3KR5A

Structure of a protease 4
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 181
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr5A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr5A02
3SI2A 2PVWA 2BO9A 3Q6ZA 3FECA 2FG1A 5HVFA 5K8NA 3S9MA 2V8GA 4CPAA 4ABLA 2PJ9A 2PJ8A 5FSVA 3V2BA 1TXZA 1ZLHA 1F2PA 4NGSA 4ZX8A 6CPAA 1BPNA 4Z65A 4KYBA 3KHXA 2Q43A 3B3CA 1CPXA 5FSUA 2AFWA 1IGBA 4D86A 3FMCA 4F9VA 5JGFA 3FEDA 3ISXA 3SIGA 3D4UA 4MHNA 4MHZA 4IQYA 3HUVA 5JM6A 2I3CA 4P45A 4MXUA 4P4JA 5K8PA 1JQGA 2X47A 4IAVA 3CT9A 4YWYA 2RB7A 3PEIA 3BI1A 4LQGA 3B3TA 4P4FA 4ESSA 4GVWA 2PIYA 2GREA 3GLJA 1CPSA 1UWYA 2PJ6A 4NJRA 4MCPA 4ZY1A 4PQAA 2AFXA 1VHUA 2JBJA 3JRUA 1CBXA 3IIBA 4PXDA 4DYOA 2Q51A 1ZLIA 1FNOA 3EJFA 5CPAA 3BHXA 5LYLA 2PE3A 2ZEOA 4P44A 1VHOA 2XEJA 3BXMA 4K3NA 3V45A 2ZEGA 2ZEDA 4YU9A 3TC8A 3IWWA 3NH5A 4NJQA 2CIJA 4R6TA 4EWTA 1XFOA 5J1QA 3DLJA 2EWBA 1Z8LA 2ABZA 2ZOFA 2PJ0A 3B3SA 2C6GA 2FXKA 1TKHA 3PB8X 4OIDA 4IHMA 4OC2A 4WJBA 3WC6A 5LRGA 3ISZA 3FJUA 4KSIA 4NFRA 2V8DA 4UEZA 3EW5A 3KQXA 1M4LA 5LYFA 3S9NA 4MHYA 4OC0A 4MRIA 4O23A 1Y0YA 1HEEA 4X2TA 4JVVA 3FF3A 1KWMA 3GUXA 4J5SA 5IB9A 3IIFA 4UEEA 4UIBA 4J4ZA 5JH9A 3H8EA 5AILA 2AFMA 3Q71A 3VATA 1ELMP 2VRIA 1HDUA 2PJ1A 3NA6A 2ZENA 3B3WA 1XMBA 2ZEEA 1PYTB 2C6CA 4ZY0A 5CMSA 3KASA 4DJLA 1LFWA 2CF4A 3MRUA 4UEFA 5THWA 2PRQA 2V8HA 1QQ9A 2XEIA 1DE4C 4NGMA 3K2KA 1CG2A 1Y7EA 2PVVA 2C6PA 1F57A 3ETIA 2G9DA 1LAMA 4IK2A 5CBMA 3SI0A 3VH9A 5LYDA 1ZR3A 3GQOA 1Y0RA 2LGRA 3H8GA 3IJ3A 2IJZA 3PFOA 2PJ5A 1YW4A 1TY8A 3PB4X 3VFQA 2XD7A 1HDQA 3EJGA 1H8LA 2ZEPA 3KI9A 2GLFA 1CP7A 5LRJA 2AFSA 2V8VA 2GU2A 1R3NA 5HVHA 5F09A 1VHEA 3SI1A 1LCPA 4P10A 4W9YA 4AXVA 3JZTA 4JYWA 2O53A 4MHPA 1HJZA 3FVLA 4NGPA 2PJ3A 5K8MA 4PXEA 2EK9A 3IC1A 4ZI6A 3GPQA 3CPAA 3WT4A 3IEHA 1AMPA 4OP4A 4X8IA 2PJ7A 4MMOA 3D7GA 3WABA 4K0CA 1VGYA 2RFHA 4R8FA 2ZELA 4ZX9A 2HB6A 3D7HA 5HXDA 2POKA 2ZOGA 1ELLP 3PB6X 3SIHA 4ONWA 3D7FA 3NH8A 1Q7LA 3FX6A 4X3RA 3SJFA 3SJGA 1TKFA 1BLLE 4ETJA 1XJOA 1BAVA 3GPGA 1YSJA 1VIXA 4NGQA 2VL1A 2QYVA 4ABKA 1DTDA 4R7MA 3EKEA 2OOTA 2WYRA 1YW6A 1LOKA 3KZWA 3EWPA 3IIDA 2PJAA 4MCRA 3T8WA 3QNVA 1ARMA 5HOLA 3GQEA 2BOAA 3D67A 4DUKA 7CPAA 4P4BA 2ANPA 3WC7A 4ZYQA 3GB0A 4J5QA 1LAPA 1FT7A 3B3VA 2F7VA 1OBRA 1Z5RA 3WC5A 3H8FA 2BFQA 4BD9A 2F8HA 3L2NA 2DX6A 3RBUA 2FAVA 3PB7X 1NJRA 2XEGA 3TX8A 3PBBA 2ZEMA 2XEFA 3PBEA 2O4HA 1YD9A 1RTQA 2PJ2A 5DS0A 4TNUA 2PJ4A 1ZR5A 3FH4A 5DUSA 1CX8A 3D7DA 2PJCA 5CB3A 4P4DA 3V7ZA 3V38A 1NSAA 3SJEA 4F9UA 1SPVA 4TWEA 4NGRA 1CP6A 4EMEA 1IY7A 2NYQA 3FEEA 1ZG8A 1YLOA 4JLLA 2OR4A 5HVGA 3SJXA 4FAIA 2PJBA 3DGVA 4B6ZA 2IMOA 4JZ0A 3CPXA 3D66A 4GUAA 3D68A 4OMEA 4Q7AA 3MN8A 2CTBA 4H2KA 4PXCA 3KL9A 4FUUA 3K9TA 3KHZA 4FWUA 3EWQA 1F2OA 2QVPA 2JEWA 4P6YA 4WWVA 1TKJA 5E3BA 2Q4ZA 4UIAA 1XBUA 3IO1A 2BFRA 3PFEA 1R43A 2V77A 3VARA 4OC3A 4UMLA 2QJ8A 3LMSA 4FBEA 3B2YA 4MCQA 2AFOA 3NH4A 3PRTA 2ACFA 4OKOA 5CB5A 3B7IA 3PB9X 2L8RA 5LYIA 4RUHA 2HC9A 4PXBA 4EFDA 5I4MA 2AFZA 1GYTA 4UF4A 2C1CA 1BPMA 4A39A 1XRYA 5ELYA 2PCUA 2GLJA 1LANA 1EE3P 5D8NA 4R76A 1ZG9A 2IQ6A 5D29A 3HLPA 4OC4A 2DEAA 4JGKA 2EEEA 4GM5A 5K8OA 1TXRA 3GPOA 1ARLA 3S9LA 1ZG7A 3EWRA 8CPAA 4J5RA 2AFCA 2ZEHA 4GVVA 2NSMA 2EK8A 3KGQA 3N5FA 3LWUA 1YMEA 4PPZA 4MCSA 3KR5A 4OIWA 4NGNA 4NGTA 5FSZA 3BI0A 1AYEA 1Z2LA 2AFUA 2WZNA 4G1PA 4P4IA 4OC1A 3SIIA 4ZY2A 3NFZA 4OC5A 2FVGA 2CTCA 2BCOA 5HIHA 4F8ZA 3IFEA 4JCAA 3KQZA 1QMUA 2PIZA 2ZEFA 3SIJA 3EWOA 5FSYA 3RZAA 3I1UA 2JBKA 4TU0A 1TF9A 3B35A 3KR4A 3CDXA 3RAMA 1TF8A 4A94A 4A37A 2J9AA 1PCAA 4A38A 5LRKA 4P4EA 5FSXA 4ETKA
chains in the Genus database with same CATH superfamily
3OWCA 3SI2A 2PVWA 3TO9A 4XNHC 3ZZIA 1Z4RA 2BO9A 3Q6ZA 3FECA 2P6GA 2FG1A 5HVFA 5BWAB 5K8NA 2GE3A 3S9MA 2V8GA 4K30A 2OZGA 4CPAA 4AG9A 4ABLA 2PJ9A 2YNEA 4UWIA 2PJ8A 5FSVA 3V2BA 2FIAA 5HH1A 3N7ZA 3FRMA 3ZJ0A 2JLMA 1TXZA 1ZLHA 5H86A 1F2PA 4NGSA 4ZX8A 6CPAA 1BPNA 5ISVA 4BBHA 4Z65A 4KYBA 4JXQA 1JWQA 3KHXA 2Q43A 3PGPA 3B3CA 4AVAA 2FT0A 4CAWA 1CPXA 5FSUA 2AFWA 1IGBA 2GIVA 4D86A 1BOBA 3FMCA 1CJWA 4F9VA 5JGFA 4A2ZA 4A33A 3FEDA 1WK4A 3ISXA 4JLYA 1KUYA 1FY7A 3SIGA 1AUGA 2GANA 3D4UA 4JXRA 4MHNA 4MHZA 4IQYA 3HUVA 5JM6A 4MFZA 2I3CA 3G3SA 4MXUA 4P45A 5GCNA 2W2GA 2OH1A 3LACA 2WPWA 4P4JA 4E2AA 3UY5A 5K8PA 1JQGA 2X47A 1B6BA 2Z11A 3TE4A 4IAVA 2YNCA 3CT9A 2RB7A 3PEIA 3BI1A 4LQGA 4PSWA 3B3TA 4P4FA 