3KR5A

Structure of a protease 4
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
519
structure length
518
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 181
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr5A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr5A02
3BI1A 2WZNA 3K9TA 3JZTA 3PEIA 1ZLHA 1HJZA 2ANPA 4PXDA 4PXCA 4W9YA 1IY7A 8CPAA 3EWPA 4P44A 5JGFA 1TKHA 2NSMA 4K0CA 4MHNA 2JEWA 4MCRA 5LYLA 3FMCA 3H8GA 5CMSA 2POKA 1LAMA 1EE3P 4GVVA 5LYIA 4P4FA 1PYTB 2C6CA 3FEDA 3VARA 3DLJA 5I4MA 2PJ9A 3D67A 2GLFA 4MHYA 4JVVA 2ZEMA 4ZI6A 2ZEEA 4P4BA 2PJ6A 7CPAA 2Q43A 2QVPA 2JBJA 3D7FA 4DYOA 2PJ1A 4UIBA 1Z8LA 3D7DA 5JM6A 2HC9A 5HOLA 2C6PA 4CPAA 2AFOA 1TXZA 2AFSA 2G9DA 1XJOA 3D4UA 3PBBA 2F7VA 2AFZA 3SJEA 3SJFA 4JZ0A 4MHPA 2HB6A 1ZLIA 1DTDA 4UEFA 4P45A 1YW4A 1SPVA 3Q6ZA 1CX8A 2OR4A 5LYFA 3WT4A 4J5QA 3B2YA 3K2KA 3HLPA 3KQXA 2CIJA 2PJAA 3ISXA 4NGSA 4NJRA 1HDQA 5CPAA 1CG2A 2CTCA 3SIGA 4UEZA 3HUVA 1CBXA 1ZR5A 3EW5A 3IC1A 2AFWA 4NGTA 1Z5RA 1BPNA 2QYVA 4FWUA 1ELLP 5AILA 3IEHA 3SI0A 2F8HA 2PJ8A 3KZWA 3JRUA 3LMSA 3GUXA 4DJLA 3KI9A 2PJ7A 3D7HA 3KHXA 4X3RA 1FNOA 1QQ9A 1BPMA 2BFQA 3T8WA 2OOTA 1LOKA 2PE3A 1KWMA 3RBUA 1HEEA 1ARMA 3VFQA 1YMEA 4NGQA 3EJFA 1AMPA 3D66A 4KSIA 1Y0YA 4MRIA 2IJZA 2PJBA 4ZY2A 4NGMA 4P4EA 4X8IA 4A38A 4NGRA 3B7IA 3I1UA 4PXBA 3PB9X 5D29A 1XMBA 3PFOA 4NFRA 2XEFA 3B3TA 3MN8A 4R6TA 3ETIA 1YD9A 3S9LA 4MCSA 1Z2LA 2EWBA 4TNUA 3KR5A 2AFMA 3KR4A 3H8EA 2WYRA 4OC2A 4OC1A 4ZX8A 3KL9A 2Q51A 4FUUA 4J4ZA 3SJXA 4A39A 4MMOA 5JH9A 1R43A 1ZG7A 2V8GA 3CPXA 2O4HA 3SI2A 2ZOGA 5DUSA 3GPOA 5FSUA 1XRYA 1CP7A 1PCAA 2CF4A 3CPAA 4YU9A 2V77A 3FJUA 2Q4ZA 4KYBA 1ZG8A 3TX8A 4UMLA 3BHXA 3IO1A 4OC3A 4WJBA 2DEAA 2FVGA 5F09A 3NFZA 4MXUA 4ZYQA 3GB0A 5CBMA 2V8DA 2PCUA 3QNVA 2PJ0A 1M4LA 3B3WA 2XD7A 2PJCA 2EK9A 3IFEA 1VGYA 5LYDA 1RTQA 4ONWA 3MRUA 3FF3A 4UF4A 4LQGA 4X2TA 2BOAA 1IGBA 1TF8A 3GLJA 1HDUA 5FSVA 2PRQA 5ELYA 3B3VA 2PVWA 3CDXA 4PXEA 4OC5A 4NJQA 3IWWA 3IIFA 3KGQA 5D8NA 2AFXA 1FT7A 4ZY0A 1AYEA 2ZENA 2J9AA 4ZY1A 3V2BA 1GYTA 2NYQA 4OKOA 2BO9A 2C6GA 1ELMP 2EEEA 3VATA 2XEGA 4JGKA 3B3CA 4A37A 4ETJA 4OC0A 3V7ZA 1QMUA 4OC4A 5LRGA 2AFUA 4AXVA 4GM5A 3NA6A 3IJ3A 3V38A 4JCAA 1F2OA 4F9VA 5K8OA 4R8FA 1CP6A 4IHMA 3WC6A 4ABKA 4PPZA 2FXKA 2RFHA 4IAVA 5HVFA 2CTBA 1TY8A 5CB5A 2AFCA 3RAMA 1VHUA 3EWQA 4GVWA 1R3NA 1NSAA 4IQYA 1TKFA 3FECA 2GU2A 3EWOA 1CPXA 4ETKA 3NH5A 4P4JA 5IB9A 1H8LA 1TKJA 4FBEA 1ZG9A 2XEIA 1OBRA 4O23A 4WWVA 3FEEA 4P4DA 4R7MA 3D7GA 4J5SA 2PIZA 4OIWA 5THWA 5K8MA 3DGVA 4Z65A 2VL1A 1VHEA 1CPSA 3KQZA 2PJ2A 5K8PA 1XBUA 1NJRA 3D68A 3S9MA 3SIHA 3SJGA 2PJ3A 1Y0RA 5HIHA 2RB7A 3B3SA 4ABLA 4P4IA 4OIDA 3SIJA 4OMEA 1VHOA 2BFRA 4UIAA 5LRJA 6CPAA 3WC5A 1LFWA 3EWRA 3RZAA 3S9NA 1TF9A 3ISZA 2ACFA 2LGRA 4RUHA 2GREA 3EJGA 3IIBA 1F57A 2I3CA 1LAPA 3GPGA 3GPQA 2ZEFA 3PRTA 1BLLE 4EFDA 2BCOA 4OP4A 4NGNA 4ZX9A 2ZEOA 4P10A 5E3BA 3CT9A 4F8ZA 4EWTA 2XEJA 2ZELA 4MCPA 3LWUA 3L2NA 3WABA 1ARLA 3PFEA 5LRKA 2EK8A 3B35A 3Q71A 4PQAA 4JLLA 2V8HA 2QJ8A 3FVLA 3WC7A 1YLOA 4FAIA 1LCPA 4ESSA 3PBEA 4R76A 2ZEPA 1F2PA 4Q7AA 2ZEHA 5FSZA 5DS0A 3BI0A 5K8NA 4H2KA 2FAVA 4J5RA 4EMEA 3FH4A 4GUAA 3GQOA 3N5FA 3SI1A 3NH8A 1DE4C 3H8FA 3SIIA 2PVVA 1YW6A 3V45A 2ZEGA 2PJ5A 3PB7X 4F9UA 4P6YA 4MHZA 3KHZA 3FX6A 2L8RA 5HXDA 3PB6X 3PB8X 2FG1A 4NGPA 3GQEA 5CB3A 4MCQA 1Q7LA 1TXRA 3VH9A 4JYWA 3TC8A 2DX6A 3IIDA 3BXMA 2C1CA 4TWEA 2IQ6A 4TU0A 1UWYA 4IK2A 4A94A 2PJ4A 2GLJA 4B6ZA 2V8VA 1JQGA 1XFOA 2IMOA 4D86A 1BAVA 1Y7EA 3NH4A 4YWYA 3PB4X 1ZR3A 2ZOFA 2JBKA 5HVHA 1YSJA 4DUKA 2VRIA 5J1QA 2X47A 5FSXA 3KASA 5HVGA 4UEEA 3EKEA 4BD9A 5FSYA 2ABZA 2ZEDA 1LANA 4G1PA 4K3NA 2PIYA 2O53A 1VIXA
chains in the Genus database with same CATH superfamily
