4X2TA

X-ray crystal structure of the orally available aminopeptidase inhibitor, tosedostat, bound to the m17 leucyl aminopeptidase from p. falciparum
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
519
structure length
516
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
publication title X-ray crystal structures of an orally available aminopeptidase inhibitor, Tosedostat, bound to anti-malarial drug targets PfA-M1 and PfA-M17.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
total genus 171
structure length 516
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4x2tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x2tA02
1UWYA 3GLJA 3SIJA 4MXUA 4NGSA 3H8FA 1HEEA 4X8IA 3D7DA 5CB3A 4P4BA 5LYLA 2VRIA 4FUUA 2V8GA 3PFOA 4ONWA 3BI1A 4KSIA 1YW6A 2FG1A 3IFEA 4PPZA 5E3BA 2EK8A 3RBUA 3VARA 4A37A 4MCPA 4TNUA 3GQOA 4IK2A 1CX8A 1ELMP 2RFHA 3EW5A 4F9VA 4OP4A 5LRJA 1ZLHA 4NJQA 4OIWA 2ZOGA 1VIXA 4ZX9A 3V45A 4OC4A 2EEEA 2PJ8A 5LRGA 2WZNA 8CPAA 2ZEDA 4ZY1A 3SIHA 5IB9A 3BXMA 3HLPA 4GM5A 2JBKA 2ZEOA 2PJ2A 4JVVA 5CB5A 4DYOA 2AFXA 3DGVA 1FT7A 2ZEEA 2C6PA 4JYWA 3PB7X 3WABA 2QJ8A 4IQYA 3WC7A 4H2KA 2F7VA 4UEFA 3CPXA 2Q4ZA 3B3TA 4P6YA 1ARLA 1LAPA 3D68A 1XRYA 3SI0A 3SJFA 1YLOA 3IIBA 3KGQA 4OC3A 5F09A 2C1CA 1ZG8A 2XEIA 2AFCA 3D7HA 4X3RA 1RTQA 1IY7A 3B3WA 3PB4X 5J1QA 4JCAA 3PRTA 3KZWA 2QVPA 5FSXA 3LWUA 5JM6A 4ZY0A 3BHXA 1BLLE 3KR5A 3JZTA 2OOTA 4G1PA 4UIAA 2AFOA 4MCRA 1GYTA 2BFQA 4P10A 1Z2LA 4AXVA 4PXEA 6CPAA 1Z8LA 3KASA 1PYTB 4YU9A 3PFEA 5ELYA 2V8DA 2DX6A 2PCUA 4A38A 2O53A 1XMBA 3KHZA 3KQZA 1ZG7A 3D7GA 4JZ0A 1Q7LA 3L2NA 3H8EA 1BPMA 2BOAA 4WJBA 4MCQA 2EWBA 4D86A 4MHZA 1TKHA 1ZR3A 3NH8A 1VHUA 2VL1A 4FAIA 4GUAA 1CPSA 5K8MA 1OBRA 4O23A 4J5RA 4DJLA 4OKOA 5JGFA 3NH5A 3V38A 5I4MA 4NGNA 4UMLA 2IMOA 3FX6A 2L8RA 1ZLIA 3K9TA 4ETKA 2V8HA 5JH9A 4BD9A 4EWTA 4CPAA 3GPQA 2CTCA 2PJ5A 2XEJA 1CG2A 4ZY2A 3WC6A 1BAVA 1CP7A 2GREA 3KHXA 2G9DA 4OC1A 4ZX8A 5CBMA 2HC9A 4K0CA 1VGYA 1R43A 4P4FA 4MMOA 1AYEA 4UEZA 3EWPA 4MCSA 5LYDA 3FF3A 4GVWA 1EE3P 2ANPA 3EJFA 2AFWA 4KYBA 1CBXA 3FH4A 5K8OA 2PVWA 2PJ0A 3IWWA 3N5FA 4J5SA 3PBEA 4ABLA 4P4IA 3Q6ZA 4UIBA 3JRUA 4A39A 2ZEGA 4ESSA 1LOKA 3D66A 5AILA 4DUKA 1ARMA 2NSMA 1HJZA 2HB6A 3D4UA 1M4LA 3S9NA 2O4HA 4RUHA 4MHYA 2PJAA 4Z65A 2PJCA 1F57A 1QQ9A 2PVVA 3NA6A 4NJRA 2CF4A 4UF4A 3B2YA 2WYRA 4IHMA 3D67A 5HVGA 3T8WA 4GVVA 3SJEA 2BCOA 3SJXA 2BO9A 4FWUA 2FXKA 2NYQA 1Y0RA 3V7ZA 4ZI6A 2ZEMA 3PB9X 2CTBA 4OIDA 4P45A 3D7FA 2Q51A 1HDQA 1H8LA 3EWQA 2JBJA 1LANA 1ELLP 3PB6X 4MRIA 3FEDA 1PCAA 2XD7A 3KL9A 1CP6A 1YW4A 2PJ9A 3FECA 3VATA 2CIJA 2PIZA 2PJ7A 4A94A 3WT4A 3Q71A 2PJ1A 3PBBA 3WC5A 2I3CA 2F8HA 1DTDA 3RZAA 4ZYQA 3PB8X 3BI0A 3IO1A 2FAVA 2IQ6A 2BFRA 1JQGA 5D29A 3S9LA 1VHEA 4J5QA 3FMCA 5HVHA 3V2BA 1ZG9A 3CT9A 3EWRA 2ZEFA 4OC0A 2FVGA 2ZELA 2LGRA 4JGKA 5CPAA 1YMEA 4LQGA 3SIGA 1LCPA 4PXCA 4B6ZA 3VH9A 2OR4A 2GLFA 5HXDA 3GPGA 5FSZA 4R8FA 5LRKA 5HOLA 4MHNA 3IEHA 2QYVA 2XEFA 1TF9A 5LYFA 2XEGA 1ZR5A 4NGMA 5LYIA 2ACFA 1TXZA 2PJBA 4TU0A 3B3VA 4PXDA 2IJZA 2C6GA 2ABZA 4NFRA 1Y0YA 1R3NA 1NJRA 1HDUA 4W9YA 3EKEA 2GLJA 4NGTA 5K8PA 5CMSA 3EJGA 3GQEA 3S9MA 5FSYA 2PIYA 3IC1A 4WWVA 1TKFA 4MHPA 2J9AA 3NH4A 3KR4A 2POKA 3B3SA 3K2KA 4JLLA 1F2PA 1TXRA 1LAMA 3B3CA 3KQXA 5DUSA 1XJOA 3B35A 2PJ4A 3CPAA 7CPAA 3DLJA 4OC2A 1CPXA 1IGBA 5HVFA 2DEAA 4EMEA 3PEIA 4X2TA 1YSJA 