1ON0A 5G21A 1Y9KA 1QSTA 1Z9UA 4ESSA 4X5KA 4B12A 2Q7SA 1BO4A 3D2MA 2G3TA 2DF5A 2ODFA 2D4OA 1X12A 4KOUA 4GVWA 3R95A 5DWNA 2IL4A 1J4JA 1NE9A 4XPLA 2PIYA 5JPHA 2VZZA 2GREA 3GLJA 1X10A 1CPSA 4NSQA 1UWYA 1R57A 2PJ6A 4NJRA 2J8NA 4MCPA 5C88A 4ZY1A 4PQAA 2AFXA 4Q38A 3SHPA 1VHUA 2JBJA 3JRUA 1CBXA 3IIBA 3LD2A 4PXDA 4DYOA 4MJ8A 4KOVA 2Q51A 3TO7A 1ZLIA 2OZHA 1FNOA 3R9FA 3NE8A 3EJFA 5CPAA 1MJAA 3BHXA 5LYLA 1I12A 4MI4A 2PE3A 2ZEOA 1IIDA 2B4DB 1S7LA 1VHOA 2XEJA 3BXMA 4P44A 3TOBA 2VXKA 4KOWA 4K3NA 3V45A 2ZEGA 2ZEDA 4YU9A 3TC8A 3IWWA 4L89A 3NH5A 4NJQA 1RO5A 2CIJA 4R6TA 4B5OA 3JTKA 4EWTA 1XFOA 3P2HA 2PR8A 4MFLA 4NEXA 5J1QA 2VI7A 2H5MA 3DLJA 3DR6A 3TO6A 5E96A 2EWBA 4R57A 1RXTA 1Z8LA 3CXQA 2ABZA 2ZOFA 2PJ0A 3B3SA 4UCPA 2C6GA 2FXKA 4YGOA 1TKHA 3DSBA 3PB8X 4A32A 4HNYB 2RNKA 1V0CA 1ZO0A 2QIRA 4OIDA 4IHMA 4OC2A 1Z4EA 4WJBA 3WC6A 5LRGA 2Q7BA 3W6XA 2KQVA 3ISZA 4HNXB 2CY2A 2VEZA 3R96A 3FJUA 2QMLA 3A9LA 4KSIA 4GS4A 1Z8WA 2FE7A 2V8DA 4NFRA 5FVJA 4B13A 4UEZA 4JJXA 3EW5A 2JZFA 3KQXA 1K4JA 1M4LA 1WWZA 1UFHA 5LYFA 3S9NA 4MHYA 4OC0A 1XE4A 4BINA 2Z3LA 4PSXA 4MRIA 2EO8A 4UFWA 1M4DA 4O23A 1Y0YA 1HEEA 4X2TA 4JVVA 3FF3A 1KWMA 2VZYA 2Z3PA 4U9ZA 3GUXA 2B3VA 4J5SA 4B10A 3TTHA 5IB9A 3IIFA 2PR1A 4M6IA 4UEEA 4UIBA 5EC4A 4UCNA 4J4ZA 2P6FA 5JH9A 4KZTA 3H8EA 5AILA 2AFMA 2J8MA 4RS2A 3Q71A 3P2FA 4HKFA 4LQ6A 1KUXA 3IU1A 5AG6A 4CGLA 2QECA 3VATA 1ELMP 5IB0A 2VRIA 1HDUA 2PJ1A 3NA6A 2ZENA 2ZPAA 3B3WA 1XMBA 2ZEEA 1PYTB 2C6CA 4ZY0A 2YNDA 5CMSA 3F0AA 3KASA 4KOSA 4DJLA 1LFWA 2CF4A 3G8WA 3MRUA 2Q04A 4UEFA 5THWA 4C7HA 3V8IA 2PRQA 2V8HA 4A31A 1QQ9A 2XEIA 1DE4C 3GKRA 3GYAA 4NGMA 1S7NA 3K2KA 1CG2A 5EMIA 4CRYB 5IX3A 1Y7EA 2PVVA 2C6PA 1F57A 3ETIA 1IB1E 2G9DA 1LAMA 3FBUA 4LUAA 4IK2A 4E0AA 3TFYA 5CBMA 3SI0A 4QBJA 2CNMA 3VH9A 2JDDA 5LYDA 1ZR3A 3GQOA 1Y0RA 4FD5A 4KOYA 4UCMA 2LGRA 1PU9A 3H8GA 2JZDA 3IJ3A 2IJZA 3PFOA 4B14A 2PJ5A 3IGRA 1YW4A 1TY8A 2R98A 3PB4X 3VFQA 1B87A 2JDCA 2XD7A 1HDQA 4KUAA 4QVTA 3EJGA 4H6ZA 4KS9A 4KLWA 1H8LA 5AG7A 2G3AA 2ZEPA 3F5BA 4JD6A 3QAHA 3KI9A 4UWJA 2GLFA 1S60A 1CP7A 2EUIA 1P4NA 4CYOA 2B5GA 1XOVA 5LRJA 2AFSA 2V8VA 2GU2A 4QB9A 4CYNA 2I00A 1I21A 1R3NA 2X7BA 3R9EA 5HVHA 5F09A 1VHEA 3SI1A 1XMTA 1LCPA 1S5KA 4P10A 2FS5A 4W9YA 4AXVA 1OZPA 4KVME 4CGOA 3JZTA 4JYWA 4MFQA 4II9A 2O53A 5JQ4A 4MHPA 5H84A 4FD7A 1HJZA 2FXFA 3SXNA 1XEBA 4PK3A 4UFVA 1IOFA 3FVLA 4NGPA 2PJ3A 5K8MA 4PXEA 2DPSA 4FD4A 2EK9A 3DR8A 3LODA 2DXQA 3IC1A 4U9YA 4Q36A 4ZI6A 3GPQA 1PUAA 2I79A 2R7HA 3CPAA 4Y49B 2BL1A 2REFA 1QSMA 3IEHA 3EXNA 3WT4A 3PZJA 1AMPA 2BEIA 2P0WA 4MHDA 1MJBA 4OP4A 1MK4A 4X8IA 4A95A 2PJ7A 3S6FA 4MMOA 5J8CA 3D7GA 3PP9A 4QC6A 3WABA 3FYNA 4XNHB 4K0CA 1VGYA 2RFHA 4OLLA 4J3GA 4R8FA 2ZELA 1YGHA 1LRZA 4R87A 4KVOE 4ZX9A 2HB6A 3D7HA 4L8AA 2F5IA 1YREA 3BLNA 5HXDA 2POKA 2ZOGA 1ELLP 2D4PA 3EFAA 3GY9A 4RI1A 3QAYA 3PB6X 3SIHA 4ONWA 3D7FA 2WPXA 3NH8A 1Q7LA 3FX6A 4X3RA 3SJFA 3RYOA 3SJGA 3WR7A 5F48A 2B4BA 3S6HA 1TKFA 2FSRA 1BLLE 4ETJA 1M44A 3B8GA 1XJOA 4RN7A 5F47A 4OADA 1BAVA 3GPGA 2PRBA 1YSJA 2JEVA 1VIXA 4NGQA 2FL4A 2VL1A 4UA3A 1MJ9A 1QSRA 2QYVA 4GXHA 4KSFA 2RC4A 4ABKA 4M3SA 2OB0A 1DTDA 4CAEA 3W91A 4R7MA 2VBQA 1NSLA 3EKEA 2JZEA 2OOTA 2WYRA 1YW6A 1LOKA 3KZWA 3EWPA 2ZXVA 3IIDA 2PJAA 5C82A 4MCRA 4KOXA 3T8WA 4CAVA 3IWGA 3QNVA 5HMNA 1IOIA 1ARMA 2WCTA 5HOLA 1XF8A 3GQEA 1TIQA 4CS0B 4C2YA 2BOAA 3D67A 4DUKA 2Q0YA 4R3KA 3DNSA 7CPAA 4P4BA 2ANPA 4C2ZA 4F0YA 2PQ8A 4M85A 3WC7A 4ZYQA 3GB0A 3NE7A 5F49A 4J5QA 1LAPA 2Y0MA 3S6GA 1FT7A 4B11A 3B3VA 5KTAA 2F7VA 4XPKA 4UBRA 1OBRA 1CM0A 1Z5RA 1SQHA 3CXPA 3WC5A 3C26A 3H8FA 2BFQA 4BD9A 2F8HA 3L2NA 4MBUA 5CNPA 2VQYA 4R9MA 4U5YA 2DX6A 3VWDA 2G0BA 4M6GA 3RBUA 4OAEA 4XPDB 2FAVA 5DWMA 1M4IA 3PB7X 4CYQA 2PDOA 3D3SA 1NJRA 4KVXA 3T90A 2O28A 2Q44A 2XEGA 3R1KA 3TX8A 3PBBA 2DPTA 2Z3OA 2ZEMA 3T9YA 2ARHA 2XEFA 3PBEA 2O4HA 1KUVA 2ZW4A 3H4QA 4B5PA 1YD9A 1RTQA 2PJ2A 4CAFA 4CGPA 5J8FA 2B5GB 5DS0A 4TNUA 4C68A 2PJ4A 1ZR5A 1Q2CA 3FH4A 5DUSA 1CX8A 3CZXA 3D7DA 3W6SA 2PJCA 2GFQA 5CB3A 2WUUA 4P4DA 4HNWB 3V7ZA 1VHSA 1NSAA 3V38A 2K5TA 2EBJA 2OZUA 3SJEA 2BUEA 3DDDA 4C7IA 2PSWA 4F9UA 1SPVA 4TWEA 4KUBA 1Y9WA 4NGRA 4DNCA 1GHEA 2Z3NA 1CP6A 4MFKA 2CNTA 3RNZA 2Z3MA 4YWYA 4EMEA 1IY7A 3VWEA 2NYQA 3TCVA 5I0CA 2HUZA 3FEEA 4H6UA 1ZG8A 1YLOA 4JLLA 4CYPA 2OR4A 5HVGA 3SJXA 2Z0ZA 4FAIA 4QUSA 2PJBA 3DGVA 4B6ZA 1Y7RA 2IMOA 4JZ0A 3CPXA 4EVYA 3D66A 