4CAFA 4JXQA 3BI1A 2Z3LA 2WZNA 1QSTA 3JZTA 3PEIA 2PR1A 1ZLHA 3K9TA 1HJZA 2R8VA 2D4OA 3G8WA 4H6UA 3VWDA 5F46A 2ANPA 4UWJA 4PXDA 2KQVA 1B87A 4UCMA 2WPXA 4B10A 1S7LA 4PXCA 4W9YA 5AG4A 1IY7A 8CPAA 3EWPA 4P44A 5JGFA 2ZXVA 1IU8A 1TKHA 2NSMA 4K0CA 1LRZA 1XOVA 3JTKA 4YRHA 4DNCA 4MI4A 4AVBA 3EFAA 3V8IA 5G21A 3P2FA 4MHNA 2JEWA 3FRMA 4MCRA 5LYLA 3FMCA 4CS0B 5E96A 3H8GA 3K9UA 5CMSA 2POKA 1LAMA 4H89A 1YQEA 1EE3P 4GVVA 3T9YA 5LYIA 4P4FA 2Q4YA 1PYTB 4KSAA 3D2PA 2C6CA 3FEDA 3VARA 2GFQA 3DLJA 5I4MA 2ODFA 2PJ9A 3OWCA 2GANA 3D3SA 2GLFA 3D67A 4MHYA 5HMNA 4JVVA 4ZI6A 2ZEMA 2ZEEA 3FBUA 2PJ6A 4P4BA 7CPAA 2PR8A 1YGHA 2I00A 2JBJA 2Q43A 2QVPA 3D8PA 4UFWA 3D7FA 1UFHA 4DYOA 1BO4A 2HV2A 2OZGA 1IYKA 1S5KA 5CNPA 2PJ1A 1OZPA 4MFQA 4UIBA 1Z8LA 3D7DA 5JM6A 3N7ZA 2HC9A 4B14A 2FXFA 2B3UA 1BOBA 3FXTA 5HOLA 2C6PA 4CPAA 2AFOA 1TXZA 2AFSA 3I9SA 4KOVA 3S6KA 2G9DA 1XJOA 3D4UA 3PBBA 4PK3A 2F7VA 2AFZA 4RI1A 3ZZIA 3SJEA 3SJFA 2VQYA 4JZ0A 4M6IA 2HB6A 1ZLIA 1MK4A 4MHPA 4NSQA 3TFYA 1DTDA 1K4JA 4UEFA 2QIRA 4P45A 1QSOA 3TOBA 1YW4A 1SPVA 3Q6ZA 1CX8A 2OR4A 5LYFA 2ATRA 3PGPA 3WT4A 4J5QA 3B2YA 2P0WA 3K2KA 4NCZA 3HLPA 5G20A 3RO0A 2F5IA 3KQXA 2CIJA 2PJAA 1MJBA 3ISXA 4NGSA 4NJRA 4BBHA 1HDQA 5CPAA 2JZFA 1CG2A 2CTCA 3SIGA 1N71A 4UEZA 4XPLA 3HUVA 4UFVA 5IV0A 1CBXA 1ZR5A 3EW5A 3IC1A 4PK2A 2REFA 2AFWA 2WSAA 4NGTA 4HNXB 1VHSA 2B4BA 3P2HA 2FSRA 5EMIA 1Z5RA 2FS5A 1PU9A 1BPNA 2QYVA 2VZZA 4FWUA 4L89A 1ELLP 5AILA 3IEHA 3SI0A 5DWNA 1M1DA 1U6MA 2F8HA 2PJ8A 1YK3A 3KZWA 1Y9KA 2RNKA 3JRUA 3C26A 2Q44A 3LMSA 3GUXA 4QBJA 4DJLA 3KI9A 2PJ7A 5KTDA 3GKRA 3F0AA 3D7HA 3KHXA 5J8FA 3EO4A 4NEXA 2OB0A 2X7BA 4X3RA 2BL1A 2J8NA 1FNOA 4CYQA 3CXSA 2OH1A 1QQ9A 1BPMA 2BFQA 3T8WA 2Q4VA 2OOTA 1LOKA 2PE3A 1KWMA 3NE7A 1I12A 3RBUA 1HEEA 4KOXA 1YVOA 1ARMA 4A95A 3VFQA 4F0YA 5EC4A 4JJXA 2YNCA 3CXPA 4B5OA 1YMEA 2W2GA 4NGQA 2EBJA 4JWPA 3EJFA 1AMPA 5G22A 3MGDA 4A31A 3D66A 4F6AA 4ZGYB 4KSIA 1Y0YA 4QB9A 2Q7BA 3G3SA 4MRIA 2IJZA 4U9ZA 4CYNA 2PJBA 4ZY2A 3VWEA 4NGMA 4P4EA 1Z4RA 4A2ZA 4IF5A 4X8IA 5GCNA 4A38A 4GXHA 2VXKA 4NGRA 1IICA 1XF8A 3B7IA 1Z8XA 4MY0A 3I1UA 4PXBA 2ZPAA 1S7FA 2R7HA 3PB9X 4U9YA 5D29A 4KUAA 4UFXA 1XMBA 3PFOA 4XPKA 4XPDB 4NFRA 2XEFA 2P6FA 3B3TA 3MN8A 4R6TA 3ETIA 2VZYA 4KOWA 2JEVA 4Q38A 1YD9A 1IB1E 3DDDA 2B4DA 1S7NA 3JVNA 4U5YA 3S6HA 3W91A 3S9LA 4R9MA 3CZXA 3WR7A 2IL4A 4A30A 4LQ6A 4MCSA 1Z2LA 2EWBA 4TNUA 3KR5A 2AFMA 3KR4A 3H8EA 5EBVA 1WWZA 4R87A 2NMTA 2G3TA 4C7HA 2WYRA 2CNSA 1M4GA 4KSFA 4OC2A 4OC1A 4ZX8A 3BJ8A 3KL9A 4ONUA 1XMTA 2Q51A 3FNCA 1ZO0A 4FUUA 4J4ZA 3SJXA 4MFZA 4MMOA 4A39A 5JH9A 1R43A 1ZG7A 2V8GA 5F48A 4KVME 3CPXA 2O4HA 1QSRA 2ZOGA 3SI2A 4Y49C 5DUSA 3FIXA 4PSWA 3GPOA 5FSUA 1XRYA 1SQHA 2DXQA 4RS2A 4LX9A 1CP7A 1RXTA 1PCAA 1QSMA 2CF4A 2J8RA 3CPAA 3IU1A 3LODA 4UA3A 3R96A 2Q04A 2GIVA 4CYOA 4CAXA 4B5PB 3S6GA 4I49A 4OLLA 4YU9A 3BLNA 2V77A 3FJUA 2Q4ZA 2BUEA 2FIWA 4KYBA 1XIXA 1ZG8A 4JXRA 3TX8A 4C2XA 4UMLA 2ZW6A 3BHXA 3IO1A 4OC3A 4WJBA 5F49A 2PRBA 2DEAA 2FVGA 4AVCA 2JLMA 2QMLA 1YREA 4HNWB 2P6EA 3FB3A 5IB0A 5F09A 1RO5A 4LUAA 4CGPA 2B4DB 3NFZA 4MXUA 4ZYQA 4NXYA 3GB0A 3TTHA 4A33A 5CBMA 1IOIA 2V8DA 2PCUA 1KZFA 1V0CA 4AG9A 4CGLA 3QNVA 2Z10A 4XNHC 2PJ0A 1FY7A 1M4LA 3RNZA 4EVYA 3B3WA 2XD7A 4CAEA 2PJCA 2EK9A 4CGOA 4KOUA 4YGOA 1MJAA 2CNMA 1VGYA 3IFEA 4MFKA 5LYDA 4A32A 2R1IA 1RTQA 4ONWA 3MRUA 2PQ8A 3FF3A 4UF4A 4H6ZA 4X2TA 4LQGA 2J8MA 4KUBA 1IGBA 2BOAA 1TF8A 1VKCA 1J4JA 4GS4A 4MFLA 5H84A 3GLJA 2Z0ZA 4CRYB 1HDUA 5FSVA 2P6GA 2PRQA 2AE6A 2BSWA 2C27A 2Y0MA 3B3VA 5ELYA 1X10A 2PVWA 2EO8A 1ON0A 3EY5A 1Q2CA 3CDXA 3I3GA 4OADA 4OC5A 4NJQA 4PXEA 4QC6A 4BMHA 3IWWA 3IIFA 3KGQA 5D8NA 1I21A 2AFXA 4KS9A 1FT7A 5KTAA 2JZDA 4ZY0A 2K5TA 2VBQA 1AYEA 4MY3A 2ZENA 2J9AA 3QAYA 4CAWA 4ZY1A 3V2BA 1GYTA 2NYQA 2DPTA 4OKOA 2BO9A 2C6GA 1ELMP 2EEEA 3VATA 2XEGA 4JGKA 3B3CA 4A37A 3TCVA 4ETJA 3QAHA 4OC0A 4OAEA 3V7ZA 2FT0A 5H86A 4J3GA 5I0CA 1QMUA 4CRZB 1YLEA 1XEBA 4OC4A 5J8CA 2B5GA 1CM0A 2BEIA 2Z3NA 5LRGA 2AFUA 2Q7SA 4UCNA 4AXVA 4JD6A 4GM5A 5AG7A 2CY2A 3NA6A 2OU2A 1MJ9A 3IJ3A 5FVJA 3V38A 5AG6A 4JCAA 1F2OA 3TO7A 4F9VA 5K8OA 4UWIA 2AJ6A 4R8FA 1CP6A 1XE4A 1YVKA 1QSNA 4IHMA 4MJ8A 3F5BA 3WC6A 4ABKA 4PPZA 4F0XA 4II9A 3LD2A 2FXKA 3H4QA 2RFHA 4IAVA 5HVFA 4C7IA 1Y9WA 2CTBA 4KLWA 2Z3KA 1TY8A 4Q36A 5CB5A 2AFCA 2OZUA 3RAMA 1S7KA 4KLVA 4B5PA 1IOFA 1VHUA 3EWQA 4GVWA 4C2YA 2ZW7A 1R3NA 1NSAA 5KTCA 4IQYA 4ORFA 4KZTA 4NF1A 3TT2A 1TKFA 2DPSA 3FECA 2GU2A 3EWOA 1CPXA 4ETKA 3NH5A 4FD5A 2PC1A 4P4JA 1H8LA 4KOYA 1TKJA 1Z8WA 4FBEA 5ISVA 1ZG9A 2XEIA 4B13A 1OBRA 2Z3OA 4HPSA 4O23A 4R3KA 4WWVA 1I1DA 2HQYA 2KCWA 3FEEA 2YNEA 1CJWA 4R7MA 1WK4A 4MFJA 2HUZA 4P4DA 4BINA 2JDDA 5IB9A 2Z11A 1KUYA 1NMTA 1A2ZA 3D7GA 4J5SA 2PIZA 4C2ZA 4OIWA 2B3VA 2YGWA 4AVAA 2B5GB 2VI7A 3IGRA 5THWA 3EXNA 5K8MA 3DGVA 4Z65A 1VHEA 2VL1A 1CPSA 2ZW5A 2PSWA 4KVXA 4E2AA 1S60A 3KQZA 4FD7A 3FYNA 3GYAA 4KOTA 2PJ2A 1YR0A 5K8PA 1XBUA 1NJRA 2FCKA 3D68A 3SIHA 1R57A 2G3AA 2PJ3A 2FL4A 2YNCC 3LACA 3S9MA 1Y0RA 3SJGA 4E0AA 5HIHA 1IIDA 2RB7A 3B3SA 4ABLA 4P4IA 3DSBA 4OIDA 