1VHOA 5FSUA 3MRUA 4K3NA 4Q7AA 1F2OA 2EK9A 2RB7A 2AFZA 1TF8A 5FSVA 3NFZA 1BPNA 4P4JA 3EWOA 1LFWA 3GPOA 4P44A 1QMUA 1AMPA 3ISZA 1NSAA 1TKJA 4PQAA 1SPVA 3GUXA 3QNVA 2PRQA 2GU2A 2V8VA 4F8ZA 2Q43A 1XBUA 4FBEA 4OC5A 4UEEA 2AFUA 1FNOA 4P4EA 2PE3A 3ETIA 3IIDA 3KI9A 2ZEHA 3RAMA 4R76A 3LMSA 5K8NA 4NGRA 1DE4C 3ISXA 4TWEA 4J4ZA 2AFMA 3SI1A 3VFQA 3SIIA 4ABKA 3GB0A 4F9UA 3H8GA 3I1UA 2AFSA 3CDXA 3IJ3A 4P4DA 5DS0A 3HUVA 3FEEA 4NGQA 3SI2A 4OMEA 3FJUA 4EFDA 2X47A 5THWA 3SJGA 1TY8A 1XFOA 2V77A 3MN8A 1YD9A 2PJ3A 1Z5RA 2ZOFA 4IAVA 1KWMA 4PXBA 4ETJA 5HIHA 3FVLA 4R7MA 2C6CA 3IIFA 1Y7EA 2ZENA 4NGPA 2ZEPA 4YWYA 3TC8A 3TX8A 3B7IA 2JEWA 4R6TA 2PJ6A 5D8NA
chains in the Genus database with same CATH superfamily
1UWYA 3GLJA 3SIJA 2ARHA 4MXUA 3F5BA 4KORA 3R9GA 2Z3KA 4NGSA 3H8FA 1HEEA 4X8IA 3D7DA 2PR8A 5CB3A 1M44A 4P4BA 2GFQA 2VRIA 4FUUA 3GY9A 1YVKA 4MFZA 2V8GA 5I0CA 3PFOA 1XF8A 2DPTA 4ONWA 3BI1A 2P6FA 4KSIA 1YW6A 2FG1A 3IFEA 4JWPA 4PPZA 2HQYA 5E3BA 2EK8A 3RBUA 2Z3LA 3VARA 3CXSA 4C68A 4MY3A 3RYOA 2PQ8A 2D4OA 4A37A 4C2YA 4MCPA 4TNUA 3GQOA 2PRBA 3TO7A 4IK2A 4DNCA 5J8FA 2W2GA 1CX8A 4CGMA 4A95A 1ELMP 3OWCA 4PK2A 5IX3A 4ZGYB 2RFHA 3EW5A 2YNEA 4YGOA 4F9VA 4OP4A 5LRJA 1ZLHA 3R9FA 4NJQA 3TE4A 5F46A 1M1DA 2F5IA 2PDOA 4OIWA 2ZOGA 1KUVA 4MI4A 1VIXA 3IWGA 4QVTA 5LYLA 2JZEA 4ZX9A 3V45A 4OC4A 2EEEA 2PJ8A 4KSAA 5LRGA 1S7NA 2WZNA 8CPAA 2ZEDA 3LODA 2Z10A 4ZY1A 3VWDA 3BJ7A 3S6GA 3SIHA 4EVYA 5IB9A 3BXMA 3HLPA 4GM5A 3SXOA 2JBKA 2ZEOA 2PJ2A 1X10A 4JVVA 2R8VA 5CB5A 4DYOA 2AFXA 1P4NA 3SHPA 5KTAA 3DGVA 1FT7A 2ZEEA 2C6PA 4JYWA 3PB7X 3W91A 3WABA 2QJ8A 4IQYA 3WC7A 1Z8WA 4H2KA 2F7VA 3DNSA 2DXQA 4UEFA 4C2XA 2Z3PA 3CPXA 4AG9A 2Q4ZA 3B3TA 4P6YA 1ARLA 4AB7A 1LAPA 3R96A 3D68A 1XRYA 3SI0A 4KSFA 3SJFA 1YLOA 3R9EA 3IIBA 5IB0A 1IOIA 3IGRA 2WPWA 3KGQA 4IUSA 5C88A 4OC3A 4KOUA 5F09A 2C1CA 1ZG8A 2XEIA 2ATRA 1I21A 2PSWA 1IYKA 2P0WA 2AFCA 2VBQA 3TCVA 3D7HA 4M3SA 4QUSA 4X3RA 1NE9A 4XPDB 3FNCA 1RTQA 4MFLA 1IY7A 3B3WA 3PB4X 2Z0ZA 1ON0A 1P0HA 4WJBA 5J1QA 4JCAA 3SXNA 1YGHA 3PRTA 3KZWA 2QVPA 5FSXA 3LWUA 5JM6A 3FBUA 4JLYA 3EC4A 5HH1A 4ZY0A 1Q2DA 1BLLE 3KR5A 3JZTA 2D4PA 3BHXA 2OOTA 4KS9A 4G1PA 4Q36A 4UIAA 2R7HA 2JZFA 2AFOA 3RO0A 3GKRA 2EUIA 4RS2A 3S6KA 4MCRA 2Q04A 4NXYA 4RN7A 1GYTA 4CYNA 2BFQA 3NE8A 4P10A 1Z2LA 5FVJA 4PXEA 4AXVA 1Z8LA 3KASA 4HNXB 4B5PA 6CPAA 1YK3A 3W6XA 2Q7BA 1PYTB 2QIRA 4UA3A 4YU9A 4FD5A 1YLEA 4E8OA 1VHSA 3PFEA 2V8DA 2KCWA 4HKFA 5ELYA 5IV0A 2DX6A 2H5MA 2PCUA 4A38A 2O53A 1QSNA 1YQEA 5EMIA 2PR1A 2Z3OA 1XMBA 5J8CA 3CXPA 3KHZA 3KQZA 2ZXVA 3VWEA 1BO4A 1ZG7A 3D7GA 1Q7LA 3L2NA 3H8EA 1BPMA 2BOAA 4JZ0A 4MCQA 4R9MA 2EWBA 4D86A 4UCMA 3F8KA 4MHZA 1TKHA 2OB0A 1ZR3A 4GXHA 3NH8A 3V8IA 4MBUA 3TO9A 1VHUA 2AJ6A 2VL1A 3TO6A 4FAIA 2EVNA 2K5TA 4GUAA 1CPSA 1QSTA 3IU1A 4CRYB 2R1IA 5K8MA 2RC4A 3F0AA 1OBRA 4O23A 5KTDA 2OZUA 4J5RA 4UBRA 4DJLA 4OKOA 5JGFA 2JEVA 3NH5A 3PZJA 3V38A 4CGNA 5EBVA 5I4MA 4NGNA 1Y9WA 3ZZIA 4UMLA 2I00A 2IMOA 3FX6A 2L8RA 1YR0A 1ZLIA 4FD6A 3K9TA 3TT2A 4ETKA 2V8HA 3TTHA 4Y49B 5JH9A 4Q38A 3R95A 2GE3A 2OZHA 4PSWA 4BD9A 4QC6A 1U6MA 3BJ8A 4CS0B 4EWTA 4CPAA 3GPQA 2CTCA 4H89A 1QSMA 1S7FA 1CG2A 4ZY2A 2PJ5A 2WPXA 2XEJA 1BAVA 1CP7A 1IB1E 3WC6A 4UWIA 2GREA 4MJ8A 3KHXA 2G9DA 4OC1A 4B5PB 1CJWA 3PP9A 4HNWB 1Z8XA 1N71A 3LACA 2BUEA 4ZX8A 1RO5A 5CBMA 2HC9A 4K0CA 1VGYA 1R43A 2OH1A 4PK3A 4MMOA 1AYEA 4P4FA 4UEZA 