4IF5A 3I3GA 4GUAA 4ZGYB 3D68A 4JWPA 4OMEA 5AGEA 4YFJA 3FXTA 4Q7AA 4R3LA 3MN8A 2CTBA 4AG7A 4H2KA 2BSWA 4PXCA 3IWEA 3KL9A 1I1DA 3K9UA 4FUUA 2OU2A 3K9TA 4ZBGA 3D8PA 2KCWA 3KHZA 4MY0A 4FWUA 4BMHA 1QSOA 3EWQA 1IYKA 1F2OA 3CXSA 2Z3KA 2QVPA 3BJ8A 2JEWA 4P6YA 4WWVA 1TKJA 3E0KA 4I49A 2HQYA 1KZFA 2Q4YA 2ZW5A 3QB8A 5E3BA 3TOAA 1XIXA 1YR0A 2CNSA 2Q4ZA 4UIAA 4PK2A 4UFXA 1XBUA 1YK3A 2P6EA 4YRHA 3IO1A 2BFRA 5G20A 3PFEA 1R43A 3EO4A 2HV2A 1YVKA 2V77A 3VARA 1Z8TA 4OC3A 4UMLA 1S3ZA 2QJ8A 2AE6A 3JUWA 3LMSA 4FBEA 3TT2A 3GIUA 3B2YA 4MCQA 2NMTA 4CAXA 2AFOA 3NH4A 3PRTA 2ACFA 4OKOA 2B3UA 4KOTA 5AG5A 5CB5A 3B7IA 2AJ6A 2FCKA 2CXAA 1YLEA 3F8KA 3PB9X 2L8RA 5LYIA 2FIWA 4FD6A 4M6HA 1Z8XA 2ZW7A 2HC9A 4RUHA 4PXBA 4EFDA 5I4MA 4NCZA 2AFZA 1IU8A 1Q2YA 2R8VA 1GYTA 4UF4A 2C1CA 3EC4A 1BPMA 5G1ZA 4A39A 1XRYA 4XPDC 5KTCA 3S6KA 5ELYA 1L0CA 1M1DA 2PCUA 2GLJA 1LANA 4F6AA 1YX0A 1EE3P 1NMTA 4CRZB 5D8NA 3MGDA 4R76A 3I9SA 3JVNA 1ZG9A 2IQ6A 5D29A 1U6MA 3HLPA 4AVBA 3RO0A 5IV0A 2REEA 4OC4A 4MFJA 4HPSA 2DEAA 2YNCC 4JGKA 4KORA 5A28A 4MY3A 2EEEA 4GM5A 5K8OA 1TXRA 4ONUA 5EBVA 3GPOA 1ARLA 1QSNA 2C27A 4A30A 3S9LA 1ZG7A 3EWRA 4F0XA 3KKWA 2PC1A 8CPAA 4J5RA 1IYLA 4B5PB 2AFCA 2ZEHA 5F46A 1VKCA 2A4NA 4GVVA 1S7KA 4E8OA 5KTDA 2Q4VA 4IUSA 2NSMA 2EK8A 3KGQA 3N5FA 3R9GA 4AVCA 3LWUA 3EY5A 1YMEA 4PPZA 5A27A 4MCSA 3KR5A 2ZW6A 4OIWA 4NGNA 4ORFA 4AB7A 2J8RA 4NGTA 1N71A 4MFPA 2WSAA 1S7FA 5FSZA 3BI0A 1AYEA 1Z2LA 2AFUA 2WZNA 4G1PA 4KLVA 4NF1A 1IICA 4OC1A 3SIIA 4P4IA 4ZY2A 2B58A 2YGWA 3NFZA 4OC5A 1Q2DA 2FVGA 2B4DA 2CTCA 2BCOA 2R1IA 3H5ZA 5HIHA 4F8ZA 3IFEA 4JCAA 3KQZA 3FB3A 1QMUA 2PIZA 4CGMA 2ZEFA 3SIJA 4CGNA 3FIXA 1A2ZA 2ATRA 2Z10A 3EWOA 5FSYA 3RZAA 3I1UA 1P0HA 2JBKA 3IU2A 4TU0A 1TF9A 3SXOA 4KSAA 3B35A 4C2XA 3KR4A 3CDXA 3RAMA 1TF8A 4A94A 4PV6A 1M4GA 4H89A 4A37A 4NXYA 1YQEA 2J9AA 1PCAA 2EVNA 3FNCA 4Y49C 5G22A 4A38A 3BJ7A 5LRKA 4LX9A 1YVOA 4P4EA 5FSXA 5AG4A 3D2PA 4ETKA
chains in the Genus database with same CATH topology
3SI2A 2PVWA 2BO9A 3Q6ZA 3FECA 2FG1A 5HVFA 5K8NA 3S9MA 2V8GA 4CPAA 4ABLA 2PJ9A 2PJ8A 5FSVA 3V2BA 1TXZA 1ZLHA 1F2PA 4NGSA 4ZX8A 6CPAA 1BPNA 4Z65A 4KYBA 3KHXA 2Q43A 3B3CA 1CPXA 5FSUA 2AFWA 1IGBA 4D86A 3FMCA 4F9VA 5JGFA 3FEDA 3ISXA 3SIGA 3D4UA 4MHNA 4MHZA 4IQYA 3HUVA 5JM6A 2I3CA 4P45A 4MXUA 4P4JA 5K8PA 1JQGA 2X47A 4IAVA 3CT9A 4YWYA 2RB7A 3PEIA 3BI1A 4LQGA 3B3TA 4P4FA 4ESSA 4GVWA 2PIYA 2GREA 3GLJA 1CPSA 1UWYA 2PJ6A 4NJRA 4MCPA 4ZY1A 4PQAA 2AFXA 1VHUA 2JBJA 3JRUA 1CBXA 3IIBA 4PXDA 4DYOA 2Q51A 1ZLIA 1FNOA 3EJFA 5CPAA 3BHXA 5LYLA 2PE3A 2ZEOA 4P44A 1VHOA 2XEJA 3BXMA 4K3NA 3V45A 2ZEGA 2ZEDA 4YU9A 3TC8A 3IWWA 3NH5A 4NJQA 2CIJA 4R6TA 4EWTA 1XFOA 5J1QA 3DLJA 2EWBA 1Z8LA 2ABZA 2ZOFA 2PJ0A 3B3SA 2C6GA 2FXKA 1TKHA 3PB8X 4OIDA 4IHMA 4OC2A 4WJBA 3WC6A 5LRGA 3ISZA 3FJUA 4KSIA 4NFRA 2V8DA 4UEZA 3EW5A 3KQXA 1M4LA 5LYFA 3S9NA 4MHYA 4OC0A 4MRIA 4O23A 1Y0YA 1HEEA 4X2TA 4JVVA 3FF3A 1KWMA 3GUXA 4J5SA 5IB9A 3IIFA 4UEEA 4UIBA 4J4ZA 5JH9A 3H8EA 5AILA 2AFMA 3Q71A 3VATA 1ELMP 2VRIA 1HDUA 2PJ1A 3NA6A 2ZENA 3B3WA 1XMBA 2ZEEA 1PYTB 2C6CA 4ZY0A 5CMSA 3KASA 4DJLA 1LFWA 2CF4A 3MRUA 4UEFA 5THWA 2PRQA 2V8HA 1QQ9A 2XEIA 1DE4C 4NGMA 3K2KA 1CG2A 1Y7EA 2PVVA 2C6PA 1F57A 3ETIA 2G9DA 1LAMA 4IK2A 5CBMA 3SI0A 3VH9A 5LYDA 1ZR3A 3GQOA 1Y0RA 2LGRA 3H8GA 3IJ3A 2IJZA 3PFOA 2PJ5A 1YW4A 1TY8A 3PB4X 3VFQA 2XD7A 1HDQA 3EJGA 1H8LA 2ZEPA 3KI9A 2GLFA 1CP7A 5LRJA 2AFSA 2V8VA 2GU2A 1R3NA 5HVHA 5F09A 1VHEA 3SI1A 1LCPA 4P10A 4W9YA 4AXVA 3JZTA 4JYWA 2O53A 4MHPA 1HJZA 3FVLA 4NGPA 2PJ3A 5K8MA 4PXEA 2EK9A 3IC1A 4ZI6A 3GPQA 3CPAA 3WT4A 3IEHA 1AMPA 4OP4A 4X8IA 2PJ7A 4MMOA 3D7GA 3WABA 4K0CA 1VGYA 2RFHA 4R8FA 2ZELA 4ZX9A 2HB6A 3D7HA 5HXDA 2POKA 2ZOGA 1ELLP 3PB6X 3SIHA 4ONWA 3D7FA 3NH8A 1Q7LA 3FX6A 4X3RA 3SJFA 3SJGA 1TKFA 1BLLE 4ETJA 1XJOA 1BAVA 3GPGA 1YSJA 1VIXA 4NGQA 2VL1A 2QYVA 4ABKA 1DTDA 4R7MA 3EKEA 2OOTA 2WYRA 1YW6A 1LOKA 3KZWA 3EWPA 3IIDA 2PJAA 4MCRA 3T8WA 3QNVA 1ARMA 5HOLA 3GQEA 2BOAA 3D67A 4DUKA 7CPAA 4P4BA 2ANPA 3WC7A 4ZYQA 3GB0A 4J5QA 1LAPA 1FT7A 3B3VA 2F7VA 1OBRA 1Z5RA 3WC5A 3H8FA 2BFQA 4BD9A 2F8HA 3L2NA 2DX6A 3RBUA 2FAVA 3PB7X 1NJRA 2XEGA 3TX8A 3PBBA 2ZEMA 2XEFA 3PBEA 2O4HA 1YD9A 1RTQA 2PJ2A 5DS0A 4TNUA 2PJ4A 1ZR5A 3FH4A 5DUSA 1CX8A 3D7DA 2PJCA 5CB3A 4P4DA 3V7ZA 3V38A 1NSAA 3SJEA 4F9UA 1SPVA 4TWEA 4NGRA 1CP6A 4EMEA 1IY7A 2NYQA 3FEEA 1ZG8A 1YLOA 4JLLA 2OR4A 