3SIJA 2ARHA 3T90A 4OMEA 2R98A 4M6HA 4FD6A 2GE3A 2JZEA 1S3ZA 1VHOA 2BFRA 4UIAA 5LRJA 6CPAA 1NE9A 3W6SA 4ZBGA 3WC5A 2WCTA 3DR8A 1LFWA 1Z4EA 3EWRA 3RZAA 4CAVA 3S9NA 3BJ7A 1TF9A 3ISZA 2ACFA 2LGRA 4RUHA 2GREA 3GY9A 4RN7A 3CXQA 5BWAB 3EJGA 3IIBA 1F57A 3R95A 5C82A 2I3CA 1LAPA 3GPGA 3EC4A 3GPQA 2ZEFA 3PRTA 1BLLE 3SXOA 4EFDA 2BCOA 2FE7A 4OP4A 1KUXA 2DF5A 2WUUA 4Y49B 2Z3MA 4NGNA 2D4PA 5F47A 4ZX9A 2ZEOA 4P10A 3B8GA 2WPWA 5E3BA 4C68A 3PZJA 3CT9A 4E8OA 2I79A 4F8ZA 4EWTA 2H5MA 2XEJA 2Z3PA 1M44A 2ZELA 4MCPA 3LWUA 4UCPA 3R9FA 4MFPA 3L2NA 3TOAA 1ARLA 3JUWA 3SXNA 3PFEA 3WABA 4AG7A 2EK8A 5LRKA 3B35A 3Q71A 4MHDA 1Z9UA 4PQAA 4JLLA 2V8HA 2QJ8A 2EVNA 3FVLA 2G0BA 3H5ZA 4PV6A 1IYLA 3WC7A 2RC4A 4B12A 1YLOA 4R57A 1LCPA 4ESSA 3F8KA 3W6XA 4FAIA 3PBEA 4R76A 4K30A 1P4NA 5DWMA 2ZEPA 3S6FA 1F2PA 2O28A 2ZEHA 5FSZA 4Q7AA 5DS0A 2EUIA 3UY5A 2FIAA 3BI0A 5K8NA 4XNHB 4H2KA 1M4DA 2FAVA 1AUGA 4J5RA 4CGNA 4EMEA 3FH4A 4GUAA 5JPHA 3GQOA 1TIQA 3N5FA 3SI1A 3NH8A 1DE4C 3H8FA 3SIIA 1GHEA 2B58A 4QVTA 5A27A 4KVOE 4L8AA 2PVVA 1YW6A 3ZJ0A 3TE4A 3V45A 2ZEGA 5JQ4A 2PJ5A 3IU2A 3E0KA 4UBRA 3PB7X 4JLYA 1Y7RA 4M3SA 4FD4A 3QB8A 4F9UA 4HKFA 4CYPA 4P6YA 4MHZA 2QECA 3FX6A 3KHZA 2L8RA 3GIUA 1NSLA 3PB6X 3PB8X 2FG1A 4NGPA 5A28A 5HXDA 2VEZA 3R9EA 3GQEA 3DR6A 5CB3A 4MCQA 4B11A 4R3LA 1Q7LA 1B6BA 1TXRA 3D2MA 2A4NA 3VH9A 2OZHA 4JYWA 3TC8A 2DX6A 3IIDA 3BXMA 2C1CA 3R9GA 3DNSA 2CXAA 4TWEA 2CNTA 2IQ6A 3KKWA 4PSXA 4TU0A 1UWYA 3NE8A 5G1ZA 5AGEA 4IK2A 2ZW4A 4A94A 4M6GA 2PJ4A 2GLJA 4B6ZA 3IWEA 2V8VA 4X5KA 1JQGA 1XFOA 2Q0YA 1L0CA 2IMOA 4D86A 1BAVA 3PP9A 1Y7EA 1Q2YA 3NH4A 4YWYA 3PB4X 3TO9A 4YFJA 1KUVA 1ZR3A 4M85A 3TO6A 2ZOFA 4HNYB 2JBKA 5C88A 1Z8TA 5HVHA 1YSJA 2JDCA 2PDOA 2YNDA 4XPDC 4DUKA 2VRIA 2REEA 4KORA 5HH1A 4QUSA 3IWGA 4KOSA 3RYOA 2X47A 4CGMA 5FSXA 3A9LA 5J1QA 3KASA 5HVGA 1YX0A 3R1KA 1X12A 5IX3A 4MBUA 1P0HA 4UEEA 5AG5A 4AB7A 1PUAA 1JWQA 4IUSA 3EKEA 1Q2DA 4BD9A 3SHPA 5FSYA 2ABZA 1M4IA 2ZEDA 1LANA 4G1PA 4K3NA 2PIYA 2O53A 1VIXA
chains in the Genus database with same CATH topology
3BI1A 2WZNA 3K9TA 3JZTA 3PEIA 1ZLHA 1HJZA 2ANPA 4PXDA 4PXCA 4W9YA 1IY7A 8CPAA 3EWPA 4P44A 5JGFA 1TKHA 2NSMA 4K0CA 4MHNA 2JEWA 4MCRA 5LYLA 3FMCA 3H8GA 5CMSA 2POKA 1LAMA 1EE3P 4GVVA 5LYIA 4P4FA 1PYTB 2C6CA 3FEDA 3VARA 3DLJA 5I4MA 2PJ9A 3D67A 2GLFA 4MHYA 4JVVA 2ZEMA 4ZI6A 2ZEEA 4P4BA 2PJ6A 7CPAA 2Q43A 2QVPA 2JBJA 3D7FA 4DYOA 2PJ1A 4UIBA 1Z8LA 3D7DA 5JM6A 2HC9A 5HOLA 2C6PA 4CPAA 2AFOA 1TXZA 2AFSA 2G9DA 1XJOA 3D4UA 3PBBA 2F7VA 2AFZA 3SJEA 3SJFA 4JZ0A 4MHPA 2HB6A 1ZLIA 1DTDA 4UEFA 4P45A 1YW4A 1SPVA 3Q6ZA 1CX8A 2OR4A 5LYFA 3WT4A 4J5QA 3B2YA 3K2KA 3HLPA 3KQXA 2CIJA 2PJAA 3ISXA 4NGSA 4NJRA 1HDQA 5CPAA 1CG2A 2CTCA 3SIGA 4UEZA 3HUVA 1CBXA 1ZR5A 3EW5A 3IC1A 2AFWA 4NGTA 1Z5RA 1BPNA 2QYVA 4FWUA 1ELLP 5AILA 3IEHA 3SI0A 2F8HA 2PJ8A 3KZWA 3JRUA 3LMSA 3GUXA 4DJLA 3KI9A 2PJ7A 3D7HA 3KHXA 4X3RA 1FNOA 1QQ9A 1BPMA 2BFQA 3T8WA 2OOTA 1LOKA 2PE3A 1KWMA 3RBUA 1HEEA 1ARMA 3VFQA 1YMEA 4NGQA 3EJFA 1AMPA 3D66A 4KSIA 1Y0YA 4MRIA 2IJZA 2PJBA 4ZY2A 4NGMA 4P4EA 4X8IA 4A38A 4NGRA 3B7IA 3I1UA 4PXBA 3PB9X 5D29A 1XMBA 3PFOA 4NFRA 2XEFA 3B3TA 3MN8A 4R6TA 3ETIA 1YD9A 3S9LA 4MCSA 1Z2LA 2EWBA 4TNUA 3KR5A 2AFMA 3KR4A 3H8EA 2WYRA 4OC2A 4OC1A 4ZX8A 3KL9A 2Q51A 4FUUA 4J4ZA 3SJXA 4A39A 4MMOA 5JH9A 1R43A 1ZG7A 2V8GA 3CPXA 2O4HA 3SI2A 2ZOGA 5DUSA 3GPOA 5FSUA 1XRYA 1CP7A 1PCAA 2CF4A 3CPAA 4YU9A 2V77A 3FJUA 2Q4ZA 4KYBA 1ZG8A 3TX8A 4UMLA 3BHXA 3IO1A 4OC3A 4WJBA 2DEAA 2FVGA 5F09A 3NFZA 4MXUA 4ZYQA 3GB0A 5CBMA 2V8DA 2PCUA 3QNVA 2PJ0A 1M4LA 3B3WA 2XD7A 2PJCA 2EK9A 3IFEA 1VGYA 5LYDA 1RTQA 4ONWA 3MRUA 3FF3A 4UF4A 4LQGA 4X2TA 2BOAA 1IGBA 1TF8A 3GLJA 1HDUA 5FSVA 2PRQA 5ELYA 3B3VA 2PVWA 3CDXA 4PXEA 4OC5A 4NJQA 3IWWA 3IIFA 3KGQA 5D8NA 2AFXA 1FT7A 4ZY0A 1AYEA 2ZENA 2J9AA 4ZY1A 3V2BA 1GYTA 2NYQA 4OKOA 2BO9A 2C6GA 1ELMP 2EEEA 3VATA 2XEGA 4JGKA 3B3CA 4A37A 4ETJA 4OC0A 3V7ZA 1QMUA 4OC4A 5LRGA 2AFUA 4AXVA 4GM5A 3NA6A 3IJ3A 3V38A 4JCAA 1F2OA 4F9VA 5K8OA 4R8FA 1CP6A 4IHMA 3WC6A 4ABKA 4PPZA 2FXKA 2RFHA 4IAVA 5HVFA 2CTBA 1TY8A 5CB5A 2AFCA 3RAMA 1VHUA 3EWQA 4GVWA 1R3NA 1NSAA 4IQYA 1TKFA 3FECA 2GU2A 3EWOA 1CPXA 4ETKA 3NH5A 4P4JA 5IB9A 1H8LA 1TKJA 4FBEA 1ZG9A 2XEIA 1OBRA 4O23A 4WWVA 3FEEA 4P4DA 4R7MA 3D7GA 4J5SA 2PIZA 4OIWA 5THWA 5K8MA 3DGVA 4Z65A 2VL1A 1VHEA 1CPSA 3KQZA 2PJ2A 5K8PA 1XBUA 1NJRA 3D68A 3S9MA 3SIHA 3SJGA 2PJ3A 