3JTKA 3EWPA 1YX0A 4MCSA 4AG7A 4B12A 4FD4A 5LYDA 4E2AA 2JLMA 3FF3A 4GVWA 4B11A 1EE3P 4CAVA 1I1DA 2ANPA 3EJFA 2AFWA 4KYBA 4M6IA 1CBXA 5HMNA 3FH4A 2RNKA 3CZXA 5K8OA 2PVWA 2PJ0A 3ZJ0A 2Q44A 3IWWA 4B10A 5KTCA 3N5FA 4J5SA 3IWEA 1AUGA 3D2MA 2O28A 2GANA 3PBEA 4ABLA 4P4IA 5GCNA 5DWNA 3Q6ZA 4UIBA 4II9A 3JRUA 4A39A 2ZEGA 4ESSA 2YGWA 3P2FA 4NSQA 1QSRA 4CYOA 1LOKA 4MY0A 3S6FA 2EBJA 3T90A 3D66A 2CXAA 3PGPA 4ONUA 5AILA 4NF1A 4DUKA 1WK4A 2FIWA 3EY5A 1ARMA 5F47A 3WR7A 2NSMA 1HJZA 2HB6A 3D4UA 1M4LA 5H86A 1KZFA 2JDDA 3S9NA 2O4HA 4RUHA 1B6BA 4MHYA 3MGDA 1VKCA 2PJAA 4ORFA 4CGLA 4Z65A 2PJCA 2B4BA 2REFA 2FL4A 1F57A 1QQ9A 2FE7A 2PVVA 3NA6A 1IU8A 4LUAA 4NJRA 3B8GA 4AVAA 4XPDC 2CF4A 4UF4A 4C2ZA 2R98A 3B2YA 2WYRA 1XE4A 4IHMA 4KZTA 3D67A 4F0XA 5EC4A 3EO4A 5HVGA 3TFYA 4XPLA 2VEZA 1Y7RA 3T8WA 2ZW7A 4UFVA 5A28A 4GVVA 1XEBA 3SJEA 4AVBA 2BCOA 3SJXA 2BO9A 1Y9KA 4FWUA 2FXKA 2NYQA 1YVOA 1Y0RA 3V7ZA 3K9UA 4ZI6A 2ZEMA 4UFXA 4KVME 1V0CA 3PB9X 2CTBA 2YNCA 4MHDA 4OIDA 4P45A 2WUUA 2CY2A 3D7FA 5CNPA 2Q51A 4A2ZA 1HDQA 1H8LA 3LD2A 4CYQA 3EWQA 2VZZA 4KOYA 5H84A 2JBJA 3W6SA 1Z4EA 1LANA 1ELLP 3PB6X 4MRIA 3FEDA 1PCAA 2XD7A 2Q4VA 3KL9A 4PV6A 3T9YA 1CP6A 1L0CA 1YW4A 2PJ9A 2Q4YA 3FECA 3VATA 2CIJA 2PIZA 2PJ7A 4L8AA 1RXTA 4ZBGA 4H6ZA 4KVOE 4A94A 3WT4A 5C82A 3Q71A 1TIQA 2PJ1A 4KVXA 3PBBA 4RI1A 4R3KA 4IF5A 3WC5A 3D8PA 2I3CA 2F8HA 1DTDA 3RZAA 4ZYQA 3PB8X 3TOBA 3BI0A 5AG5A 1NSLA 4BINA 1IOFA 3E0KA 3H5ZA 2FAVA 3IO1A 3JVNA 2IQ6A 2BFRA 1JQGA 3H4QA 5D29A 3RNZA 5F48A 3S9LA 1VHEA 4J5QA 2J8RA 3FMCA 3NE7A 3I3GA 5AG7A 5HVHA 3V2BA 2B5GA 1ZG9A 3CT9A 3EWRA 2ZEFA 4MFKA 2FIAA 2QMLA 4OC0A 2FVGA 2ZELA 2LGRA 4JGKA 1ZO0A 2ZW6A 3I9SA 5CPAA 4A30A 2NMTA 1YMEA 4LQGA 2YNCC 1MK4A 3SIGA 4XPKA 4Y49C 2BEIA 4YRHA 2KQVA 1LCPA 1S7KA 4PXCA 4B6ZA 4KUAA 3VH9A 2OR4A 2GLFA 2J8NA 5HXDA 4M6GA 1PUAA 3GPGA 5FSZA 4QB9A 2G3AA 3FYNA 1KUXA 4PSXA 4R8FA 2Q0YA 3DR6A 1X12A 5LRKA 1S60A 5HOLA 4MHNA 3P2HA 1A2ZA 2FCKA 1MJBA 3IEHA 2QYVA 2XEFA 4CAFA 1J4JA 2EO8A 1TF9A 1GHEA 3D3SA 5LYFA 4OADA 1BOBA 1IICA 2B4DA 2XEGA 2IL4A 1IYLA 4KOSA 2DPSA 5DWMA 1ZR5A 1CM0A 4NGMA 2Q7SA 5LYIA 4C7HA 2QECA 1PU9A 2ACFA 2BL1A 1TXZA 2Y0MA 3DDDA 2P6GA 2ZPAA 4J3GA 4K30A 3R1KA 2PJBA 4TU0A 5AG4A 2AE6A 3B3VA 4PXDA 5A27A 1Q2CA 2P6EA 2IJZA 2C6GA 4CRZB 2ABZA 1WWZA 2ODFA 3DSBA 1Y0YA 3QAHA 4NFRA 1R3NA 4CAXA 1NJRA 1HDUA 2CNMA 2FS5A 3A9LA 4W9YA 4CAEA 3EKEA 2GLJA 4NGTA 5K8PA 4B14A 5CMSA 3FIXA 3EJGA 3GQEA 5E96A 5G20A 2B5GB 3S9MA 5FSYA 2BSWA 2PIYA 3IC1A 4WWVA 1TKFA 4MHPA 2OZGA 2REEA 2J9AA 1XMTA 5JQ4A 3NH4A 3KR4A 2POKA 3B3SA 2JZDA 1YREA 2C27A 2CNSA 3K2KA 2VZYA 4JLLA 4U5YA 1F2PA 1TXRA 1LAMA 3BLNA 3B3CA 2B3UA 4LX9A 3KQXA 5DUSA 1XJOA 1MJAA 3B35A 2PJ4A 5AGEA 3CPAA 4BBHA 4BMHA 2J8MA 3DLJA 2HUZA 3FB3A 7CPAA 4MFJA 4OC2A 4KLWA 1CPXA 1IGBA 5HVFA 4UWJA 1JWQA 2PC1A 5G22A 4H6UA 2DEAA 4EMEA 1B87A 3PEIA 4X2TA 1YSJA 2VXKA 1VHOA 4XNHC 4UFWA 5FSUA 2FSRA 3MRUA 4K3NA 4JJXA 4M6HA 4Q7AA 4U9YA 1F2OA 1LRZA 2EK9A 2RB7A 2AFZA 5F49A 1TF8A 2B4DB 5FSVA 4JXRA 1UFHA 3NFZA 4GS4A 1BPNA 2FXFA 4JXQA 4XNHB 4P4JA 3KKWA 3EWOA 4A31A 1NMTA 5BWAB 1LFWA 2GIVA 4B13A 3GPOA 4P44A 1QMUA 1AMPA 3ISZA 1NSAA 1TKJA 4PQAA 1SPVA 3GUXA 3QNVA 2PRQA 2GU2A 2HV2A 3GYAA 2ZW4A 2V8VA 4KOXA 4AVCA 4HPSA 5G21A 3UY5A 4F8ZA 2Q43A 3FRMA 1XBUA 3D2PA 4OC5A 4UEEA 2I79A 3S6HA 4FBEA 4KUBA 2AFUA 1FNOA 1M4GA 4P4EA 2PE3A 4E0AA 1K4JA 1S7LA 2WCTA 