5HVGA 3SJXA 4FAIA 2PJBA 3DGVA 4B6ZA 2IMOA 4JZ0A 3CPXA 3D66A 4GUAA 3D68A 4OMEA 4Q7AA 3MN8A 2CTBA 4H2KA 4PXCA 3KL9A 4FUUA 3K9TA 3KHZA 4FWUA 3EWQA 1F2OA 2QVPA 2JEWA 4P6YA 4WWVA 1TKJA 5E3BA 2Q4ZA 4UIAA 1XBUA 3IO1A 2BFRA 3PFEA 1R43A 2V77A 3VARA 4OC3A 4UMLA 2QJ8A 3LMSA 4FBEA 3B2YA 4MCQA 2AFOA 3NH4A 3PRTA 2ACFA 4OKOA 5CB5A 3B7IA 3PB9X 2L8RA 5LYIA 4RUHA 2HC9A 4PXBA 4EFDA 5I4MA 2AFZA 1GYTA 4UF4A 2C1CA 1BPMA 4A39A 1XRYA 5ELYA 2PCUA 2GLJA 1LANA 1EE3P 5D8NA 4R76A 1ZG9A 2IQ6A 5D29A 3HLPA 4OC4A 2DEAA 4JGKA 2EEEA 4GM5A 5K8OA 1TXRA 3GPOA 1ARLA 3S9LA 1ZG7A 3EWRA 8CPAA 4J5RA 2AFCA 2ZEHA 4GVVA 2NSMA 2EK8A 3KGQA 3N5FA 3LWUA 1YMEA 4PPZA 4MCSA 3KR5A 4OIWA 4NGNA 4NGTA 5FSZA 3BI0A 1AYEA 1Z2LA 2AFUA 2WZNA 4G1PA 4P4IA 4OC1A 3SIIA 4ZY2A 3NFZA 4OC5A 2FVGA 2CTCA 2BCOA 5HIHA 4F8ZA 3IFEA 4JCAA 3KQZA 1QMUA 2PIZA 2ZEFA 3SIJA 3EWOA 5FSYA 3RZAA 3I1UA 2JBKA 4TU0A 1TF9A 3B35A 3KR4A 3CDXA 3RAMA 1TF8A 4A94A 4A37A 2J9AA 1PCAA 4A38A 5LRKA 4P4EA 5FSXA 4ETKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI2 A;  2PVW A;  2BO9 A;  3Q6Z A;  3FEC A;  2FG1 A;  5HVF A;  5K8N A;  3S9M A;  2V8G A;  4CPA A;  4ABL A;  2PJ9 A;  2PJ8 A;  5FSV A;  3V2B A;  1TXZ A;  1ZLH A;  1F2P A;  4NGS A;  4ZX8 A;  6CPA A;  1BPN A;  4Z65 A;  4KYB A;  3KHX A;  2Q43 A;  3B3C A;  1CPX A;  5FSU A;  2AFW A;  1IGB A;  4D86 A;  3FMC A;  4F9V A;  5JGF A;  3FED A;  3ISX A;  3SIG A;  3D4U A;  4MHN A;  4MHZ A;  4IQY A;  3HUV A;  5JM6 A;  2I3C A;  4P45 A;  4MXU A;  4P4J A;  5K8P A;  1JQG A;  2X47 A;  4IAV A;  3CT9 A;  4YWY A;  2RB7 A;  3PEI A;  3BI1 A;  4LQG A;  3B3T A;  4P4F A;  4ESS A;  4GVW A;  2PIY A;  2GRE A;  3GLJ A;  1CPS A;  1UWY A;  2PJ6 A;  4NJR A;  4MCP A;  4ZY1 A;  4PQA A;  2AFX A;  1VHU A;  2JBJ A;  3JRU A;  1CBX A;  3IIB A;  4PXD A;  4DYO A;  2Q51 A;  1ZLI A;  1FNO A;  3EJF A;  5CPA A;  3BHX A;  5LYL A;  2PE3 A;  2ZEO A;  4P44 A;  1VHO A;  2XEJ A;  3BXM A;  4K3N A;  3V45 A;  2ZEG A;  2ZED A;  4YU9 A;  3TC8 A;  3IWW A;  3NH5 A;  4NJQ A;  2CIJ A;  4R6T A;  4EWT A;  1XFO A;  5J1Q A;  3DLJ A;  2EWB A;  1Z8L A;  2ABZ A;  2ZOF A;  2PJ0 A;  3B3S A;  2C6G A;  2FXK A;  1TKH A;  3PB8 X;  4OID A;  4IHM A;  4OC2 A;  4WJB A;  3WC6 A;  5LRG A;  3ISZ A;  3FJU A;  4KSI A;  4NFR A;  2V8D A;  4UEZ A;  3EW5 A;  3KQX A;  1M4L A;  5LYF A;  3S9N A;  4MHY A;  4OC0 A;  4MRI A;  4O23 A;  1Y0Y A;  1HEE A;  4X2T A;  4JVV A;  3FF3 A;  1KWM A;  3GUX A;  4J5S A;  5IB9 A;  3IIF A;  4UEE A;  4UIB A;  4J4Z A;  5JH9 A;  3H8E A;  5AIL A;  2AFM A;  3Q71 A;  3VAT A;  1ELM P;  2VRI A;  1HDU A;  2PJ1 A;  3NA6 A;  2ZEN A;  3B3W A;  1XMB A;  2ZEE A;  1PYT B;  2C6C A;  4ZY0 A;  5CMS A;  3KAS A;  4DJL A;  1LFW A;  2CF4 A;  3MRU A;  4UEF A;  5THW A;  2PRQ A;  2V8H A;  1QQ9 A;  2XEI A;  1DE4 C;  4NGM A;  3K2K A;  1CG2 A;  1Y7E A;  2PVV A;  2C6P A;  1F57 A;  3ETI A;  2G9D A;  1LAM A;  4IK2 A;  5CBM A;  3SI0 A;  3VH9 A;  5LYD A;  1ZR3 A;  3GQO A;  1Y0R A;  2LGR A;  3H8G A;  3IJ3 A;  2IJZ A;  3PFO A;  2PJ5 A;  1YW4 A;  1TY8 A;  3PB4 X;  3VFQ A;  2XD7 A;  1HDQ A;  3EJG A;  1H8L A;  2ZEP A;  3KI9 A;  2GLF A;  1CP7 A;  5LRJ A;  2AFS A;  2V8V A;  2GU2 A;  1R3N A;  5HVH A;  5F09 A;  1VHE A;  3SI1 A;  1LCP A;  4P10 A;  4W9Y A;  4AXV A;  3JZT A;  4JYW A;  2O53 A;  4MHP A;  1HJZ A;  3FVL A;  4NGP A;  2PJ3 A;  5K8M A;  4PXE A;  2EK9 A;  3IC1 A;  4ZI6 A;  3GPQ A;  3CPA A;  3WT4 A;  3IEH A;  1AMP A;  4OP4 A;  4X8I A;  2PJ7 A;  4MMO A;  3D7G A;  3WAB A;  4K0C A;  1VGY A;  2RFH A;  4R8F A;  2ZEL A;  4ZX9 A;  2HB6 A;  3D7H A;  5HXD A;  2POK A;  2ZOG A;  1ELL P;  3PB6 X;  3SIH A;  4ONW A;  3D7F A;  3NH8 A;  1Q7L A;  3FX6 A;  4X3R A;  3SJF A;  3SJG A;  1TKF A;  1BLL E;  4ETJ A;  1XJO A;  1BAV A;  3GPG A;  1YSJ A;  1VIX A;  4NGQ A;  2VL1 A;  2QYV A;  4ABK A;  1DTD A;  4R7M A;  3EKE A;  2OOT A;  2WYR A;  1YW6 A;  1LOK A;  3KZW A;  3EWP A;  3IID A;  2PJA A;  4MCR A;  3T8W A;  3QNV A;  1ARM A;  5HOL A;  3GQE A;  2BOA A;  3D67 A;  4DUK A;  7CPA A;  4P4B A;  2ANP A;  3WC7 A;  4ZYQ A;  3GB0 A;  4J5Q A;  1LAP A;  1FT7 A;  3B3V A;  2F7V A;  1OBR A;  1Z5R A;  3WC5 A;  3H8F A;  2BFQ A;  4BD9 A;  2F8H A;  3L2N A;  2DX6 A;  3RBU A;  2FAV A;  3PB7 X;  1NJR A;  2XEG A;  3TX8 A;  3PBB A;  2ZEM A;  2XEF A;  3PBE A;  2O4H A;  1YD9 A;  1RTQ A;  2PJ2 A;  5DS0 A;  4TNU A;  2PJ4 A;  1ZR5 