1Y0RA 5HIHA 2RB7A 3B3SA 4ABLA 4P4IA 4OIDA 3SIJA 4OMEA 1VHOA 2BFRA 4UIAA 5LRJA 6CPAA 3WC5A 1LFWA 3EWRA 3RZAA 3S9NA 1TF9A 3ISZA 2ACFA 2LGRA 4RUHA 2GREA 3EJGA 3IIBA 1F57A 2I3CA 1LAPA 3GPGA 3GPQA 2ZEFA 3PRTA 1BLLE 4EFDA 2BCOA 4OP4A 4NGNA 4ZX9A 2ZEOA 4P10A 5E3BA 3CT9A 4F8ZA 4EWTA 2XEJA 2ZELA 4MCPA 3LWUA 3L2NA 3WABA 1ARLA 3PFEA 5LRKA 2EK8A 3B35A 3Q71A 4PQAA 4JLLA 2V8HA 2QJ8A 3FVLA 3WC7A 1YLOA 4FAIA 1LCPA 4ESSA 3PBEA 4R76A 2ZEPA 1F2PA 4Q7AA 2ZEHA 5FSZA 5DS0A 3BI0A 5K8NA 4H2KA 2FAVA 4J5RA 4EMEA 3FH4A 4GUAA 3GQOA 3N5FA 3SI1A 3NH8A 1DE4C 3H8FA 3SIIA 2PVVA 1YW6A 3V45A 2ZEGA 2PJ5A 3PB7X 4F9UA 4P6YA 4MHZA 3KHZA 3FX6A 2L8RA 5HXDA 3PB6X 3PB8X 2FG1A 4NGPA 3GQEA 5CB3A 4MCQA 1Q7LA 1TXRA 3VH9A 4JYWA 3TC8A 2DX6A 3IIDA 3BXMA 2C1CA 4TWEA 2IQ6A 4TU0A 1UWYA 4IK2A 4A94A 2PJ4A 2GLJA 4B6ZA 2V8VA 1JQGA 1XFOA 2IMOA 4D86A 1BAVA 1Y7EA 3NH4A 4YWYA 3PB4X 1ZR3A 2ZOFA 2JBKA 5HVHA 1YSJA 4DUKA 2VRIA 5J1QA 2X47A 5FSXA 3KASA 5HVGA 4UEEA 3EKEA 4BD9A 5FSYA 2ABZA 2ZEDA 1LANA 4G1PA 4K3NA 2PIYA 2O53A 1VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BI1 A;  2WZN A;  3K9T A;  3JZT A;  3PEI A;  1ZLH A;  1HJZ A;  2ANP A;  4PXD A;  4PXC A;  4W9Y A;  1IY7 A;  8CPA A;  3EWP A;  4P44 A;  5JGF A;  1TKH A;  2NSM A;  4K0C A;  4MHN A;  2JEW A;  4MCR A;  5LYL A;  3FMC A;  3H8G A;  5CMS A;  2POK A;  1LAM A;  1EE3 P;  4GVV A;  5LYI A;  4P4F A;  1PYT B;  2C6C A;  3FED A;  3VAR A;  3DLJ A;  5I4M A;  2PJ9 A;  3D67 A;  2GLF A;  4MHY A;  4JVV A;  2ZEM A;  4ZI6 A;  2ZEE A;  4P4B A;  2PJ6 A;  7CPA A;  2Q43 A;  2QVP A;  2JBJ A;  3D7F A;  4DYO A;  2PJ1 A;  4UIB A;  1Z8L A;  3D7D A;  5JM6 A;  2HC9 A;  5HOL A;  2C6P A;  4CPA A;  2AFO A;  1TXZ A;  2AFS A;  2G9D A;  1XJO A;  3D4U A;  3PBB A;  2F7V A;  2AFZ A;  3SJE A;  3SJF A;  4JZ0 A;  4MHP A;  2HB6 A;  1ZLI A;  1DTD A;  4UEF A;  4P45 A;  1YW4 A;  1SPV A;  3Q6Z A;  1CX8 A;  2OR4 A;  5LYF A;  3WT4 A;  4J5Q A;  3B2Y A;  3K2K A;  3HLP A;  3KQX A;  2CIJ A;  2PJA A;  3ISX A;  4NGS A;  4NJR A;  1HDQ A;  5CPA A;  1CG2 A;  2CTC A;  3SIG A;  4UEZ A;  3HUV A;  1CBX A;  1ZR5 A;  3EW5 A;  3IC1 A;  2AFW A;  4NGT A;  1Z5R A;  1BPN A;  2QYV A;  4FWU A;  1ELL P;  5AIL A;  3IEH A;  3SI0 A;  2F8H A;  2PJ8 A;  3KZW A;  3JRU A;  3LMS A;  3GUX A;  4DJL A;  3KI9 A;  2PJ7 A;  3D7H A;  3KHX A;  4X3R A;  1FNO A;  1QQ9 A;  1BPM A;  2BFQ A;  3T8W A;  2OOT A;  1LOK A;  2PE3 A;  1KWM A;  3RBU A;  1HEE A;  1ARM A;  3VFQ A;  1YME A;  4NGQ A;  3EJF A;  1AMP A;  3D66 A;  4KSI A;  1Y0Y A;  4MRI A;  2IJZ A;  2PJB A;  4ZY2 A;  4NGM A;  4P4E A;  4X8I A;  4A38 A;  4NGR A;  3B7I A;  3I1U A;  4PXB A;  3PB9 X;  5D29 A;  1XMB A;  3PFO A;  4NFR A;  2XEF A;  3B3T A;  3MN8 A;  4R6T A;  3ETI A;  1YD9 A;  3S9L A;  4MCS A;  1Z2L A;  2EWB A;  4TNU A;  3KR5 A;  2AFM A;  3KR4 A;  3H8E A;  2WYR A;  4OC2 A;  4OC1 A;  4ZX8 A;  3KL9 A;  2Q51 A;  4FUU A;  4J4Z A;  3SJX A;  4A39 A;  4MMO A;  5JH9 A;  1R43 A;  1ZG7 A;  2V8G A;  3CPX A;  2O4H A;  3SI2 A;  2ZOG A;  5DUS A;  3GPO A;  5FSU A;  1XRY A;  1CP7 A;  1PCA A;  2CF4 A;  3CPA A;  4YU9 A;  2V77 A;  3FJU A;  2Q4Z A;  4KYB A;  1ZG8 A;  3TX8 A;  4UML A;  3BHX A;  3IO1 A;  4OC3 A;  4WJB A;  2DEA A;  2FVG A;  5F09 A;  3NFZ A;  4MXU A;  4ZYQ A;  3GB0 A;  5CBM A;  2V8D A;  2PCU A;  3QNV A;  2PJ0 A;  1M4L A;  3B3W A;  2XD7 A;  2PJC A;  2EK9 A;  3IFE A;  1VGY A;  5LYD A;  1RTQ A;  4ONW A;  3MRU A;  3FF3 A;  4UF4 A;  4LQG A;  4X2T A;  2BOA A;  1IGB A;  1TF8 A;  3GLJ A;  1HDU A;  5FSV A;  2PRQ A;  5ELY A;  3B3V A;  2PVW A;  3CDX A;  4PXE A;  4OC5 A;  4NJQ A;  3IWW A;  3IIF A;  3KGQ A;  5D8N A;  2AFX A;  1FT7 A;  4ZY0 A;  1AYE A;  2ZEN A;  2J9A A;  4ZY1 A;  3V2B A;  1GYT A;  2NYQ A;  4OKO A;  2BO9 A;  2C6G A;  1ELM P;  2EEE A;  3VAT A;  2XEG A;  4JGK A;  3B3C A;  4A37 A;  4ETJ A;  4OC0 A;  3V7Z A;  1QMU A;  4OC4 A;  5LRG A;  2AFU A;  4AXV A;  4GM5 A;  3NA6 A;  3IJ3 A;  3V38 A;  4JCA A;  1F2O A;  4F9V A;  5K8O A;  4R8F A;  1CP6 A;  4IHM A;  3WC6 A;  4ABK A;  4PPZ A;  2FXK A;  2RFH A;  4IAV A;  5HVF A;  2CTB A;  1TY8 A;  5CB5 A;  2AFC A;  3RAM A;  1VHU A;  3EWQ A;  4GVW A;  1R3N A;  1NSA A;  4IQY A;  1TKF A;  3FEC A;  2GU2 A;  3EWO A;  1CPX A;  4ETK A;  3NH5 A;  4P4J A;  5IB9 A;  1H8L A;  1TKJ A;  4FBE A;  1ZG9 A;  2XEI A;  1OBR A;  4O23 A;  4WWV A;  3FEE A;  4P4D A;  4R7M A;  