P;  1FNO A;  4QB9 A;  1OBR A;  4X3R A;  4B14 A;  3FEE A;  4ZYQ A;  2IQ6 A;  1F2O A;  3DR8 A;  5KTC A;  1Z8L A;  4MCP A;  2ZW7 A;  4MHP A;  3TOA A;  3TOB A;  2FL4 A;  1WK4 A;  3EY5 A;  3TO6 A;  3ZZI A;  2JEV A;  3TC8 A;  3B8G A;  3IU2 A;  1B87 A;  3KR5 A;  5I4M A;  5AIL A;  3BHX A;  2GLJ A;  4UWI A;  3IID A;  4ZY1 A;  3ETI A;  1B6B A;  2Q4Z A;  4MFP A;  3SJF A;  4ONU A;  5HIH A;  4P4D A;  3B3W A;  3H8F A;  4CYP A;  2ABZ A;  1ZR3 A;  4YWY A;  1JWQ A;  3QAH A;  4CAV A;  1ELM P;  1LRZ A;  4OC1 A;  1A2Z A;  2AFX A;  1Y9W A;  2ZEO A;  4TNU A;  4A32 A;  4MCQ A;  3ZJ0 A;  1IOI A;  1MJB A;  1S7K A;  3B7I A;  3D66 A;  3WC7 A;  1IYK A;  2AFW A;  1U6M A;  4G1P A;  4H6U A;  1VKC A;  1S7F A;  4FD4 A;  1ZG9 A;  2JEW A;  1YLO A;  4KOY A;  4OID A;  2OB0 A;  2FXF A;  4TU0 A;  5CB3 A;  2JLM A;  4OC0 A;  2AFC A;  2PCU A;  4HNX B;  4J3G A;  4LUA A;  3R96 A;  3SXN A;  4RUH A;  2V8D A;  4UFV A;  1KZF A;  1Q7L A;  1AYE A;  4KLW A;  2Z10 A;  1RXT A;  3EJF A;  2GE3 A;  4PXB A;  1AMP A;  2PJ1 A;  1P4N A;  4EWT A;  2WSA A;  3IGR A;  4ORF A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  2JDD A;  3FH4 A;  3I1U A;  3Q71 A;  3S6K A;  1CP7 A;  2DPS A;  1XE4 A;  3PRT A;  4MY3 A;  4DNC A;  2IL4 A;  4UEZ A;  3RBU A;  1YR0 A;  2FT0 A;  5C88 A;  1YQE A;  3EJG A;  3CZX A;  4NGQ A;  3BI1 A;  1NMT A;  2X47 A;  2PJ8 A;  2V8V A;  3JVN A;  1MK4 A;  2R7H A;  4O23 A;  4CGN A;  2RC4 A;  3CXS A;  1ON0 A;  2JBJ A;  2Z3O A;  2H5M A;  4GM5 A;  1BO4 A;  1EE3 P;  2YND A;  3V8I A;  1DTD A;  3KL9 A;  3KR4 A;  1S5K A;  2VL1 A;  2ZPA A;  5J8C A;  4MMO A;  2Z0Z A;  2X7B A;  4IK2 A;  2R8V A;  4MHY A;  3B3T A;  2PRB A;  2FXK A;  4FUU A;  3TCV A;  1XIX A;  4P4I A;  4BIN A;  5FSU A;  1GYT A;  4KSA A;  1ZO0 A;  2ANP A;  3SJE A;  4HKF A;  1BLL E;  2A4N A;  3EW5 A;  3TT2 A;  4AG9 A;  2R98 A;  3F5B A;  3V38 A;  3FX6 A;  3S9N A;  2FCK A;  2ZEE A;  2RB7 A;  5THW A;  2CNT A;  4YGO A;  2BFQ A;  4R3L A;  4OC3 A;  2ZEF A;  3G8W A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  4C2Y A;  1XMB A;  2V8H A;  4ZBG A;  4ZI6 A;  2CNM A;  3MGD A;  5F49 A;  1I12 A;  2PJA A;  4KUB A;  4ZY2 A;  4P45 A;  3B2Y