A;  3FH4 A;  5DUS A;  1CX8 A;  3D7D A;  2PJC A;  5CB3 A;  4P4D A;  3V7Z A;  3V38 A;  1NSA A;  3SJE A;  4F9U A;  1SPV A;  4TWE A;  4NGR A;  1CP6 A;  4EME A;  1IY7 A;  2NYQ A;  3FEE A;  1ZG8 A;  1YLO A;  4JLL A;  2OR4 A;  5HVG A;  3SJX A;  4FAI A;  2PJB A;  3DGV A;  4B6Z A;  2IMO A;  4JZ0 A;  3CPX A;  3D66 A;  4GUA A;  3D68 A;  4OME A;  4Q7A A;  3MN8 A;  2CTB A;  4H2K A;  4PXC A;  3KL9 A;  4FUU A;  3K9T A;  3KHZ A;  4FWU A;  3EWQ A;  1F2O A;  2QVP A;  2JEW A;  4P6Y A;  4WWV A;  1TKJ A;  5E3B A;  2Q4Z A;  4UIA A;  1XBU A;  3IO1 A;  2BFR A;  3PFE A;  1R43 A;  2V77 A;  3VAR A;  4OC3 A;  4UML A;  2QJ8 A;  3LMS A;  4FBE A;  3B2Y A;  4MCQ A;  2AFO A;  3NH4 A;  3PRT A;  2ACF A;  4OKO A;  5CB5 A;  3B7I A;  3PB9 X;  2L8R A;  5LYI A;  4RUH A;  2HC9 A;  4PXB A;  4EFD A;  5I4M A;  2AFZ A;  1GYT A;  4UF4 A;  2C1C A;  1BPM A;  4A39 A;  1XRY A;  5ELY A;  2PCU A;  2GLJ A;  1LAN A;  1EE3 P;  5D8N A;  4R76 A;  1ZG9 A;  2IQ6 A;  5D29 A;  3HLP A;  4OC4 A;  2DEA A;  4JGK A;  2EEE A;  4GM5 A;  5K8O A;  1TXR A;  3GPO A;  1ARL A;  3S9L A;  1ZG7 A;  3EWR A;  8CPA A;  4J5R A;  2AFC A;  2ZEH A;  4GVV A;  2NSM A;  2EK8 A;  3KGQ A;  3N5F A;  3LWU A;  1YME A;  4PPZ A;  4MCS A;  3KR5 A;  4OIW A;  4NGN A;  4NGT A;  5FSZ A;  3BI0 A;  1AYE A;  1Z2L A;  2AFU A;  2WZN A;  4G1P A;  4P4I A;  4OC1 A;  3SII A;  4ZY2 A;  3NFZ A;  4OC5 A;  2FVG A;  2CTC A;  2BCO A;  5HIH A;  4F8Z A;  3IFE A;  4JCA A;  3KQZ A;  1QMU A;  2PIZ A;  2ZEF A;  3SIJ A;  3EWO A;  5FSY A;  3RZA A;  3I1U A;  2JBK A;  4TU0 A;  1TF9 A;  3B35 A;  3KR4 A;  3CDX A;  3RAM A;  1TF8 A;  4A94 A;  4A37 A;  2J9A A;  1PCA A;  4A38 A;  5LRK A;  4P4E A;  5FSX A;  4ETK A; 
#chains in the Genus database with same CATH topology
 3OWC A;  3SI2 A;  2PVW A;  3TO9 A;  4XNH C;  3ZZI A;  1Z4R A;  2BO9 A;  3Q6Z A;  3FEC A;  2P6G A;  2FG1 A;  5HVF A;  5BWA B;  5K8N A;  2GE3 A;  3S9M A;  2V8G A;  4K30 A;  2OZG A;  4CPA A;  4AG9 A;  4ABL A;  2PJ9 A;  2YNE A;  4UWI A;  2PJ8 A;  5FSV A;  3V2B A;  2FIA A;  5HH1 A;  3N7Z A;  3FRM A;  3ZJ0 A;  2JLM A;  1TXZ A;  1ZLH A;  5H86 A;  1F2P A;  4NGS A;  4ZX8 A;  6CPA A;  1BPN A;  5ISV A;  4BBH A;  4Z65 A;  4KYB A;  4JXQ A;  1JWQ A;  3KHX A;  2Q43 A;  3PGP A;  3B3C A;  4AVA A;  2FT0 A;  4CAW A;  1CPX A;  5FSU A;  2AFW A;  1IGB A;  2GIV A;  4D86 A;  1BOB A;  3FMC A;  1CJW A;  4F9V A;  5JGF A;  4A2Z A;  4A33 A;  3FED A;  1WK4 A;  3ISX A;  4JLY A;  1KUY A;  1FY7 A;  3SIG A;  1AUG A;  2GAN A;  3D4U A;  4JXR A;  4MHN A;  4MHZ A;  4IQY A;  3HUV A;  5JM6 A;  4MFZ A;  2I3C A;  3G3S A;  4MXU A;  4P45 A;  5GCN A;  2W2G A;  2OH1 A;  3LAC A;  2WPW A;  4P4J A;  4E2A A;  3UY5 A;  5K8P A;  1JQG A;  2X47 A;  1B6B A;  2Z11 A;  3TE4 A;  4IAV A;  2YNC A;  3CT9 A;  2RB7 A;  3PEI A;  3BI1 A;  4LQG A;  4PSW A;  3B3T A;  4P4F A;  1ON0 A;  5G21 A;  1Y9K A;  1QST A;  1Z9U A;  4ESS A;  4X5K A;  4B12 A;  2Q7S A;  1BO4 A;  3D2M A;  2G3T A;  2DF5 A;  2ODF A;  2D4O A;  1X12 A;  4KOU A;  4GVW A;  3R95 A;  5DWN A;  2IL4 A;  1J4J A;  1NE9 A;  4XPL A;  2PIY A;  5JPH A;  2VZZ A;  2GRE A;  3GLJ A;  1X10 A;  1CPS A;  4NSQ A;  1UWY A;  1R57 A;  2PJ6 A;  4NJR A;  2J8N A;  4MCP A;  5C88 A;  4ZY1 A;  4PQA A;  2AFX A;  4Q38 A;  3SHP A;  1VHU A;  2JBJ A;  3JRU A;  1CBX A;  3IIB A;  3LD2 A;  4PXD A;  4DYO A;  4MJ8 A;  4KOV A;  2Q51 A;  3TO7 A;  1ZLI A;  2OZH A;  1FNO A;  3R9F A;  3NE8 A;  3EJF A;  5CPA A;  1MJA A;  3BHX A;  5LYL A;  1I12 A;  4MI4 A;  2PE3 A;  2ZEO A;  1IID A;  2B4D B;  1S7L A;  1VHO A;  2XEJ A;  3BXM A;  4P44 A;  3TOB A;  2VXK A;  4KOW A;  4K3N A;  3V45 A;  2ZEG A;  2ZED A;  4YU9 A;  3TC8 A;  3IWW A;  4L89 A;  3NH5 A;  4NJQ A;  1RO5 A;  2CIJ A;  4R6T A;  4B5O A;  3JTK A;  4EWT A;  1XFO A;  3P2H A;  2PR8 A;  4MFL A;  4NEX A;  5J1Q A;  2VI7 A;  2H5M A;  3DLJ A;  3DR6 A;  3TO6 A;  5E96 A;  2EWB A;  4R57 A;  1RXT A;  1Z8L A;  3CXQ A;  2ABZ A;  2ZOF A;  2PJ0 A;  3B3S A;  4UCP A;  2C6G A;  2FXK A;  4YGO A;  1TKH A;  3DSB A;  3PB8 X;  4A32 A;  4HNY B;  2RNK A;  1V0C A;  1ZO0 A;  2QIR A;  4OID A;  4IHM A;  4OC2 A;  1Z4E A;  4WJB A;  3WC6 A;  5LRG A;  2Q7B A;  3W6X A;  2KQV A;  3ISZ A;  4HNX B;  2CY2 A;  2VEZ A;  3R96 A;  3FJU A;  2QML A;  3A9L A;  4KSI A;  4GS4 A;  1Z8W A;  2FE7 A;  2V8D A;  4NFR A;  5FVJ A;  4B13 A;  4UEZ A;  4JJX A;  