3D7G A;  4J5S A;  2PIZ A;  4OIW A;  5THW A;  5K8M A;  3DGV A;  4Z65 A;  2VL1 A;  1VHE A;  1CPS A;  3KQZ A;  2PJ2 A;  5K8P A;  1XBU A;  1NJR A;  3D68 A;  3S9M A;  3SIH A;  3SJG A;  2PJ3 A;  1Y0R A;  5HIH A;  2RB7 A;  3B3S A;  4ABL A;  4P4I A;  4OID A;  3SIJ A;  4OME A;  1VHO A;  2BFR A;  4UIA A;  5LRJ A;  6CPA A;  3WC5 A;  1LFW A;  3EWR A;  3RZA A;  3S9N A;  1TF9 A;  3ISZ A;  2ACF A;  2LGR A;  4RUH A;  2GRE A;  3EJG A;  3IIB A;  1F57 A;  2I3C A;  1LAP A;  3GPG A;  3GPQ A;  2ZEF A;  3PRT A;  1BLL E;  4EFD A;  2BCO A;  4OP4 A;  4NGN A;  4ZX9 A;  2ZEO A;  4P10 A;  5E3B A;  3CT9 A;  4F8Z A;  4EWT A;  2XEJ A;  2ZEL A;  4MCP A;  3LWU A;  3L2N A;  3WAB A;  1ARL A;  3PFE A;  5LRK A;  2EK8 A;  3B35 A;  3Q71 A;  4PQA A;  4JLL A;  2V8H A;  2QJ8 A;  3FVL A;  3WC7 A;  1YLO A;  4FAI A;  1LCP A;  4ESS A;  3PBE A;  4R76 A;  2ZEP A;  1F2P A;  4Q7A A;  2ZEH A;  5FSZ A;  5DS0 A;  3BI0 A;  5K8N A;  4H2K A;  2FAV A;  4J5R A;  4EME A;  3FH4 A;  4GUA A;  3GQO A;  3N5F A;  3SI1 A;  3NH8 A;  1DE4 C;  3H8F A;  3SII A;  2PVV A;  1YW6 A;  3V45 A;  2ZEG A;  2PJ5 A;  3PB7 X;  4F9U A;  4P6Y A;  4MHZ A;  3KHZ A;  3FX6 A;  2L8R A;  5HXD A;  3PB6 X;  3PB8 X;  2FG1 A;  4NGP A;  3GQE A;  5CB3 A;  4MCQ A;  1Q7L A;  1TXR A;  3VH9 A;  4JYW A;  3TC8 A;  2DX6 A;  3IID A;  3BXM A;  2C1C A;  4TWE A;  2IQ6 A;  4TU0 A;  1UWY A;  4IK2 A;  4A94 A;  2PJ4 A;  2GLJ A;  4B6Z A;  2V8V A;  1JQG A;  1XFO A;  2IMO A;  4D86 A;  1BAV A;  1Y7E A;  3NH4 A;  4YWY A;  3PB4 X;  1ZR3 A;  2ZOF A;  2JBK A;  5HVH A;  1YSJ A;  4DUK A;  2VRI A;  5J1Q A;  2X47 A;  5FSX A;  3KAS A;  5HVG A;  4UEE A;  3EKE A;  4BD9 A;  5FSY A;  2ABZ A;  2ZED A;  1LAN A;  4G1P A;  4K3N A;  2PIY A;  2O53 A;  1VIX A; 
#chains in the Genus database with same CATH topology
 4CAF A;  4JXQ A;  3BI1 A;  2Z3L A;  2WZN A;  1QST A;  3JZT A;  3PEI A;  2PR1 A;  1ZLH A;  3K9T A;  1HJZ A;  2R8V A;  2D4O A;  3G8W A;  4H6U A;  3VWD A;  5F46 A;  2ANP A;  4UWJ A;  4PXD A;  2KQV A;  1B87 A;  4UCM A;  2WPX A;  4B10 A;  1S7L A;  4PXC A;  4W9Y A;  5AG4 A;  1IY7 A;  8CPA A;  3EWP A;  4P44 A;  5JGF A;  2ZXV A;  1IU8 A;  1TKH A;  2NSM A;  4K0C A;  1LRZ A;  1XOV A;  3JTK A;  4YRH A;  4DNC A;  4MI4 A;  4AVB A;  3EFA A;  3V8I A;  5G21 A;  3P2F A;  4MHN A;  2JEW A;  3FRM A;  4MCR A;  5LYL A;  3FMC A;  4CS0 B;  5E96 A;  3H8G A;  3K9U A;  5CMS A;  2POK A;  1LAM A;  4H89 A;  1YQE A;  1EE3 P;  4GVV A;  3T9Y A;  5LYI A;  4P4F A;  2Q4Y A;  1PYT B;  4KSA A;  3D2P A;  2C6C A;  3FED A;  3VAR A;  2GFQ A;  3DLJ A;  5I4M A;  2ODF A;  2PJ9 A;  3OWC A;  2GAN A;  3D3S A;  2GLF A;  3D67 A;  4MHY A;  5HMN A;  4JVV A;  4ZI6 A;  2ZEM A;  2ZEE A;  3FBU A;  2PJ6 A;  4P4B A;  7CPA A;  2PR8 A;  1YGH A;  2I00 A;  2JBJ A;  2Q43 A;  2QVP A;  3D8P A;  4UFW A;  3D7F A;  1UFH A;  4DYO A;  1BO4 A;  2HV2 A;  2OZG A;  1IYK A;  1S5K A;  5CNP A;  2PJ1 A;  1OZP A;  4MFQ A;  4UIB A;  1Z8L A;  3D7D A;  5JM6 A;  3N7Z A;  2HC9 A;  4B14 A;  2FXF A;  2B3U A;  1BOB A;  3FXT A;  5HOL A;  2C6P A;  4CPA A;  2AFO A;  1TXZ A;  2AFS A;  3I9S A;  4KOV A;  3S6K A;  2G9D A;  1XJO A;  3D4U A;  3PBB A;  4PK3 A;  2F7V A;  2AFZ A;  4RI1 A;  3ZZI A;  3SJE A;  3SJF A;  2VQY A;  4JZ0 A;  4M6I A;  2HB6 A;  1ZLI A;  1MK4 A;  4MHP A;  4NSQ A;  3TFY A;  1DTD A;  1K4J A;  4UEF A;  2QIR A;  4P45 A;  1QSO A;  3TOB A;  1YW4 A;  1SPV A;  3Q6Z A;  1CX8 A;  2OR4 A;  5LYF A;  2ATR A;  3PGP A;  3WT4 A;  4J5Q A;  3B2Y A;  2P0W A;  3K2K A;  4NCZ A;  3HLP A;  5G20 A;  3RO0 A;  2F5I A;  3KQX A;  2CIJ A;  2PJA A;  1MJB A;  3ISX A;  4NGS A;  4NJR A;  4BBH A;  1HDQ A;  5CPA A;  2JZF A;  1CG2 A;  2CTC A;  3SIG A;  1N71 A;  4UEZ A;  4XPL A;  3HUV A;  4UFV A;  5IV0 A;  1CBX A;  1ZR5 A;  3EW5 A;  3IC1 A;  4PK2 A;  2REF A;  2AFW A;  2WSA A;  4NGT A;  4HNX B;  1VHS A;  2B4B A;  3P2H A;  2FSR A;  5EMI A;  1Z5R A;  2FS5 A;  1PU9 A;  1BPN A;  2QYV A;  2VZZ A;  4FWU A;  4L89 A;  1ELL P;  5AIL A;  3IEH A;  3SI0 A;  5DWN A;  1M1D A;  1U6M A;  2F8H A;  2PJ8 A;  1YK3 A;  3KZW A;  1Y9K A;  2RNK A;  3JRU A;  3C26 A;  2Q44 A;  3LMS A;  3GUX A;  4QBJ A;  4DJL A;  3KI9 A;  2PJ7 A;  5KTD A;  3GKR A;  3F0A A;  3D7H A;  3KHX A;  5J8F A;  3EO4 A;  4NEX A;  2OB0 A;  2X7B A;  4X3R A;  2BL1 A;  2J8N A;  1FNO A;  4CYQ A;  3CXS A;  2OH1 A;  1QQ9 A;  1BPM A;  2BFQ A;  3T8W