A;  3GIU A;  5HVF A;  4CYO A;  3SHP A;  5LRJ A;  2ZOF A;  3GB0 A;  4CGL A;  2PQ8 A;  4I49 A;  4UA3 A;  4JCA A;  1CPX A;  3P2F A;  4MHD A;  4FD5 A;  1PYT B;  3CDX A;  5HH1 A;  1RO5 A;  3VFQ A;  4A94 A;  1TY8 A;  1VGY A;  4UIA A;  3SIJ A;  2Q44 A;  4JWP A;  5AG5 A;  4C2Z A;  4P44 A;  4MXU A;  1I21 A;  2GRE A;  4M6H A;  4NGP A;  2ATR A;  1M4G A;  1IB1 E;  4UBR A;  4DJL A;  1IY7 A;  3K9U A;  2WYR A;  2OU2 A;  3R9G A;  2VEZ A;  4OIW A;  3RAM A;  4A38 A;  3IFE A;  4KSI A;  3G3S A;  1UWY A;  4KOT A;  3TO7 A;  4B12 A;  2OZU A;  3SII A;  4D86 A;  1FY7 A;  2P6F A;  2P6E A;  3H4Q A;  3F8K A;  5JM6 A;  2FIA A;  2Q4Y A;  2DX6 A;  5G1Z A;  5BWA B;  1IID A;  3TX8 A;  4Q7A A;  2J8M A;  2PJ5 A;  4LQG A;  3DDD A;  2Q43 A;  4M85 A;  2BSW A;  2VQY A;  2YNE A;  3KGQ A;  4KOW A;  3KHX A;  4PK2 A;  4F0X A;  3A9L A;  5F09 A;  2POK A;  4YU9 A;  1BPN A;  3EWO A;  3EO4 A;  3LWU A;  4P10 A;  2HQY A;  5FSY A;  2FS5 A;  4PXD A;  3CT9 A;  4X8I A;  1Z5R A;  4KVO E;  5JPH A;  4J4Z A;  1VHS A;  1YRE A;  4H89 A;  4DYO A;  3N7Z A;  2L8R A;  1QST A;  3BI0 A;  3FXT A;  3D4U A;  3H5Z A;  4Q38 A;  1TF9 A;  1Z4R A;  3KQZ A;  4JYW A;  3D67 A;  3GUX A;  2EK9 A;  2V77 A;  5CMS A;  1IOF A;  2NMT A;  1K4J A;  4W9Y A;  2JZE A;  4NEX A;  4HPS A;  4ETJ A;  1CX8 A;  3IWG A;  3Q6Z A;  4OAE A;  4XPD C;  2B5G B;  4Y49 B;  3PBE A;  2KCW A;  1FT7 A;  3LMS A;  4R6T A;  2D4O A;  4QBJ A;  4P4B A;  3IWE A;  4P4J A;  1ARM A;  1QSO A;  2O53 A;  2F7V A;  3B35 A;  3DLJ A;  4MY0 A;  4CAF A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  4PV6 A;  2ZW4 A;  3FNC A;  5KTA A;  1KWM A;  4NSQ A;  4UIB A;  2FVG A;  4UCN A;  4FAI A;  5LYD A;  1IIC A;  2PJ6 A;  5FVJ A;  4F6A A;  4NGR A;  1M4D A;  2ZEH A;  4A33 A;  2G0B A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  2HUZ A;  4XPK A;  4CRY B;  3IIF A;  3NFZ A;  3W6X A;  4A37 A;  2QIR A;  2WZN A;  2XEG A;  4OC2 A;  3GPQ A;  3EWR A;  4TWE A;  1PUA A;  4CRZ B;  4NCZ A;  2R1I A;  3JRU A;  1S7N A;  3FJU A;  4PSW A;  4UCP A;  3FIX A;  4DUK A;  1QSN A;  4JD6 A;  1XFO A;  4II9 A;  1YSJ A;  4RS2 A;  3DSB A;  3QB8 A;  2FE7 A;  3RYO A;  4FD7 A;  1XMT A;  1IU8 