3ETIA 3IIDA 3KI9A 4A32A 2ZEHA 1FY7A 4M85A 4MFPA 3RAMA 4R76A 3LMSA 5K8NA 4NGRA 3QAYA 1DE4C 3EXNA 3ISXA 4TWEA 3CXQA 3C26A 4UCNA 2CNTA 3G3SA 2Z3NA 4KOWA 4J4ZA 2AFMA 2VQYA 3SI1A 1I12A 2FT0A 3VFQA 2YNDA 4I49A 2Z3MA 3SIIA 1Q2YA 1S5KA 4X5KA 1XOVA 3FXTA 4CGPA 2DF5A 4ABKA 2B3VA 1Z8TA 4HNYB 3GB0A 4F9UA 1S3ZA 3G8WA 4A33A 4UCPA 1M4IA 2ZW5A 3H8GA 1IIDA 3I1UA 4LQ6A 2JDCA 2AFSA 3DR8A 3CDXA 2WSAA 3IJ3A 1Z9UA 4KLVA 4P4DA 1MJ9A 5DS0A 1OZPA 4L89A 4F0YA 3HUVA 2A4NA 3FEEA 4NGQA 4KOTA 3SI2A 4R87A 5AG6A 4B5OA 4OMEA 2X7BA 5ISVA 3FJUA 4OLLA 4FD7A 4EFDA 4OAEA 2X47A 2Z11A 5THWA 3IU2A 3SJGA 1TY8A 1SQHA 1QSOA 1XFOA 4JD6A 2V77A 3MN8A 4YFJA 1YD9A 2PJ3A 1Z5RA 4QBJA 4U9ZA 2ZOFA 4CYPA 4IAVA 4NEXA 5JPHA 1KWMA 4PXBA 2VI7A 4NCZA 4ETJA 3EFAA 5HIHA 4R3LA 1Z4RA 3JUWA 3FVLA 1XIXA 4R7MA 3QB8A 2C6CA 3IIFA 1Y7EA 2B58A 2G0BA 2ZENA 4NGPA 4C7IA 2ZEPA 4YWYA 3TC8A 3TX8A 1M4DA 3B7IA 4R57A 2OU2A 2G3TA 1KUYA 1R57A 4KOVA 5G1ZA 2JEWA 4F6AA 3N7ZA 4R6TA 4CGOA 3GIUA 2PJ6A 5D8NA 4MFQA 4CAWA 3TOAA
chains in the Genus database with same CATH topology
1UWYA 3GLJA 3SIJA 4MXUA 4NGSA 3H8FA 1HEEA 4X8IA 3D7DA 5CB3A 4P4BA 5LYLA 2VRIA 4FUUA 2V8GA 3PFOA 4ONWA 3BI1A 4KSIA 1YW6A 2FG1A 3IFEA 4PPZA 5E3BA 2EK8A 3RBUA 3VARA 4A37A 4MCPA 4TNUA 3GQOA 4IK2A 1CX8A 1ELMP 2RFHA 3EW5A 4F9VA 4OP4A 5LRJA 1ZLHA 4NJQA 4OIWA 2ZOGA 1VIXA 4ZX9A 3V45A 4OC4A 2EEEA 2PJ8A 5LRGA 2WZNA 8CPAA 2ZEDA 4ZY1A 3SIHA 5IB9A 3BXMA 3HLPA 4GM5A 2JBKA 2ZEOA 2PJ2A 4JVVA 5CB5A 4DYOA 2AFXA 3DGVA 1FT7A 2ZEEA 2C6PA 4JYWA 3PB7X 3WABA 2QJ8A 4IQYA 3WC7A 4H2KA 2F7VA 4UEFA 3CPXA 2Q4ZA 3B3TA 4P6YA 1ARLA 1LAPA 3D68A 1XRYA 3SI0A 3SJFA 1YLOA 3IIBA 3KGQA 4OC3A 5F09A 2C1CA 1ZG8A 2XEIA 2AFCA 3D7HA 4X3RA 1RTQA 1IY7A 3B3WA 3PB4X 5J1QA 4JCAA 3PRTA 3KZWA 2QVPA 5FSXA 3LWUA 5JM6A 4ZY0A 3BHXA 1BLLE 3KR5A 3JZTA 2OOTA 4G1PA 4UIAA 2AFOA 4MCRA 1GYTA 2BFQA 4P10A 1Z2LA 4AXVA 4PXEA 6CPAA 1Z8LA 3KASA 1PYTB 4YU9A 3PFEA 5ELYA 2V8DA 2DX6A 2PCUA 4A38A 2O53A 1XMBA 3KHZA 3KQZA 1ZG7A 3D7GA 4JZ0A 1Q7LA 3L2NA 3H8EA 1BPMA 2BOAA 4WJBA 4MCQA 2EWBA 4D86A 4MHZA 1TKHA 1ZR3A 3NH8A 1VHUA 2VL1A 4FAIA 4GUAA 1CPSA 5K8MA 1OBRA 4O23A 4J5RA 4DJLA 4OKOA 5JGFA 3NH5A 3V38A 5I4MA 4NGNA 4UMLA 2IMOA 3FX6A 2L8RA 1ZLIA 3K9TA 4ETKA 2V8HA 5JH9A 4BD9A 4EWTA 4CPAA 3GPQA 2CTCA 2PJ5A 2XEJA 1CG2A 4ZY2A 3WC6A 1BAVA 1CP7A 2GREA 3KHXA 2G9DA 4OC1A 4ZX8A 5CBMA 2HC9A 4K0CA 1VGYA 1R43A 4P4FA 4MMOA 1AYEA 4UEZA 3EWPA 4MCSA 5LYDA 3FF3A 4GVWA 1EE3P 2ANPA 3EJFA 2AFWA 4KYBA 1CBXA 3FH4A 5K8OA 2PVWA 2PJ0A 3IWWA 3N5FA 4J5SA 3PBEA 4ABLA 4P4IA 3Q6ZA 4UIBA 3JRUA 4A39A 2ZEGA 4ESSA 1LOKA 3D66A 5AILA 4DUKA 1ARMA 2NSMA 1HJZA 2HB6A 3D4UA 1M4LA 3S9NA 2O4HA 4RUHA 4MHYA 2PJAA 4Z65A 2PJCA 1F57A 1QQ9A 2PVVA 3NA6A 4NJRA 2CF4A 4UF4A 3B2YA 2WYRA 4IHMA 3D67A 5HVGA 3T8WA 4GVVA 3SJEA 2BCOA 3SJXA 2BO9A 4FWUA 2FXKA 2NYQA 1Y0RA 3V7ZA 4ZI6A 2ZEMA 3PB9X 2CTBA 4OIDA 4P45A 3D7FA 2Q51A 1HDQA 1H8LA 3EWQA 2JBJA 1LANA 1ELLP 3PB6X 4MRIA 3FEDA 1PCAA 2XD7A 3KL9A 1CP6A 1YW4A 2PJ9A 3FECA 3VATA 2CIJA 2PIZA 2PJ7A 4A94A 3WT4A 3Q71A 2PJ1A 3PBBA 3WC5A 2I3CA 2F8HA 1DTDA 3RZAA 4ZYQA 3PB8X 3BI0A 3IO1A 2FAVA 2IQ6A 2BFRA 1JQGA 5D29A 3S9LA 1VHEA 4J5QA 3FMCA 5HVHA 3V2BA 1ZG9A 3CT9A 3EWRA 2ZEFA 4OC0A 2FVGA 2ZELA 2LGRA 4JGKA 5CPAA 1YMEA 4LQGA 3SIGA 1LCPA 4PXCA 4B6ZA 3VH9A 2OR4A 2GLFA 5HXDA 3GPGA 5FSZA 4R8FA 5LRKA 5HOLA 4MHNA 3IEHA 2QYVA 2XEFA 1TF9A 5LYFA 2XEGA 1ZR5A 