3EW5 A;  2JZF A;  3KQX A;  1K4J A;  1M4L A;  1WWZ A;  1UFH A;  5LYF A;  3S9N A;  4MHY A;  4OC0 A;  1XE4 A;  4BIN A;  2Z3L A;  4PSX A;  4MRI A;  2EO8 A;  4UFW A;  1M4D A;  4O23 A;  1Y0Y A;  1HEE A;  4X2T A;  4JVV A;  3FF3 A;  1KWM A;  2VZY A;  2Z3P A;  4U9Z A;  3GUX A;  2B3V A;  4J5S A;  4B10 A;  3TTH A;  5IB9 A;  3IIF A;  2PR1 A;  4M6I A;  4UEE A;  4UIB A;  5EC4 A;  4UCN A;  4J4Z A;  2P6F A;  5JH9 A;  4KZT A;  3H8E A;  5AIL A;  2AFM A;  2J8M A;  4RS2 A;  3Q71 A;  3P2F A;  4HKF A;  4LQ6 A;  1KUX A;  3IU1 A;  5AG6 A;  4CGL A;  2QEC A;  3VAT A;  1ELM P;  5IB0 A;  2VRI A;  1HDU A;  2PJ1 A;  3NA6 A;  2ZEN A;  2ZPA A;  3B3W A;  1XMB A;  2ZEE A;  1PYT B;  2C6C A;  4ZY0 A;  2YND A;  5CMS A;  3F0A A;  3KAS A;  4KOS A;  4DJL A;  1LFW A;  2CF4 A;  3G8W A;  3MRU A;  2Q04 A;  4UEF A;  5THW A;  4C7H A;  3V8I A;  2PRQ A;  2V8H A;  4A31 A;  1QQ9 A;  2XEI A;  1DE4 C;  3GKR A;  3GYA A;  4NGM A;  1S7N A;  3K2K A;  1CG2 A;  5EMI A;  4CRY B;  5IX3 A;  1Y7E A;  2PVV A;  2C6P A;  1F57 A;  3ETI A;  1IB1 E;  2G9D A;  1LAM A;  3FBU A;  4LUA A;  4IK2 A;  4E0A A;  3TFY A;  5CBM A;  3SI0 A;  4QBJ A;  2CNM A;  3VH9 A;  2JDD A;  5LYD A;  1ZR3 A;  3GQO A;  1Y0R A;  4FD5 A;  4KOY A;  4UCM A;  2LGR A;  1PU9 A;  3H8G A;  2JZD A;  3IJ3 A;  2IJZ A;  3PFO A;  4B14 A;  2PJ5 A;  3IGR A;  1YW4 A;  1TY8 A;  2R98 A;  3PB4 X;  3VFQ A;  1B87 A;  2JDC A;  2XD7 A;  1HDQ A;  4KUA A;  4QVT A;  3EJG A;  4H6Z A;  4KS9 A;  4KLW A;  1H8L A;  5AG7 A;  2G3A A;  2ZEP A;  3F5B A;  4JD6 A;  3QAH A;  3KI9 A;  4UWJ A;  2GLF A;  1S60 A;  1CP7 A;  2EUI A;  1P4N A;  4CYO A;  2B5G A;  1XOV A;  5LRJ A;  2AFS A;  2V8V A;  2GU2 A;  4QB9 A;  4CYN A;  2I00 A;  1I21 A;  1R3N A;  2X7B A;  3R9E A;  5HVH A;  5F09 A;  1VHE A;  3SI1 A;  1XMT A;  1LCP A;  1S5K A;  4P10 A;  2FS5 A;  4W9Y A;  4AXV A;  1OZP A;  4KVM E;  4CGO A;  3JZT A;  4JYW A;  4MFQ A;  4II9 A;  2O53 A;  5JQ4 A;  4MHP A;  5H84 A;  4FD7 A;  1HJZ A;  2FXF A;  3SXN A;  1XEB A;  4PK3 A;  4UFV A;  1IOF A;  3FVL A;  4NGP A;  2PJ3 A;  5K8M A;  4PXE A;  2DPS A;  4FD4 A;  2EK9 A;  3DR8 A;  3LOD A;  2DXQ A;  3IC1 A;  4U9Y A;  4Q36 A;  4ZI6 A;  3GPQ A;  1PUA A;  2I79 A;  2R7H A;  3CPA A;  4Y49 B;  2BL1 A;  2REF A;  1QSM A;  3IEH A;  3EXN A;  3WT4 A;  3PZJ A;  1AMP A;  2BEI A;  2P0W A;  4MHD A;  1MJB A;  4OP4 A;  1MK4 A;  4X8I A;  4A95 A;  2PJ7 A;  3S6F A;  4MMO A;  5J8C A;  3D7G A;  3PP9 A;  4QC6 A;  3WAB A;  3FYN A;  4XNH B;  4K0C A;  1VGY A;  2RFH A;  4OLL A;  4J3G A;  4R8F A;  2ZEL A;  1YGH A;  1LRZ A;  4R87 A;  4KVO E;  4ZX9 A;  2HB6 A;  3D7H A;  4L8A A;  2F5I A;  1YRE A;  3BLN A;  5HXD A;  2POK A;  2ZOG A;  1ELL P;  2D4P A;  3EFA A;  3GY9 A;  4RI1 A;  3QAY A;  3PB6 X;  3SIH A;  4ONW A;  3D7F A;  2WPX A;  3NH8 A;  1Q7L A;  3FX6 A;  4X3R A;  3SJF A;  3RYO A;  3SJG A;  3WR7 A;  5F48 A;  2B4B A;  3S6H A;  1TKF A;  2FSR A;  1BLL E;  4ETJ A;  1M44 A;  3B8G A;  1XJO A;  4RN7 A;  5F47 A;  4OAD A;  1BAV A;  3GPG A;  2PRB A;  1YSJ A;  2JEV A;  1VIX A;  4NGQ A;  2FL4 A;  2VL1 A;  4UA3 A;  1MJ9 A;  1QSR A;  2QYV A;  4GXH A;  4KSF A;  2RC4 A;  4ABK A;  4M3S A;  2OB0 A;  1DTD A;  4CAE A;  3W91 A;  4R7M A;  2VBQ A;  1NSL A;  3EKE A;  2JZE A;  2OOT A;  2WYR A;  1YW6 A;  1LOK A;  3KZW A;  3EWP A;  2ZXV A;  3IID A;  2PJA A;  5C82 A;  4MCR A;  4KOX A;  3T8W A;  4CAV A;  3IWG A;  3QNV A;  5HMN A;  1IOI A;  1ARM A;  2WCT A;  5HOL A;  1XF8 A;  3GQE A;  1TIQ A;  4CS0 B;  4C2Y A;  2BOA A;  3D67 A;  4DUK A;  2Q0Y A;  4R3K A;  3DNS A;  7CPA A;  4P4B A;  2ANP A;  4C2Z A;  4F0Y A;  2PQ8 A;  4M85 A;  3WC7 A;  4ZYQ A;  3GB0 A;  3NE7 A;  5F49 A;  4J5Q A;  1LAP A;  2Y0M A;  3S6G A;  1FT7 A;  4B11 A;  3B3V A;  5KTA A;  2F7V A;  4XPK A;  4UBR A;  1OBR A;  1CM0 A;  1Z5R A;  1SQH A;  3CXP A;  3WC5 A;  3C26 A;  3H8F A;  2BFQ A;  4BD9 A;  2F8H A;  3L2N A;  4MBU A;  5CNP A;  2VQY A;  4R9M A;  4U5Y A;  2DX6 A;  3VWD A;  2G0B A;  4M6G A;  3RBU A;  4OAE A;  4XPD B;  2FAV A;  5DWM A;  1M4I A;  3PB7 X;  4CYQ A;  2PDO A;  3D3S A;  1NJR A;  4KVX A;  3T90 A;  2O28 A;  2Q44 A;  2XEG A;  3R1K A;  3TX8 A;  3PBB A;  2DPT A;  2Z3O A;  2ZEM A;  3T9Y A;  2ARH A;  2XEF A;  3PBE A;  2O4H A;  1KUV A;  2ZW4 A;  3H4Q A;  4B5P A;  1YD9 A;  1RTQ A;  2PJ2 A;  4CAF A;  4CGP A;  5J8F A;  2B5G B;  5DS0 A;  4TNU A;  