A;  3PB9 X;  2YNC A;  4R9M A;  5IV0 A;  5LYF A;  2EEE A;  1I1D A;  5I0C A;  3HUV A;  2WPX A;  2ZEL A;  1Z9U A;  4B10 A;  1Z8X A;  4J5S A;  3D7F A;  1LCP A;  5G21 A;  3SI2 A;  4BBH A;  1YLE A;  3DGV A;  2F5I A;  4ABL A;  1Z2L A;  2Q7S A;  2GIV A;  4OAD A;  3PZJ A;  2EK8 A;  4MJ8 A;  3WC5 A;  3TE4 A;  2AFZ A;  2ZEG A;  3WC6 A;  4ETK A;  4KOV A;  3D7G A;  4A30 A;  3NE7 A;  4CPA A;  2CTC A;  3S6F A;  1R57 A;  2EWB A;  3RNZ A;  3CXP A;  2LGR A;  1ZLI A;  2B4D B;  4UF4 A;  2PSW A;  3FRM A;  4IQY A;  1TXR A;  1L0C A;  2HC9 A;  2JBK A;  4MHN A;  1TXZ A;  4B5P B;  2PJ7 A;  3D8P A;  1CP6 A;  3LD2 A;  4OLL A;  3EKE A;  1LFW A;  3T8W A;  2P0W A;  2Z3K A;  3FVL A;  2VRI A;  4BMH A;  1CPS A;  1XEB A;  2C27 A;  3ISZ A;  4U5Y A;  3WR7 A;  4XNH C;  5J8F A;  3LOD A;  3RO0 A;  5D29 A;  1CM0 A;  4IHM A;  1N71 A;  2EVN A;  3KI9 A;  3IC1 A;  4QUS A;  3PEI A;  2I00 A;  2WUU A;  4ONW A;  2VBQ A;  4X5K A;  3VWD A;  3W91 A;  2JZF A;  4JLL A;  2CY2 A;  2XEF A;  3KHZ A;  4NXY A;  2O28 A;  5H86 A;  1S7L A;  2XEJ A;  2Q7B A;  4J5R A;  5K8M A;  1AUG A;  2DXQ A;  2G9D A;  5A28 A;  4UCM A;  4UEF A;  2P6G A;  4KZT A;  5AG6 A;  2BFR A;  4FD6 A;  3GPO A;  2CTB A;  4K0C A;  2EBJ A;  4K3N A;  4CAW A;  1M44 A;  3C26 A;  2Z3P A;  2PJ4 A;  1YGH A;  3SI0 A;  4E0A A;  1Z8T A;  1TF8 A;  2CXA A;  5JH9 A;  4NGN A;  1VHO A;  4GUA A;  2JZD A;  4ABK A;  1DE4 C;  3HLP A;  3KAS A;  2FG1 A; 
#chains in the Genus database with same CATH homology
 4ESS A;  3GQE A;  3PFO A;  4Z65 A;  2F8H A;  2PJ3 A;  3PFE A;  3SJX A;  2QJ8 A;  4PPZ A;  2GU2 A;  5K8P A;  2I3C A;  2J9A A;  3FF3 A;  5E3B A;  3N5F A;  4BD9 A;  3B3C A;  5DUS A;  4F9V A;  3FED A;  3KZW A;  4PQA A;  3L2N A;  2XEI A;  5D8N A;  5LYI A;  3PB4 X;  1F2P A;  3IEH A;  4X2T A;  4J5Q A;  3PB7 X;  4JVV A;  4F8Z A;  3MRU A;  2PVV A;  1XJO A;  5DS0 A;  2BCO A;  8CPA A;  2PJC A;  3S9M A;  2C6P A;  5ELY A;  3GPG A;  3IIB A;  1TKF A;  3SJG A;  3NH5 A;  2AFM A;  1R3N A;  3WT4 A;  2XD7 A;  2OOT A;  5FSV A;  2IJZ A;  2CIJ A;  1ZR5 A;  1XRY A;  3FMC A;  4R7M A;  1ARL A;  1HDQ A;  4P4F A;  1NSA A;  5CPA A;  2AFS A;  4JZ0 A;  2RFH A;  6CPA A;  3B3S