A;  2Q4V A;  2OOT A;  1LOK A;  2PE3 A;  1KWM A;  3NE7 A;  1I12 A;  3RBU A;  1HEE A;  4KOX A;  1YVO A;  1ARM A;  4A95 A;  3VFQ A;  4F0Y A;  5EC4 A;  4JJX A;  2YNC A;  3CXP A;  4B5O A;  1YME A;  2W2G A;  4NGQ A;  2EBJ A;  4JWP A;  3EJF A;  1AMP A;  5G22 A;  3MGD A;  4A31 A;  3D66 A;  4F6A A;  4ZGY B;  4KSI A;  1Y0Y A;  4QB9 A;  2Q7B A;  3G3S A;  4MRI A;  2IJZ A;  4U9Z A;  4CYN A;  2PJB A;  4ZY2 A;  3VWE A;  4NGM A;  4P4E A;  1Z4R A;  4A2Z A;  4IF5 A;  4X8I A;  5GCN A;  4A38 A;  4GXH A;  2VXK A;  4NGR A;  1IIC A;  1XF8 A;  3B7I A;  1Z8X A;  4MY0 A;  3I1U A;  4PXB A;  2ZPA A;  1S7F A;  2R7H A;  3PB9 X;  4U9Y A;  5D29 A;  4KUA A;  4UFX A;  1XMB A;  3PFO A;  4XPK A;  4XPD B;  4NFR A;  2XEF A;  2P6F A;  3B3T A;  3MN8 A;  4R6T A;  3ETI A;  2VZY A;  4KOW A;  2JEV A;  4Q38 A;  1YD9 A;  1IB1 E;  3DDD A;  2B4D A;  1S7N A;  3JVN A;  4U5Y A;  3S6H A;  3W91 A;  3S9L A;  4R9M A;  3CZX A;  3WR7 A;  2IL4 A;  4A30 A;  4LQ6 A;  4MCS A;  1Z2L A;  2EWB A;  4TNU A;  3KR5 A;  2AFM A;  3KR4 A;  3H8E A;  5EBV A;  1WWZ A;  4R87 A;  2NMT A;  2G3T A;  4C7H A;  2WYR A;  2CNS A;  1M4G A;  4KSF A;  4OC2 A;  4OC1 A;  4ZX8 A;  3BJ8 A;  3KL9 A;  4ONU A;  1XMT A;  2Q51 A;  3FNC A;  1ZO0 A;  4FUU A;  4J4Z A;  3SJX A;  4MFZ A;  4MMO A;  4A39 A;  5JH9 A;  1R43 A;  1ZG7 A;  2V8G A;  5F48 A;  4KVM E;  3CPX A;  2O4H A;  1QSR A;  2ZOG A;  3SI2 A;  4Y49 C;  5DUS A;  3FIX A;  4PSW A;  3GPO A;  5FSU A;  1XRY A;  1SQH A;  2DXQ A;  4RS2 A;  4LX9 A;  1CP7 A;  1RXT A;  1PCA A;  1QSM A;  2CF4 A;  2J8R A;  3CPA A;  3IU1 A;  3LOD A;  4UA3 A;  3R96 A;  2Q04 A;  2GIV A;  4CYO A;  4CAX A;  4B5P B;  3S6G A;  4I49 A;  4OLL A;  4YU9 A;  3BLN A;  2V77 A;  3FJU A;  2Q4Z A;  2BUE A;  2FIW A;  4KYB A;  1XIX A;  1ZG8 A;  4JXR A;  3TX8 A;  4C2X A;  4UML A;  2ZW6 A;  3BHX A;  3IO1 A;  4OC3 A;  4WJB A;  5F49 A;  2PRB A;  2DEA A;  2FVG A;  4AVC A;  2JLM A;  2QML A;  1YRE A;  4HNW B;  2P6E A;  3FB3 A;  5IB0 A;  5F09 A;  1RO5 A;  4LUA A;  4CGP A;  2B4D B;  3NFZ A;  4MXU A;  4ZYQ A;  4NXY A;  3GB0 A;  3TTH A;  4A33 A;  5CBM A;  1IOI A;  2V8D A;  2PCU A;  1KZF A;  1V0C A;  4AG9 A;  4CGL A;  3QNV A;  2Z10 A;  4XNH C;  2PJ0 A;  1FY7 A;  1M4L A;  3RNZ A;  4EVY A;  3B3W A;  2XD7 A;  4CAE A;  2PJC A;  2EK9 A;  4CGO A;  4KOU A;  4YGO A;  1MJA A;  2CNM A;  1VGY A;  3IFE A;  4MFK A;  5LYD A;  4A32 A;  2R1I A;  1RTQ A;  4ONW A;  3MRU A;  2PQ8 A;  3FF3 A;  4UF4 A;  4H6Z A;  4X2T A;  4LQG A;  2J8M A;  4KUB A;  1IGB A;  2BOA A;  1TF8 A;  1VKC A;  1J4J A;  4GS4 A;  4MFL A;  5H84 A;  3GLJ A;  2Z0Z A;  4CRY B;  1HDU A;  5FSV A;  2P6G A;  2PRQ A;  2AE6 A;  2BSW A;  2C27 A;  2Y0M A;  3B3V A;  5ELY A;  1X10 A;  2PVW A;  2EO8 A;  1ON0 A;  3EY5 A;  1Q2C A;  3CDX A;  3I3G A;  4OAD A;  4OC5 A;  4NJQ A;  4PXE A;  4QC6 A;  4BMH A;  3IWW A;  3IIF A;  3KGQ A;  5D8N A;  1I21 A;  2AFX A;  4KS9 A;  1FT7 A;  5KTA A;  2JZD A;  4ZY0 A;  2K5T A;  2VBQ A;  1AYE A;  4MY3 A;  2ZEN A;  2J9A A;  3QAY A;  4CAW A;  4ZY1 A;  3V2B A;  1GYT A;  2NYQ A;  2DPT A;  4OKO A;  2BO9 A;  2C6G A;  1ELM P;  2EEE A;  3VAT A;  2XEG A;  4JGK A;  3B3C A;  4A37 A;  3TCV A;  4ETJ A;  3QAH A;  4OC0 A;  4OAE A;  3V7Z A;  2FT0 A;  5H86 A;  4J3G A;  5I0C A;  1QMU A;  4CRZ B;  1YLE A;  1XEB A;  4OC4 A;  5J8C A;  2B5G A;  1CM0 A;  2BEI A;  2Z3N A;  5LRG A;  2AFU A;  2Q7S A;  4UCN A;  4AXV A;  4JD6 A;  4GM5 A;  5AG7 A;  2CY2 A;  3NA6 A;  2OU2 A;  1MJ9 A;  3IJ3 A;  5FVJ A;  3V38 A;  5AG6 A;  4JCA A;  1F2O A;  3TO7 A;  4F9V A;  5K8O A;  4UWI A;  2AJ6 A;  4R8F A;  1CP6 A;  1XE4 A;  1YVK A;  1QSN A;  4IHM A;  4MJ8 A;  3F5B A;  3WC6 A;  4ABK A;  4PPZ A;  4F0X A;  4II9 A;  3LD2 A;  2FXK A;  3H4Q A;  2RFH A;  4IAV A;  5HVF A;  4C7I A;  1Y9W A;  2CTB A;  4KLW A;  2Z3K A;  1TY8 A;  4Q36 A;  5CB5 A;  2AFC A;  2OZU A;  3RAM A;  1S7K A;  4KLV A;  4B5P A;  1IOF A;  1VHU A;  3EWQ A;  4GVW A;  4C2Y A;  2ZW7 A;  1R3N A;  1NSA A;  5KTC A;  4IQY A;  4ORF A;  4KZT A;  4NF1 A;  3TT2 A;  1TKF A;  2DPS A;  3FEC A;  2GU2 A;  3EWO A;  1CPX A;  4ETK A;  3NH5 A;  4FD5 A;  2PC1 A;  4P4J A;  1H8L A;  4KOY A;  1TKJ A;  1Z8W A;  4FBE A;  5ISV A;  1ZG9 A;  2XEI A;  4B13 A;  1OBR A;  2Z3O A;  4HPS A;  4O23 A;  4R3K A;  4WWV A;  1I1D A;  2HQY A;  2KCW A;  3FEE A;  2YNE A;  1CJW A;  4R7M A;  1WK4 A;  4MFJ A;  2HUZ A;  