4NGMA 5LYIA 2ACFA 1TXZA 2PJBA 4TU0A 3B3VA 4PXDA 2IJZA 2C6GA 2ABZA 4NFRA 1Y0YA 1R3NA 1NJRA 1HDUA 4W9YA 3EKEA 2GLJA 4NGTA 5K8PA 5CMSA 3EJGA 3GQEA 3S9MA 5FSYA 2PIYA 3IC1A 4WWVA 1TKFA 4MHPA 2J9AA 3NH4A 3KR4A 2POKA 3B3SA 3K2KA 4JLLA 1F2PA 1TXRA 1LAMA 3B3CA 3KQXA 5DUSA 1XJOA 3B35A 2PJ4A 3CPAA 7CPAA 3DLJA 4OC2A 1CPXA 1IGBA 5HVFA 2DEAA 4EMEA 3PEIA 4X2TA 1YSJA 1VHOA 5FSUA 3MRUA 4K3NA 4Q7AA 1F2OA 2EK9A 2RB7A 2AFZA 1TF8A 5FSVA 3NFZA 1BPNA 4P4JA 3EWOA 1LFWA 3GPOA 4P44A 1QMUA 1AMPA 3ISZA 1NSAA 1TKJA 4PQAA 1SPVA 3GUXA 3QNVA 2PRQA 2GU2A 2V8VA 4F8ZA 2Q43A 1XBUA 4FBEA 4OC5A 4UEEA 2AFUA 1FNOA 4P4EA 2PE3A 3ETIA 3IIDA 3KI9A 2ZEHA 3RAMA 4R76A 3LMSA 5K8NA 4NGRA 1DE4C 3ISXA 4TWEA 4J4ZA 2AFMA 3SI1A 3VFQA 3SIIA 4ABKA 3GB0A 4F9UA 3H8GA 3I1UA 2AFSA 3CDXA 3IJ3A 4P4DA 5DS0A 3HUVA 3FEEA 4NGQA 3SI2A 4OMEA 3FJUA 4EFDA 2X47A 5THWA 3SJGA 1TY8A 1XFOA 2V77A 3MN8A 1YD9A 2PJ3A 1Z5RA 2ZOFA 4IAVA 1KWMA 4PXBA 4ETJA 5HIHA 3FVLA 4R7MA 2C6CA 3IIFA 1Y7EA 2ZENA 4NGPA 2ZEPA 4YWYA 3TC8A 3TX8A 3B7IA 2JEWA 4R6TA 2PJ6A 5D8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWY A;  3GLJ A;  3SIJ A;  4MXU A;  4NGS A;  3H8F A;  1HEE A;  4X8I A;  3D7D A;  5CB3 A;  4P4B A;  5LYL A;  2VRI A;  4FUU A;  2V8G A;  3PFO A;  4ONW A;  3BI1 A;  4KSI A;  1YW6 A;  2FG1 A;  3IFE A;  4PPZ A;  5E3B A;  2EK8 A;  3RBU A;  3VAR A;  4A37 A;  4MCP A;  4TNU A;  3GQO A;  4IK2 A;  1CX8 A;  1ELM P;  2RFH A;  3EW5 A;  4F9V A;  4OP4 A;  5LRJ A;  1ZLH A;  4NJQ A;  4OIW A;  2ZOG A;  1VIX A;  4ZX9 A;  3V45 A;  4OC4 A;  2EEE A;  2PJ8 A;  5LRG A;  2WZN A;  8CPA A;  2ZED A;  4ZY1 A;  3SIH A;  5IB9 A;  3BXM A;  3HLP A;  4GM5 A;  2JBK A;  2ZEO A;  2PJ2 A;  4JVV A;  5CB5 A;  4DYO A;  2AFX A;  3DGV A;  1FT7 A;  2ZEE A;  2C6P A;  4JYW A;  3PB7 X;  3WAB A;  2QJ8 A;  4IQY A;  3WC7 A;  4H2K A;  2F7V A;  4UEF A;  3CPX A;  2Q4Z A;  3B3T A;  4P6Y A;  1ARL A;  1LAP A;  3D68 A;  1XRY A;  3SI0 A;  3SJF A;  1YLO A;  3IIB A;  3KGQ A;  4OC3 A;  5F09 A;  2C1C A;  1ZG8 A;  2XEI A;  2AFC A;  3D7H A;  4X3R A;  1RTQ A;  1IY7 A;  3B3W A;  3PB4 X;  5J1Q A;  4JCA A;  3PRT A;  3KZW A;  2QVP A;  5FSX A;  3LWU A;  5JM6 A;  4ZY0 A;  3BHX A;  1BLL E;  3KR5 A;  3JZT A;  2OOT A;  4G1P A;  4UIA A;  2AFO A;  4MCR A;  1GYT A;  2BFQ A;  4P10 A;  1Z2L A;  4AXV A;  4PXE A;  6CPA A;  1Z8L A;  3KAS A;  1PYT B;  4YU9 A;  3PFE A;  5ELY A;  2V8D A;  2DX6 A;  2PCU A;  4A38 A;  2O53 A;  1XMB A;  3KHZ A;  3KQZ A;  1ZG7 A;  3D7G A;  4JZ0 A;  1Q7L A;  3L2N A;  3H8E A;  1BPM A;  2BOA A;  4WJB A;  4MCQ A;  2EWB A;  4D86 A;  4MHZ A;  1TKH A;  1ZR3 A;  3NH8 A;  1VHU A;  2VL1 A;  4FAI A;  4GUA A;  1CPS A;  5K8M A;  1OBR A;  4O23 A;  4J5R A;  4DJL A;  4OKO A;  5JGF A;  3NH5 A;  3V38 A;  5I4M A;  4NGN A;  4UML A;  2IMO A;  3FX6 A;  2L8R A;  1ZLI A;  3K9T A;  4ETK A;  2V8H A;  5JH9 A;  4BD9 A;  4EWT A;  4CPA A;  3GPQ A;  2CTC A;  2PJ5 A;  2XEJ A;  1CG2 A;  4ZY2 A;  3WC6 A;  1BAV A;  1CP7 A;  2GRE A;  3KHX A;  2G9D A;  4OC1 A;  4ZX8 A;  5CBM A;  2HC9 A;  4K0C A;  1VGY A;  1R43 A;  4P4F A;  4MMO A;  1AYE A;  4UEZ A;  3EWP A;  4MCS A;  5LYD A;  3FF3 A;  4GVW A;  1EE3 P;  2ANP A;  3EJF A;  2AFW A;  4KYB A;  1CBX A;  3FH4 A;  5K8O A;  2PVW A;  2PJ0 A;  3IWW A;  3N5F A;  4J5S A;  3PBE A;  4ABL A;  4P4I A;  3Q6Z A;  4UIB A;  3JRU A;  4A39 A;  2ZEG A;  4ESS A;  1LOK A;  