A;  5K8O A;  1LAM A;  4GVW A;  3B3V A;  3PBB A;  3SIH A;  1Y7E A;  2FAV A;  4P6Y A;  4EFD A;  4UML A;  5CB5 A;  1CBX A;  3VAT A;  4WJB A;  5LRG A;  4MRI A;  2PE3 A;  2IMO A;  4JGK A;  5JGF A;  5LYL A;  4R76 A;  2ZEP A;  2ZED A;  2GLF A;  3D7H A;  3V7Z A;  5LRK A;  4IAV A;  3EWQ A;  3K2K A;  4PXC A;  2QYV A;  4AXV A;  2DEA A;  3GQO A;  4B6Z A;  1RTQ A;  4MCS A;  5HOL A;  3RZA A;  4H2K A;  2Q51 A;  3KQX A;  5K8N A;  1YW6 A;  1R43 A;  1YW4 A;  3K9T A;  1PCA A;  2V8G A;  3CPX A;  5HVG A;  4KYB A;  3H8E A;  2O4H A;  1QQ9 A;  3NH8 A;  4R8F A;  1F57 A;  4MCR A;  1TKJ A;  1TKH A;  5HXD A;  1JQG A;  4OKO A;  2C6C A;  2ACF A;  4FWU A;  1BAV A;  4YU9 A;  4A39 A;  1XBU A;  2AFO A;  4OME A;  2PJB A;  3V2B A;  1Y0Y A;  2PRQ A;  4GVV A;  5FSX A;  4NFR A;  4OC4 A;  1IGB A;  3EWP A;  5CBM A;  1VHE A;  3PB6 X;  4PXE A;  3D7D A;  3H8G A;  2NYQ A;  3ISX A;  1QMU A;  4NGS A;  3VH9 A;  3PB8 X;  5IB9 A;  3D68 A;  3NA6 A;  2PJ2 A;  1VIX A;  4ZX8 A;  1LAP A;  2HB6 A;  4P4E A;  1YME A;  4EME A;  2PIZ A;  1BPM A;  4NJR A;  2ZEM A;  3VAR A;  1LAN A;  2AFU A;  1SPV A;  1HEE A;  4ZY0 A;  2BOA A;  2PJ0 A;  1VHU A;  3V45 A;  3MN8 A;  3FEC A;  4NGT A;  1H8L A;  4NJQ A;  2BO9 A;  2CF4 A;  2PJ9 A;  2OR4 A;  1ZG7 A;  1ZG8 A;  5FSZ A;  4ZX9 A;  3JZT A;  4OP4 A;  3S9L A;  1NJR A;  4OC5 A;  4MHZ A;  2PIY A;  3BXM A;  5J1Q A;  1HDU A;  1YD9 A;  2QVP A;  3NH4 A;  3SIG A;  3WAB A;  1ZLH A;  3IO1 A;  2C6G A;  2PVW A;  4NGM A;  1HJZ A;  1ELL P;  1FNO A;  4X3R A;  1OBR A;  3FEE A;  4ZYQ A;  2IQ6 A;  1F2O A;  1Z8L A;  4MCP A;  4MHP A;  3TC8 A;  3KR5 A;  5I4M A;  5AIL A;  3BHX A;  2GLJ A;  3IID A;  4ZY1 A;  3ETI A;  2Q4Z A;  3SJF A;  5HIH A;  4P4D A;  3B3W A;  3H8F A;  2ABZ A;  1ZR3 A;  4YWY A;  1ELM P;  4OC1 A;  2ZEO A;  2AFX A;  4TNU A;  4MCQ A;  3B7I A;  3D66 A;  3WC7 A;  2AFW A;  4G1P A;  1ZG9 A;  2JEW A;  1YLO A;  4OID A;  4TU0 A;  5CB3 A;  4OC0 A;  2AFC A;  2PCU A;  4RUH A;  2V8D A;  1Q7L A;  1AYE A;  3EJF A;  4PXB A;  1AMP A;  2PJ1 A;  4EWT A;  4F9U A;  1CG2 A;  2ZOG A;  3IJ3 A;  2NSM A;  3FH4 A;  3I1U A;  3Q71 A;  1CP7 A;  3PRT A;  4UEZ A;  3RBU A;  3EJG A;  4NGQ A;  3BI1 A;  