4P4D A;  4BIN A;  2JDD A;  5IB9 A;  2Z11 A;  1KUY A;  1NMT A;  1A2Z A;  3D7G A;  4J5S A;  2PIZ A;  4C2Z A;  4OIW A;  2B3V A;  2YGW A;  4AVA A;  2B5G B;  2VI7 A;  3IGR A;  5THW A;  3EXN A;  5K8M A;  3DGV A;  4Z65 A;  1VHE A;  2VL1 A;  1CPS A;  2ZW5 A;  2PSW A;  4KVX A;  4E2A A;  1S60 A;  3KQZ A;  4FD7 A;  3FYN A;  3GYA A;  4KOT A;  2PJ2 A;  1YR0 A;  5K8P A;  1XBU A;  1NJR A;  2FCK A;  3D68 A;  3SIH A;  1R57 A;  2G3A A;  2PJ3 A;  2FL4 A;  2YNC C;  3LAC A;  3S9M A;  1Y0R A;  3SJG A;  4E0A A;  5HIH A;  1IID A;  2RB7 A;  3B3S A;  4ABL A;  4P4I A;  3DSB A;  4OID A;  3SIJ A;  2ARH A;  3T90 A;  4OME A;  2R98 A;  4M6H A;  4FD6 A;  2GE3 A;  2JZE A;  1S3Z A;  1VHO A;  2BFR A;  4UIA A;  5LRJ A;  6CPA A;  1NE9 A;  3W6S A;  4ZBG A;  3WC5 A;  2WCT A;  3DR8 A;  1LFW A;  1Z4E A;  3EWR A;  3RZA A;  4CAV A;  3S9N A;  3BJ7 A;  1TF9 A;  3ISZ A;  2ACF A;  2LGR A;  4RUH A;  2GRE A;  3GY9 A;  4RN7 A;  3CXQ A;  5BWA B;  3EJG A;  3IIB A;  1F57 A;  3R95 A;  5C82 A;  2I3C A;  1LAP A;  3GPG A;  3EC4 A;  3GPQ A;  2ZEF A;  3PRT A;  1BLL E;  3SXO A;  4EFD A;  2BCO A;  2FE7 A;  4OP4 A;  1KUX A;  2DF5 A;  2WUU A;  4Y49 B;  2Z3M A;  4NGN A;  2D4P A;  5F47 A;  4ZX9 A;  2ZEO A;  4P10 A;  3B8G A;  2WPW A;  5E3B A;  4C68 A;  3PZJ A;  3CT9 A;  4E8O A;  2I79 A;  4F8Z A;  4EWT A;  2H5M A;  2XEJ A;  2Z3P A;  1M44 A;  2ZEL A;  4MCP A;  3LWU A;  4UCP A;  3R9F A;  4MFP A;  3L2N A;  3TOA A;  1ARL A;  3JUW A;  3SXN A;  3PFE A;  3WAB A;  4AG7 A;  2EK8 A;  5LRK A;  3B35 A;  3Q71 A;  4MHD A;  1Z9U A;  4PQA A;  4JLL A;  2V8H A;  2QJ8 A;  2EVN A;  3FVL A;  2G0B A;  3H5Z A;  4PV6 A;  1IYL A;  3WC7 A;  2RC4 A;  4B12 A;  1YLO A;  4R57 A;  1LCP A;  4ESS A;  3F8K A;  3W6X A;  4FAI A;  3PBE A;  4R76 A;  4K30 A;  1P4N A;  5DWM A;  2ZEP A;  3S6F A;  1F2P A;  2O28 A;  2ZEH A;  5FSZ A;  4Q7A A;  5DS0 A;  2EUI A;  3UY5 A;  2FIA A;  3BI0 A;  5K8N A;  4XNH B;  4H2K A;  1M4D A;  2FAV A;  1AUG A;  4J5R A;  4CGN A;  4EME A;  3FH4 A;  4GUA A;  5JPH A;  3GQO A;  1TIQ A;  3N5F A;  3SI1 A;  3NH8 A;  1DE4 C;  3H8F A;  3SII A;  1GHE A;  2B58 A;  4QVT A;  5A27 A;  4KVO E;  4L8A A;  2PVV A;  1YW6 A;  3ZJ0 A;  3TE4 A;  3V45 A;  2ZEG A;  5JQ4 A;  2PJ5 A;  3IU2 A;  3E0K A;  4UBR A;  3PB7 X;  4JLY A;  1Y7R A;  4M3S A;  4FD4 A;  3QB8 A;  4F9U A;  4HKF A;  4CYP A;  4P6Y A;  4MHZ A;  2QEC A;  3FX6 A;  3KHZ A;  2L8R A;  3GIU A;  1NSL A;  3PB6 X;  3PB8 X;  2FG1 A;  4NGP A;  5A28 A;  5HXD A;  2VEZ A;  3R9E A;  3GQE A;  3DR6 A;  5CB3 A;  4MCQ A;  4B11 A;  4R3L A;  1Q7L A;  1B6B A;  1TXR A;  3D2M A;  2A4N A;  3VH9 A;  2OZH A;  4JYW A;  3TC8 A;  2DX6 A;  3IID A;  3BXM A;  2C1C A;  3R9G A;  3DNS A;  2CXA A;  4TWE A;  2CNT A;  2IQ6 A;  3KKW A;  4PSX A;  4TU0 A;  1UWY A;  3NE8 A;  5G1Z A;  5AGE A;  4IK2 A;  2ZW4 A;  4A94 A;  4M6G A;  2PJ4 A;  2GLJ A;  4B6Z A;  3IWE A;  2V8V A;  4X5K A;  1JQG A;  1XFO A;  2Q0Y A;  1L0C A;  2IMO A;  4D86 A;  1BAV A;  3PP9 A;  1Y7E A;  1Q2Y A;  3NH4 A;  4YWY A;  3PB4 X;  3TO9 A;  4YFJ A;  1KUV A;  1ZR3 A;  4M85 A;  3TO6 A;  2ZOF A;  4HNY B;  2JBK A;  5C88 A;  1Z8T A;  5HVH A;  1YSJ A;  2JDC A;  2PDO A;  2YND A;  4XPD C;  4DUK A;  2VRI A;  2REE A;  4KOR A;  5HH1 A;  4QUS A;  3IWG A;  4KOS A;  3RYO A;  2X47 A;  4CGM A;  5FSX A;  3A9L A;  5J1Q A;  3KAS A;  5HVG A;  1YX0 A;  3R1K A;  1X12 A;  5IX3 A;  4MBU A;  1P0H A;  4UEE A;  5AG5 A;  4AB7 A;  1PUA A;  1JWQ A;  4IUS A;  3EKE A;  1Q2D A;  4BD9 A;  3SHP A;  5FSY A;  2ABZ A;  1M4I A;  2ZED A;  1LAN A;  4G1P A;  4K3N A;  2PIY A;  2O53 A;  1VIX A; 
#chains in the Genus database with same CATH homology
 3BI1 A;  2WZN A;  3K9T A;  3JZT A;  3PEI A;  1ZLH A;  1HJZ A;  2ANP A;  4PXD A;  4PXC A;  4W9Y A;  1IY7 A;  8CPA A;  3EWP A;  4P44 A;  5JGF A;  1TKH A;  2NSM A;  4K0C A;  4MHN A;  2JEW A;  4MCR A;  5LYL A;  3FMC A;  3H8G A;  5CMS A;  2POK A;  1LAM A;  1EE3 P;  4GVV A;  5LYI A;  4P4F A;  1PYT B;  2C6C A;  3FED A;  3VAR A;  3DLJ A;  5I4M A;  2PJ9 A;  3D67 A;  2GLF A;  4MHY A;  4JVV A;  2ZEM A;  4ZI6 A;  2ZEE A;  4P4B A;  2PJ6 A;  7CPA A;  2Q43 A;  2QVP A;  2JBJ A;  3D7F A;  4DYO A;  2PJ1 A;  4UIB A;  1Z8L A;  3D7D A;  5JM6 A;  2HC9 A;  5HOL A;  2C6P A;  4CPA A;  2AFO A;  1TXZ A;  2AFS A;  2G9D A;  1XJO A;  3D4U A;  3PBB A;  2F7V A;  2AFZ A;  3SJE A;  3SJF A;  4JZ0 A;  