4C68 A;  2PJ4 A;  1ZR5 A;  1Q2C A;  3FH4 A;  5DUS A;  1CX8 A;  3CZX A;  3D7D A;  3W6S A;  2PJC A;  2GFQ A;  5CB3 A;  2WUU A;  4P4D A;  4HNW B;  3V7Z A;  1VHS A;  1NSA A;  3V38 A;  2K5T A;  2EBJ A;  2OZU A;  3SJE A;  2BUE A;  3DDD A;  4C7I A;  2PSW A;  4F9U A;  1SPV A;  4TWE A;  4KUB A;  1Y9W A;  4NGR A;  4DNC A;  1GHE A;  2Z3N A;  1CP6 A;  4MFK A;  2CNT A;  3RNZ A;  2Z3M A;  4YWY A;  4EME A;  1IY7 A;  3VWE A;  2NYQ A;  3TCV A;  5I0C A;  2HUZ A;  3FEE A;  4H6U A;  1ZG8 A;  1YLO A;  4JLL A;  4CYP A;  2OR4 A;  5HVG A;  3SJX A;  2Z0Z A;  4FAI A;  4QUS A;  2PJB A;  3DGV A;  4B6Z A;  1Y7R A;  2IMO A;  4JZ0 A;  3CPX A;  4EVY A;  3D66 A;  4IF5 A;  3I3G A;  4GUA A;  4ZGY B;  3D68 A;  4JWP A;  4OME A;  5AGE A;  4YFJ A;  3FXT A;  4Q7A A;  4R3L A;  3MN8 A;  2CTB A;  4AG7 A;  4H2K A;  2BSW A;  4PXC A;  3IWE A;  3KL9 A;  1I1D A;  3K9U A;  4FUU A;  2OU2 A;  3K9T A;  4ZBG A;  3D8P A;  2KCW A;  3KHZ A;  4MY0 A;  4FWU A;  4BMH A;  1QSO A;  3EWQ A;  1IYK A;  1F2O A;  3CXS A;  2Z3K A;  2QVP A;  3BJ8 A;  2JEW A;  4P6Y A;  4WWV A;  1TKJ A;  3E0K A;  4I49 A;  2HQY A;  1KZF A;  2Q4Y A;  2ZW5 A;  3QB8 A;  5E3B A;  3TOA A;  1XIX A;  1YR0 A;  2CNS A;  2Q4Z A;  4UIA A;  4PK2 A;  4UFX A;  1XBU A;  1YK3 A;  2P6E A;  4YRH A;  3IO1 A;  2BFR A;  5G20 A;  3PFE A;  1R43 A;  3EO4 A;  2HV2 A;  1YVK A;  2V77 A;  3VAR A;  1Z8T A;  4OC3 A;  4UML A;  1S3Z A;  2QJ8 A;  2AE6 A;  3JUW A;  3LMS A;  4FBE A;  3TT2 A;  3GIU A;  3B2Y A;  4MCQ A;  2NMT A;  4CAX A;  2AFO A;  3NH4 A;  3PRT A;  2ACF A;  4OKO A;  2B3U A;  4KOT A;  5AG5 A;  5CB5 A;  3B7I A;  2AJ6 A;  2FCK A;  2CXA A;  1YLE A;  3F8K A;  3PB9 X;  2L8R A;  5LYI A;  2FIW A;  4FD6 A;  4M6H A;  1Z8X A;  2ZW7 A;  2HC9 A;  4RUH A;  4PXB A;  4EFD A;  5I4M A;  4NCZ A;  2AFZ A;  1IU8 A;  1Q2Y A;  2R8V A;  1GYT A;  4UF4 A;  2C1C A;  3EC4 A;  1BPM A;  5G1Z A;  4A39 A;  1XRY A;  4XPD C;  5KTC A;  3S6K A;  5ELY A;  1L0C A;  1M1D A;  2PCU A;  2GLJ A;  1LAN A;  4F6A A;  1YX0 A;  1EE3 P;  1NMT A;  4CRZ B;  5D8N A;  3MGD A;  4R76 A;  3I9S A;  3JVN A;  1ZG9 A;  2IQ6 A;  5D29 A;  1U6M A;  3HLP A;  4AVB A;  3RO0 A;  5IV0 A;  2REE A;  4OC4 A;  4MFJ A;  4HPS A;  2DEA A;  2YNC C;  4JGK A;  4KOR A;  5A28 A;  4MY3 A;  2EEE A;  4GM5 A;  5K8O A;  1TXR A;  4ONU A;  5EBV A;  3GPO A;  1ARL A;  1QSN A;  2C27 A;  4A30 A;  3S9L A;  1ZG7 A;  3EWR A;  4F0X A;  3KKW A;  2PC1 A;  8CPA A;  4J5R A;  1IYL A;  4B5P B;  2AFC A;  2ZEH A;  5F46 A;  1VKC A;  2A4N A;  4GVV A;  1S7K A;  4E8O A;  5KTD A;  2Q4V A;  4IUS A;  2NSM A;  2EK8 A;  3KGQ A;  3N5F A;  3R9G A;  4AVC A;  3LWU A;  3EY5 A;  1YME A;  4PPZ A;  5A27 A;  4MCS A;  3KR5 A;  2ZW6 A;  4OIW A;  4NGN A;  4ORF A;  4AB7 A;  2J8R A;  4NGT A;  1N71 A;  4MFP A;  2WSA A;  1S7F A;  5FSZ A;  3BI0 A;  1AYE A;  1Z2L A;  2AFU A;  2WZN A;  4G1P A;  4KLV A;  4NF1 A;  1IIC A;  4OC1 A;  3SII A;  4P4I A;  4ZY2 A;  2B58 A;  2YGW A;  3NFZ A;  4OC5 A;  1Q2D A;  2FVG A;  2B4D A;  2CTC A;  2BCO A;  2R1I A;  3H5Z A;  5HIH A;  4F8Z A;  3IFE A;  4JCA A;  3KQZ A;  3FB3 A;  1QMU A;  2PIZ A;  4CGM A;  2ZEF A;  3SIJ A;  4CGN A;  3FIX A;  1A2Z A;  2ATR A;  2Z10 A;  3EWO A;  5FSY A;  3RZA A;  3I1U A;  1P0H A;  2JBK A;  3IU2 A;  4TU0 A;  1TF9 A;  3SXO A;  4KSA A;  3B35 A;  4C2X A;  3KR4 A;  3CDX A;  3RAM A;  1TF8 A;  4A94 A;  4PV6 A;  1M4G A;  4H89 A;  4A37 A;  4NXY A;  1YQE A;  2J9A A;  1PCA A;  2EVN A;  3FNC A;  4Y49 C;  5G22 A;  4A38 A;  3BJ7 A;  5LRK A;  4LX9 A;  1YVO A;  4P4E A;  5FSX A;  5AG4 A;  3D2P A;  4ETK A; 
#chains in the Genus database with same CATH homology
 3SI2 A;  2PVW A;  2BO9 A;  3Q6Z A;  3FEC A;  2FG1 A;  5HVF A;  5K8N A;  3S9M A;  2V8G A;  4CPA A;  4ABL A;  2PJ9 A;  2PJ8 A;  5FSV A;  3V2B A;  1TXZ A;  1ZLH A;  1F2P A;  4NGS A;  4ZX8 A;  6CPA A;  1BPN A;  4Z65 A;  4KYB A;  3KHX A;  2Q43 A;  3B3C A;  1CPX A;  5FSU A;  2AFW A;  1IGB A;  4D86 A;  3FMC A;  4F9V A;  5JGF A;  3FED A;  3ISX A;  3SIG A;  3D4U A;  4MHN A;  4MHZ A;  4IQY A;  3HUV A;  5JM6 A;  2I3C A;  4P45 A;  4MXU A;  4P4J A;  5K8P A;  1JQG A;  2X47 A;  4IAV A;  3CT9 A;  4YWY A;  2RB7 A;  3PEI A;  3BI1 A;  4LQG A;  3B3T A;  4P4F A;  4ESS A;  4GVW A;  2PIY A;  2GRE A;  3GLJ A;  1CPS A;  1UWY A;  2PJ6 A;  4NJR A;  4MCP A;  4ZY1 A;  4PQA A;  2AFX A;  1VHU A;  2JBJ A;  3JRU