3D66 A;  5AIL A;  4DUK A;  1ARM A;  2NSM A;  1HJZ A;  2HB6 A;  3D4U A;  1M4L A;  3S9N A;  2O4H A;  4RUH A;  4MHY A;  2PJA A;  4Z65 A;  2PJC A;  1F57 A;  1QQ9 A;  2PVV A;  3NA6 A;  4NJR A;  2CF4 A;  4UF4 A;  3B2Y A;  2WYR A;  4IHM A;  3D67 A;  5HVG A;  3T8W A;  4GVV A;  3SJE A;  2BCO A;  3SJX A;  2BO9 A;  4FWU A;  2FXK A;  2NYQ A;  1Y0R A;  3V7Z A;  4ZI6 A;  2ZEM A;  3PB9 X;  2CTB A;  4OID A;  4P45 A;  3D7F A;  2Q51 A;  1HDQ A;  1H8L A;  3EWQ A;  2JBJ A;  1LAN A;  1ELL P;  3PB6 X;  4MRI A;  3FED A;  1PCA A;  2XD7 A;  3KL9 A;  1CP6 A;  1YW4 A;  2PJ9 A;  3FEC A;  3VAT A;  2CIJ A;  2PIZ A;  2PJ7 A;  4A94 A;  3WT4 A;  3Q71 A;  2PJ1 A;  3PBB A;  3WC5 A;  2I3C A;  2F8H A;  1DTD A;  3RZA A;  4ZYQ A;  3PB8 X;  3BI0 A;  3IO1 A;  2FAV A;  2IQ6 A;  2BFR A;  1JQG A;  5D29 A;  3S9L A;  1VHE A;  4J5Q A;  3FMC A;  5HVH A;  3V2B A;  1ZG9 A;  3CT9 A;  3EWR A;  2ZEF A;  4OC0 A;  2FVG A;  2ZEL A;  2LGR A;  4JGK A;  5CPA A;  1YME A;  4LQG A;  3SIG A;  1LCP A;  4PXC A;  4B6Z A;  3VH9 A;  2OR4 A;  2GLF A;  5HXD A;  3GPG A;  5FSZ A;  4R8F A;  5LRK A;  5HOL A;  4MHN A;  3IEH A;  2QYV A;  2XEF A;  1TF9 A;  5LYF A;  2XEG A;  1ZR5 A;  4NGM A;  5LYI A;  2ACF A;  1TXZ A;  2PJB A;  4TU0 A;  3B3V A;  4PXD A;  2IJZ A;  2C6G A;  2ABZ A;  4NFR A;  1Y0Y A;  1R3N A;  1NJR A;  1HDU A;  4W9Y A;  3EKE A;  2GLJ A;  4NGT A;  5K8P A;  5CMS A;  3EJG A;  3GQE A;  3S9M A;  5FSY A;  2PIY A;  3IC1 A;  4WWV A;  1TKF A;  4MHP A;  2J9A A;  3NH4 A;  3KR4 A;  2POK A;  3B3S A;  3K2K A;  4JLL A;  1F2P A;  1TXR A;  1LAM A;  3B3C A;  3KQX A;  5DUS A;  1XJO A;  3B35 A;  2PJ4 A;  3CPA A;  7CPA A;  3DLJ A;  4OC2 A;  1CPX A;  1IGB A;  5HVF A;  2DEA A;  4EME A;  3PEI A;  4X2T A;  1YSJ A;  1VHO A;  5FSU A;  3MRU A;  4K3N A;  4Q7A A;  1F2O A;  2EK9 A;  2RB7 A;  2AFZ A;  1TF8 A;  5FSV A;  3NFZ A;  1BPN A;  4P4J A;  3EWO A;  1LFW A;  3GPO A;  4P44 A;  1QMU A;  1AMP A;  3ISZ A;  1NSA A;  1TKJ A;  4PQA A;  1SPV A;  3GUX A;  3QNV A;  2PRQ A;  2GU2 A;  2V8V A;  4F8Z A;  2Q43 A;  1XBU A;  4FBE A;  4OC5 A;  4UEE A;  2AFU A;  1FNO A;  4P4E A;  2PE3 A;  3ETI A;  3IID A;  3KI9 A;  2ZEH A;  3RAM A;  4R76 A;  3LMS A;  5K8N A;  4NGR A;  1DE4 C;  3ISX A;  4TWE A;  4J4Z A;  2AFM A;  3SI1 A;  3VFQ A;  3SII A;  4ABK A;  3GB0 A;  4F9U A;  3H8G A;  3I1U A;  2AFS A;  3CDX A;  3IJ3 A;  4P4D A;  5DS0 A;  3HUV A;  3FEE A;  4NGQ A;  3SI2 A;  4OME A;  3FJU A;  4EFD A;  2X47 A;  5THW A;  3SJG A;  1TY8 A;  1XFO A;  2V77 A;  3MN8 A;  1YD9 A;  2PJ3 A;  1Z5R A;  2ZOF A;  4IAV A;  1KWM A;  4PXB A;  4ETJ A;  5HIH A;  3FVL A;  4R7M A;  2C6C A;  3IIF A;  1Y7E A;  2ZEN A;  4NGP A;  2ZEP A;  4YWY A;  3TC8 A;  3TX8 A;  3B7I A;  2JEW A;  4R6T A;  2PJ6 A;  5D8N A; 
#chains in the Genus database with same CATH topology
 1UWY A;  3GLJ A;  3SIJ A;  2ARH A;  4MXU A;  3F5B A;  4KOR A;  3R9G A;  2Z3K A;  4NGS A;  3H8F A;  1HEE A;  4X8I A;  3D7D A;  2PR8 A;  5CB3 A;  1M44 A;  4P4B A;  2GFQ A;  2VRI A;  4FUU A;  3GY9 A;  1YVK A;  4MFZ A;  2V8G A;  5I0C A;  3PFO A;  1XF8 A;  2DPT A;  4ONW A;  3BI1 A;  2P6F A;  4KSI A;  1YW6 A;  2FG1 A;  3IFE A;  4JWP A;  4PPZ A;  2HQY A;  5E3B A;  2EK8 A;  3RBU A;  2Z3L A;  3VAR A;  3CXS A;  4C68 A;  4MY3 A;  3RYO A;  2PQ8 A;  2D4O A;  4A37 A;  4C2Y A;  4MCP A;  4TNU A;  3GQO A;  2PRB A;  3TO7 A;  4IK2 