2X47 A;  2PJ8 A;  2V8V A;  4O23 A;  2JBJ A;  4GM5 A;  1EE3 P;  1DTD A;  3KL9 A;  3KR4 A;  2VL1 A;  4MMO A;  4IK2 A;  4MHY A;  3B3T A;  2FXK A;  4FUU A;  4P4I A;  5FSU A;  1GYT A;  2ANP A;  3SJE A;  1BLL E;  3EW5 A;  3V38 A;  3FX6 A;  3S9N A;  2ZEE A;  2RB7 A;  5THW A;  2BFQ A;  4OC3 A;  2ZEF A;  4FBE A;  2C1C A;  7CPA A;  4UEE A;  1M4L A;  1XMB A;  2V8H A;  4ZI6 A;  2PJA A;  4ZY2 A;  4P45 A;  3B2Y A;  5HVF A;  5LRJ A;  2ZOF A;  3GB0 A;  4JCA A;  1CPX A;  1PYT B;  3CDX A;  3VFQ A;  4A94 A;  1TY8 A;  1VGY A;  4UIA A;  3SIJ A;  4P44 A;  4MXU A;  2GRE A;  4NGP A;  4DJL A;  1IY7 A;  2WYR A;  4A38 A;  4OIW A;  3RAM A;  3IFE A;  4KSI A;  1UWY A;  3SII A;  4D86 A;  5JM6 A;  2DX6 A;  3TX8 A;  4Q7A A;  2PJ5 A;  4LQG A;  5JH9 A;  2Q43 A;  3KGQ A;  3KHX A;  5F09 A;  2POK A;  1BPN A;  3EWO A;  3LWU A;  4P10 A;  5FSY A;  4PXD A;  3CT9 A;  4X8I A;  1Z5R A;  4J4Z A;  4DYO A;  2L8R A;  3BI0 A;  3D4U A;  1TF9 A;  3KQZ A;  4JYW A;  3D67 A;  3GUX A;  2V77 A;  2EK9 A;  5CMS A;  4W9Y A;  4ETJ A;  1CX8 A;  3Q6Z A;  3PBE A;  1FT7 A;  3LMS A;  4R6T A;  4P4B A;  4P4J A;  1ARM A;  2O53 A;  2F7V A;  3B35 A;  3DLJ A;  5HVH A;  1LOK A;  3IWW A;  2ZEN A;  1Y0R A;  3QNV A;  1KWM A;  4UIB A;  2FVG A;  4FAI A;  5LYD A;  2PJ6 A;  4NGR A;  2ZEH A;  3SI1 A;  3GLJ A;  4WWV A;  3CPA A;  3IIF A;  3NFZ A;  4A37 A;  2XEG A;  2WZN A;  4OC2 A;  3GPQ A;  3EWR A;  4TWE A;  3JRU A;  3FJU A;  4DUK A;  1XFO A;  1YSJ A;  3PB9 X;  5LYF A;  2EEE A;  3HUV A;  2ZEL A;  4J5S A;  3D7F A;  1LCP A;  3SI2 A;  3DGV A;  4ABL A;  1Z2L A;  2EK8 A;  3WC5 A;  2AFZ A;  2ZEG A;  3WC6 A;  4ETK A;  3D7G A;  4CPA A;  2CTC A;  2EWB A;  2LGR A;  1ZLI A;  4UF4 A;  4IQY A;  1TXR A;  2HC9 A;  2JBK A;  4MHN A;  1TXZ A;  2PJ7 A;  1CP6 A;  3EKE A;  1LFW A;  3T8W A;  3FVL A;  2VRI A;  1CPS A;  3ISZ A;  5D29 A;  4IHM A;  3KI9 A;  3IC1 A;  3PEI A;  4ONW A;  4JLL A;  2XEF A;  3KHZ A;  2XEJ A;  5K8M A;  4J5R A;  2G9D A;  4UEF A;  2BFR A;  3GPO A;  2CTB A;  4K0C A;  4K3N A;  3SI0 A;  2PJ4 A;  1TF8 A;  4NGN A;  1VHO A;  4GUA A;  4ABK A;  1DE4 C;  3HLP A;  3KAS A;  2FG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...