A;  1CBX A;  3IIB A;  4PXD A;  4DYO A;  2Q51 A;  1ZLI A;  1FNO A;  3EJF A;  5CPA A;  3BHX A;  5LYL A;  2PE3 A;  2ZEO A;  4P44 A;  1VHO A;  2XEJ A;  3BXM A;  4K3N A;  3V45 A;  2ZEG A;  2ZED A;  4YU9 A;  3TC8 A;  3IWW A;  3NH5 A;  4NJQ A;  2CIJ A;  4R6T A;  4EWT A;  1XFO A;  5J1Q A;  3DLJ A;  2EWB A;  1Z8L A;  2ABZ A;  2ZOF A;  2PJ0 A;  3B3S A;  2C6G A;  2FXK A;  1TKH A;  3PB8 X;  4OID A;  4IHM A;  4OC2 A;  4WJB A;  3WC6 A;  5LRG A;  3ISZ A;  3FJU A;  4KSI A;  4NFR A;  2V8D A;  4UEZ A;  3EW5 A;  3KQX A;  1M4L A;  5LYF A;  3S9N A;  4MHY A;  4OC0 A;  4MRI A;  4O23 A;  1Y0Y A;  1HEE A;  4X2T A;  4JVV A;  3FF3 A;  1KWM A;  3GUX A;  4J5S A;  5IB9 A;  3IIF A;  4UEE A;  4UIB A;  4J4Z A;  5JH9 A;  3H8E A;  5AIL A;  2AFM A;  3Q71 A;  3VAT A;  1ELM P;  2VRI A;  1HDU A;  2PJ1 A;  3NA6 A;  2ZEN A;  3B3W A;  1XMB A;  2ZEE A;  1PYT B;  2C6C A;  4ZY0 A;  5CMS A;  3KAS A;  4DJL A;  1LFW A;  2CF4 A;  3MRU A;  4UEF A;  5THW A;  2PRQ A;  2V8H A;  1QQ9 A;  2XEI A;  1DE4 C;  4NGM A;  3K2K A;  1CG2 A;  1Y7E A;  2PVV A;  2C6P A;  1F57 A;  3ETI A;  2G9D A;  1LAM A;  4IK2 A;  5CBM A;  3SI0 A;  3VH9 A;  5LYD A;  1ZR3 A;  3GQO A;  1Y0R A;  2LGR A;  3H8G A;  3IJ3 A;  2IJZ A;  3PFO A;  2PJ5 A;  1YW4 A;  1TY8 A;  3PB4 X;  3VFQ A;  2XD7 A;  1HDQ A;  3EJG A;  1H8L A;  2ZEP A;  3KI9 A;  2GLF A;  1CP7 A;  5LRJ A;  2AFS A;  2V8V A;  2GU2 A;  1R3N A;  5HVH A;  5F09 A;  1VHE A;  3SI1 A;  1LCP A;  4P10 A;  4W9Y A;  4AXV A;  3JZT A;  4JYW A;  2O53 A;  4MHP A;  1HJZ A;  3FVL A;  4NGP A;  2PJ3 A;  5K8M A;  4PXE A;  2EK9 A;  3IC1 A;  4ZI6 A;  3GPQ A;  3CPA A;  3WT4 A;  3IEH A;  1AMP A;  4OP4 A;  4X8I A;  2PJ7 A;  4MMO A;  3D7G A;  3WAB A;  4K0C A;  1VGY A;  2RFH A;  4R8F A;  2ZEL A;  4ZX9 A;  2HB6 A;  3D7H A;  5HXD A;  2POK A;  2ZOG A;  1ELL P;  3PB6 X;  3SIH A;  4ONW A;  3D7F A;  3NH8 A;  1Q7L A;  3FX6 A;  4X3R A;  3SJF A;  3SJG A;  1TKF A;  1BLL E;  4ETJ A;  1XJO A;  1BAV A;  3GPG A;  1YSJ A;  1VIX A;  4NGQ A;  2VL1 A;  2QYV A;  4ABK A;  1DTD A;  4R7M A;  3EKE A;  2OOT A;  2WYR A;  1YW6 A;  1LOK A;  3KZW A;  3EWP A;  3IID A;  2PJA A;  4MCR A;  3T8W A;  3QNV A;  1ARM A;  5HOL A;  3GQE A;  2BOA A;  3D67 A;  4DUK A;  7CPA A;  4P4B A;  2ANP A;  3WC7 A;  4ZYQ A;  3GB0 A;  4J5Q A;  1LAP A;  1FT7 A;  3B3V A;  2F7V A;  1OBR A;  1Z5R A;  3WC5 A;  3H8F A;  2BFQ A;  4BD9 A;  2F8H A;  3L2N A;  2DX6 A;  3RBU A;  2FAV A;  3PB7 X;  1NJR A;  2XEG A;  3TX8 A;  3PBB A;  2ZEM A;  2XEF A;  3PBE A;  2O4H A;  1YD9 A;  1RTQ A;  2PJ2 A;  5DS0 A;  4TNU A;  2PJ4 A;  1ZR5 A;  3FH4 A;  5DUS A;  1CX8 A;  3D7D A;  2PJC A;  5CB3 A;  4P4D A;  3V7Z A;  3V38 A;  1NSA A;  3SJE A;  4F9U A;  1SPV A;  4TWE A;  4NGR A;  1CP6 A;  4EME A;  1IY7 A;  2NYQ A;  3FEE A;  1ZG8 A;  1YLO A;  4JLL A;  2OR4 A;  5HVG A;  3SJX A;  4FAI A;  2PJB A;  3DGV A;  4B6Z A;  2IMO A;  4JZ0 A;  3CPX A;  3D66 A;  4GUA A;  3D68 A;  4OME A;  4Q7A A;  3MN8 A;  2CTB A;  4H2K A;  4PXC A;  3KL9 A;  4FUU A;  3K9T A;  3KHZ A;  4FWU A;  3EWQ A;  1F2O A;  2QVP A;  2JEW A;  4P6Y A;  4WWV A;  1TKJ A;  5E3B A;  2Q4Z A;  4UIA A;  1XBU A;  3IO1 A;  2BFR A;  3PFE A;  1R43 A;  2V77 A;  3VAR A;  4OC3 A;  4UML A;  2QJ8 A;  3LMS A;  4FBE A;  3B2Y A;  4MCQ A;  2AFO A;  3NH4 A;  3PRT A;  2ACF A;  4OKO A;  5CB5 A;  3B7I A;  3PB9 X;  2L8R A;  5LYI A;  4RUH A;  2HC9 A;  4PXB A;  4EFD A;  5I4M A;  2AFZ A;  1GYT A;  4UF4 A;  2C1C A;  1BPM A;  4A39 A;  1XRY A;  5ELY A;  2PCU A;  2GLJ A;  1LAN A;  1EE3 P;  5D8N A;  4R76 A;  1ZG9 A;  2IQ6 A;  5D29 A;  3HLP A;  4OC4 A;  2DEA A;  4JGK A;  2EEE A;  4GM5 A;  5K8O A;  1TXR A;  3GPO A;  1ARL A;  3S9L A;  1ZG7 A;  3EWR A;  8CPA A;  4J5R A;  2AFC A;  2ZEH A;  4GVV A;  2NSM A;  2EK8 A;  3KGQ A;  3N5F A;  3LWU A;  1YME A;  4PPZ A;  4MCS A;  3KR5 A;  4OIW A;  4NGN A;  4NGT A;  5FSZ A;  3BI0 A;  1AYE A;  1Z2L A;  2AFU A;  2WZN A;  4G1P A;  4P4I A;  4OC1 A;  3SII A;  4ZY2 A;  3NFZ A;  4OC5 A;  2FVG A;  2CTC A;  2BCO A;  5HIH A;  4F8Z A;  3IFE A;  4JCA A;  3KQZ A;  1QMU A;  2PIZ A;  2ZEF A;  3SIJ A;  3EWO A;  5FSY A;  3RZA A;  3I1U A;  2JBK A;  4TU0 A;  1TF9 A;  3B35 A;  3KR4 A;  3CDX A;  3RAM A;  1TF8 A;  4A94 A;  4A37 A;  2J9A A;  1PCA A;  4A38 A;  5LRK A;  4P4E A;  5FSX A;  4ETK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...