A;  4DNC A;  5J8F A;  2W2G A;  1CX8 A;  4CGM A;  4A95 A;  1ELM P;  3OWC A;  4PK2 A;  5IX3 A;  4ZGY B;  2RFH A;  3EW5 A;  2YNE A;  4YGO A;  4F9V A;  4OP4 A;  5LRJ A;  1ZLH A;  3R9F A;  4NJQ A;  3TE4 A;  5F46 A;  1M1D A;  2F5I A;  2PDO A;  4OIW A;  2ZOG A;  1KUV A;  4MI4 A;  1VIX A;  3IWG A;  4QVT A;  5LYL A;  2JZE A;  4ZX9 A;  3V45 A;  4OC4 A;  2EEE A;  2PJ8 A;  4KSA A;  5LRG A;  1S7N A;  2WZN A;  8CPA A;  2ZED A;  3LOD A;  2Z10 A;  4ZY1 A;  3VWD A;  3BJ7 A;  3S6G A;  3SIH A;  4EVY A;  5IB9 A;  3BXM A;  3HLP A;  4GM5 A;  3SXO A;  2JBK A;  2ZEO A;  2PJ2 A;  1X10 A;  4JVV A;  2R8V A;  5CB5 A;  4DYO A;  2AFX A;  1P4N A;  3SHP A;  5KTA A;  3DGV A;  1FT7 A;  2ZEE A;  2C6P A;  4JYW A;  3PB7 X;  3W91 A;  3WAB A;  2QJ8 A;  4IQY A;  3WC7 A;  1Z8W A;  4H2K A;  2F7V A;  3DNS A;  2DXQ A;  4UEF A;  4C2X A;  2Z3P A;  3CPX A;  4AG9 A;  2Q4Z A;  3B3T A;  4P6Y A;  1ARL A;  4AB7 A;  1LAP A;  3R96 A;  3D68 A;  1XRY A;  3SI0 A;  4KSF A;  3SJF A;  1YLO A;  3R9E A;  3IIB A;  5IB0 A;  1IOI A;  3IGR A;  2WPW A;  3KGQ A;  4IUS A;  5C88 A;  4OC3 A;  4KOU A;  5F09 A;  2C1C A;  1ZG8 A;  2XEI A;  2ATR A;  1I21 A;  2PSW A;  1IYK A;  2P0W A;  2AFC A;  2VBQ A;  3TCV A;  3D7H A;  4M3S A;  4QUS A;  4X3R A;  1NE9 A;  4XPD B;  3FNC A;  1RTQ A;  4MFL A;  1IY7 A;  3B3W A;  3PB4 X;  2Z0Z A;  1ON0 A;  1P0H A;  4WJB A;  5J1Q A;  4JCA A;  3SXN A;  1YGH A;  3PRT A;  3KZW A;  2QVP A;  5FSX A;  3LWU A;  5JM6 A;  3FBU A;  4JLY A;  3EC4 A;  5HH1 A;  4ZY0 A;  1Q2D A;  1BLL E;  3KR5 A;  3JZT A;  2D4P A;  3BHX A;  2OOT A;  4KS9 A;  4G1P A;  4Q36 A;  4UIA A;  2R7H A;  2JZF A;  2AFO A;  3RO0 A;  3GKR A;  2EUI A;  4RS2 A;  3S6K A;  4MCR A;  2Q04 A;  4NXY A;  4RN7 A;  1GYT A;  4CYN A;  2BFQ A;  3NE8 A;  4P10 A;  1Z2L A;  5FVJ A;  4PXE A;  4AXV A;  1Z8L A;  3KAS A;  4HNX B;  4B5P A;  6CPA A;  1YK3 A;  3W6X A;  2Q7B A;  1PYT B;  2QIR A;  4UA3 A;  4YU9 A;  4FD5 A;  1YLE A;  4E8O A;  1VHS A;  3PFE A;  2V8D A;  2KCW A;  4HKF A;  5ELY A;  5IV0 A;  2DX6 A;  2H5M A;  2PCU A;  4A38 A;  2O53 A;  1QSN A;  1YQE A;  5EMI A;  2PR1 A;  2Z3O A;  1XMB A;  5J8C A;  3CXP A;  3KHZ A;  3KQZ A;  2ZXV A;  3VWE A;  1BO4 A;  1ZG7 A;  3D7G A;  1Q7L A;  3L2N A;  3H8E A;  1BPM A;  2BOA A;  4JZ0 A;  4MCQ A;  4R9M A;  2EWB A;  4D86 A;  4UCM A;  3F8K A;  4MHZ A;  1TKH A;  2OB0 A;  1ZR3 A;  4GXH A;  3NH8 A;  3V8I A;  4MBU A;  3TO9 A;  1VHU A;  2AJ6 A;  2VL1 A;  3TO6 A;  4FAI A;  2EVN A;  2K5T A;  4GUA A;  1CPS A;  1QST A;  3IU1 A;  4CRY B;  2R1I A;  5K8M A;  2RC4 A;  3F0A A;  1OBR A;  4O23 A;  5KTD A;  2OZU A;  4J5R A;  4UBR A;  4DJL A;  4OKO A;  5JGF A;  2JEV A;  3NH5 A;  3PZJ A;  3V38 A;  4CGN A;  5EBV A;  5I4M A;  4NGN A;  1Y9W A;  3ZZI A;  4UML A;  2I00 A;  2IMO A;  3FX6 A;  2L8R A;  1YR0 A;  1ZLI A;  4FD6 A;  3K9T A;  3TT2 A;  4ETK A;  2V8H A;  3TTH A;  4Y49 B;  5JH9 A;  4Q38 A;  3R95 A;  2GE3 A;  2OZH A;  4PSW A;  4BD9 A;  4QC6 A;  1U6M A;  3BJ8 A;  4CS0 B;  4EWT A;  4CPA A;  3GPQ A;  2CTC A;  4H89 A;  1QSM A;  1S7F A;  1CG2 A;  4ZY2 A;  2PJ5 A;  2WPX A;  2XEJ A;  1BAV A;  1CP7 A;  1IB1 E;  3WC6 A;  4UWI A;  2GRE A;  4MJ8 A;  3KHX A;  2G9D A;  4OC1 A;  4B5P B;  1CJW A;  3PP9 A;  4HNW B;  1Z8X A;  1N71 A;  3LAC A;  2BUE A;  4ZX8 A;  1RO5 A;  5CBM A;  2HC9 A;  4K0C A;  1VGY A;  1R43 A;  2OH1 A;  4PK3 A;  