4MHP A;  2HB6 A;  1ZLI A;  1DTD A;  4UEF A;  4P45 A;  1YW4 A;  1SPV A;  3Q6Z A;  1CX8 A;  2OR4 A;  5LYF A;  3WT4 A;  4J5Q A;  3B2Y A;  3K2K A;  3HLP A;  3KQX A;  2CIJ A;  2PJA A;  3ISX A;  4NGS A;  4NJR A;  1HDQ A;  5CPA A;  1CG2 A;  2CTC A;  3SIG A;  4UEZ A;  3HUV A;  1CBX A;  1ZR5 A;  3EW5 A;  3IC1 A;  2AFW A;  4NGT A;  1Z5R A;  1BPN A;  2QYV A;  4FWU A;  1ELL P;  5AIL A;  3IEH A;  3SI0 A;  2F8H A;  2PJ8 A;  3KZW A;  3JRU A;  3LMS A;  3GUX A;  4DJL A;  3KI9 A;  2PJ7 A;  3D7H A;  3KHX A;  4X3R A;  1FNO A;  1QQ9 A;  1BPM A;  2BFQ A;  3T8W A;  2OOT A;  1LOK A;  2PE3 A;  1KWM A;  3RBU A;  1HEE A;  1ARM A;  3VFQ A;  1YME A;  4NGQ A;  3EJF A;  1AMP A;  3D66 A;  4KSI A;  1Y0Y A;  4MRI A;  2IJZ A;  2PJB A;  4ZY2 A;  4NGM A;  4P4E A;  4X8I A;  4A38 A;  4NGR A;  3B7I A;  3I1U A;  4PXB A;  3PB9 X;  5D29 A;  1XMB A;  3PFO A;  4NFR A;  2XEF A;  3B3T A;  3MN8 A;  4R6T A;  3ETI A;  1YD9 A;  3S9L A;  4MCS A;  1Z2L A;  2EWB A;  4TNU A;  3KR5 A;  2AFM A;  3KR4 A;  3H8E A;  2WYR A;  4OC2 A;  4OC1 A;  4ZX8 A;  3KL9 A;  2Q51 A;  4FUU A;  4J4Z A;  3SJX A;  4A39 A;  4MMO A;  5JH9 A;  1R43 A;  1ZG7 A;  2V8G A;  3CPX A;  2O4H A;  3SI2 A;  2ZOG A;  5DUS A;  3GPO A;  5FSU A;  1XRY A;  1CP7 A;  1PCA A;  2CF4 A;  3CPA A;  4YU9 A;  2V77 A;  3FJU A;  2Q4Z A;  4KYB A;  1ZG8 A;  3TX8 A;  4UML A;  3BHX A;  3IO1 A;  4OC3 A;  4WJB A;  2DEA A;  2FVG A;  5F09 A;  3NFZ A;  4MXU A;  4ZYQ A;  3GB0 A;  5CBM A;  2V8D A;  2PCU A;  3QNV A;  2PJ0 A;  1M4L A;  3B3W A;  2XD7 A;  2PJC A;  2EK9 A;  3IFE A;  1VGY A;  5LYD A;  1RTQ A;  4ONW A;  3MRU A;  3FF3 A;  4UF4 A;  4LQG A;  4X2T A;  2BOA A;  1IGB A;  1TF8 A;  3GLJ A;  1HDU A;  5FSV A;  2PRQ A;  5ELY A;  3B3V A;  2PVW A;  3CDX A;  4PXE A;  4OC5 A;  4NJQ A;  3IWW A;  3IIF A;  3KGQ A;  5D8N A;  2AFX A;  1FT7 A;  4ZY0 A;  1AYE A;  2ZEN A;  2J9A A;  4ZY1 A;  3V2B A;  1GYT A;  2NYQ A;  4OKO A;  2BO9 A;  2C6G A;  1ELM P;  2EEE A;  3VAT A;  2XEG A;  4JGK A;  3B3C A;  4A37 A;  4ETJ A;  4OC0 A;  3V7Z A;  1QMU A;  4OC4 A;  5LRG A;  2AFU A;  4AXV A;  4GM5 A;  3NA6 A;  3IJ3 A;  3V38 A;  4JCA A;  1F2O A;  4F9V A;  5K8O A;  4R8F A;  1CP6 A;  4IHM A;  3WC6 A;  4ABK A;  4PPZ A;  2FXK A;  2RFH A;  4IAV A;  5HVF A;  2CTB A;  1TY8 A;  5CB5 A;  2AFC A;  3RAM A;  1VHU A;  3EWQ A;  4GVW A;  1R3N A;  1NSA A;  4IQY A;  1TKF A;  3FEC A;  2GU2 A;  3EWO A;  1CPX A;  4ETK A;  3NH5 A;  4P4J A;  5IB9 A;  1H8L A;  1TKJ A;  4FBE A;  1ZG9 A;  2XEI A;  1OBR A;  4O23 A;  4WWV A;  3FEE A;  4P4D A;  4R7M A;  3D7G A;  4J5S A;  2PIZ A;  4OIW A;  5THW A;  5K8M A;  3DGV A;  4Z65 A;  2VL1 A;  1VHE A;  1CPS A;  3KQZ A;  2PJ2 A;  5K8P A;  1XBU A;  1NJR A;  3D68 A;  3S9M A;  3SIH A;  3SJG A;  2PJ3 A;  1Y0R A;  5HIH A;  2RB7 A;  3B3S A;  4ABL A;  4P4I A;  4OID A;  3SIJ A;  4OME A;  1VHO A;  2BFR A;  4UIA A;  5LRJ A;  6CPA A;  3WC5 A;  1LFW A;  3EWR A;  3RZA A;  3S9N A;  1TF9 A;  3ISZ A;  2ACF A;  2LGR A;  4RUH A;  2GRE A;  3EJG A;  3IIB A;  1F57 A;  2I3C A;  1LAP A;  3GPG A;  3GPQ A;  2ZEF A;  3PRT A;  1BLL E;  4EFD A;  2BCO A;  4OP4 A;  4NGN A;  4ZX9 A;  2ZEO A;  4P10 A;  5E3B A;  3CT9 A;  4F8Z A;  4EWT A;  2XEJ A;  2ZEL A;  4MCP A;  3LWU A;  3L2N A;  3WAB A;  1ARL A;  3PFE A;  5LRK A;  2EK8 A;  3B35 A;  3Q71 A;  4PQA A;  4JLL A;  2V8H A;  2QJ8 A;  3FVL A;  3WC7 A;  1YLO A;  4FAI A;  1LCP A;  4ESS A;  3PBE A;  4R76 A;  2ZEP A;  1F2P A;  4Q7A A;  2ZEH A;  5FSZ A;  5DS0 A;  3BI0 A;  5K8N A;  4H2K A;  2FAV A;  4J5R A;  4EME A;  3FH4 A;  4GUA A;  3GQO A;  3N5F A;  3SI1 A;  3NH8 A;  1DE4 C;  3H8F A;  3SII A;  2PVV A;  1YW6 A;  3V45 A;  2ZEG A;  2PJ5 A;  3PB7 X;  4F9U A;  4P6Y A;  4MHZ A;  3KHZ A;  3FX6 A;  2L8R A;  5HXD A;  3PB6 X;  3PB8 X;  2FG1 A;  4NGP A;  3GQE A;  5CB3 A;  4MCQ A;  1Q7L A;  1TXR A;  3VH9 A;  4JYW A;  3TC8 A;  2DX6 A;  3IID A;  3BXM A;  2C1C A;  4TWE A;  2IQ6 A;  4TU0 A;  1UWY A;  4IK2 A;  4A94 A;  2PJ4 A;  2GLJ A;  4B6Z A;  2V8V A;  1JQG A;  1XFO A;  2IMO A;  4D86 A;  1BAV A;  1Y7E A;  3NH4 A;  4YWY A;  3PB4 X;  1ZR3 A;  2ZOF A;  2JBK A;  5HVH A;  1YSJ A;  4DUK A;  2VRI A;  5J1Q A;  2X47 A;  5FSX A;  3KAS A;  5HVG A;  4UEE A;  3EKE A;  4BD9 A;  5FSY A;  2ABZ A;  2ZED A;  1LAN A;  4G1P A;  4K3N A;  2PIY A;  2O53 A;  1VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...