4MMO A;  1AYE A;  4P4F A;  4UEZ A;  3JTK A;  3EWP A;  1YX0 A;  4MCS A;  4AG7 A;  4B12 A;  4FD4 A;  5LYD A;  4E2A A;  2JLM A;  3FF3 A;  4GVW A;  4B11 A;  1EE3 P;  4CAV A;  1I1D A;  2ANP A;  3EJF A;  2AFW A;  4KYB A;  4M6I A;  1CBX A;  5HMN A;  3FH4 A;  2RNK A;  3CZX A;  5K8O A;  2PVW A;  2PJ0 A;  3ZJ0 A;  2Q44 A;  3IWW A;  4B10 A;  5KTC A;  3N5F A;  4J5S A;  3IWE A;  1AUG A;  3D2M A;  2O28 A;  2GAN A;  3PBE A;  4ABL A;  4P4I A;  5GCN A;  5DWN A;  3Q6Z A;  4UIB A;  4II9 A;  3JRU A;  4A39 A;  2ZEG A;  4ESS A;  2YGW A;  3P2F A;  4NSQ A;  1QSR A;  4CYO A;  1LOK A;  4MY0 A;  3S6F A;  2EBJ A;  3T90 A;  3D66 A;  2CXA A;  3PGP A;  4ONU A;  5AIL A;  4NF1 A;  4DUK A;  1WK4 A;  2FIW A;  3EY5 A;  1ARM A;  5F47 A;  3WR7 A;  2NSM A;  1HJZ A;  2HB6 A;  3D4U A;  1M4L A;  5H86 A;  1KZF A;  2JDD A;  3S9N A;  2O4H A;  4RUH A;  1B6B A;  4MHY A;  3MGD A;  1VKC A;  2PJA A;  4ORF A;  4CGL A;  4Z65 A;  2PJC A;  2B4B A;  2REF A;  2FL4 A;  1F57 A;  1QQ9 A;  2FE7 A;  2PVV A;  3NA6 A;  1IU8 A;  4LUA A;  4NJR A;  3B8G A;  4AVA A;  4XPD C;  2CF4 A;  4UF4 A;  4C2Z A;  2R98 A;  3B2Y A;  2WYR A;  1XE4 A;  4IHM A;  4KZT A;  3D67 A;  4F0X A;  5EC4 A;  3EO4 A;  5HVG A;  3TFY A;  4XPL A;  2VEZ A;  1Y7R A;  3T8W A;  2ZW7 A;  4UFV A;  5A28 A;  4GVV A;  1XEB A;  3SJE A;  4AVB A;  2BCO A;  3SJX A;  2BO9 A;  1Y9K A;  4FWU A;  2FXK A;  2NYQ A;  1YVO A;  1Y0R A;  3V7Z A;  3K9U A;  4ZI6 A;  2ZEM A;  4UFX A;  4KVM E;  1V0C A;  3PB9 X;  2CTB A;  2YNC A;  4MHD A;  4OID A;  4P45 A;  2WUU A;  2CY2 A;  3D7F A;  5CNP A;  2Q51 A;  4A2Z A;  1HDQ A;  1H8L A;  3LD2 A;  4CYQ A;  3EWQ A;  2VZZ A;  4KOY A;  5H84 A;  2JBJ A;  3W6S A;  1Z4E A;  1LAN A;  1ELL P;  3PB6 X;  4MRI A;  3FED A;  1PCA A;  2XD7 A;  2Q4V A;  3KL9 A;  4PV6 A;  3T9Y A;  1CP6 A;  1L0C A;  1YW4 A;  2PJ9 A;  2Q4Y A;  3FEC A;  3VAT A;  2CIJ A;  2PIZ A;  2PJ7 A;  4L8A A;  1RXT A;  4ZBG A;  4H6Z A;  4KVO E;  4A94 A;  3WT4 A;  5C82 A;  3Q71 A;  1TIQ A;  2PJ1 A;  4KVX A;  3PBB A;  4RI1 A;  4R3K A;  4IF5 A;  3WC5 A;  3D8P A;  2I3C A;  2F8H A;  1DTD A;  3RZA A;  4ZYQ A;  3PB8 X;  3TOB A;  3BI0 A;  5AG5 A;  1NSL A;  4BIN A;  1IOF A;  3E0K A;  3H5Z A;  2FAV A;  3IO1 A;  3JVN A;  2IQ6 A;  2BFR A;  1JQG A;  3H4Q A;  5D29 A;  3RNZ A;  5F48 A;  3S9L A;  1VHE A;  4J5Q A;  2J8R A;  3FMC A;  3NE7 A;  3I3G A;  5AG7 A;  5HVH A;  3V2B A;  2B5G A;  1ZG9 A;  3CT9 A;  3EWR A;  2ZEF A;  4MFK A;  2FIA A;  2QML A;  4OC0 A;  2FVG A;  2ZEL A;  2LGR A;  4JGK A;  1ZO0 A;  2ZW6 A;  3I9S A;  5CPA A;  4A30 A;  2NMT A;  1YME A;  4LQG A;  2YNC C;  1MK4 A;  3SIG A;  4XPK A;  4Y49 C;  2BEI A;  4YRH A;  2KQV A;  1LCP A;  1S7K A;  4PXC A;  4B6Z A;  4KUA A;  3VH9 A;  2OR4 A;  2GLF A;  2J8N A;  5HXD A;  4M6G A;  1PUA A;  3GPG A;  5FSZ A;  4QB9 A;  2G3A A;  3FYN A;  1KUX A;  4PSX A;  4R8F A;  2Q0Y A;  3DR6 A;  1X12 A;  5LRK A;  1S60 A;  5HOL A;  4MHN A;  3P2H A;  1A2Z A;  2FCK A;  1MJB A;  3IEH A;  2QYV A;  2XEF A;  4CAF A;  1J4J A;  2EO8 A;  1TF9 A;  1GHE A;  3D3S A;  5LYF A;  4OAD A;  1BOB A;  1IIC A;  2B4D A;  2XEG A;  2IL4 A;  1IYL A;  4KOS A;  2DPS A;  5DWM A;  1ZR5 A;  1CM0 A;  4NGM A;  2Q7S A;  5LYI A;  4C7H A;  2QEC A;  1PU9 A;  2ACF A;  2BL1 A;  1TXZ A;  2Y0M A;  3DDD A;  2P6G A;  2ZPA A;  4J3G A;  4K30 A;  3R1K A;  2PJB A;  4TU0 A;  5AG4 A;  2AE6 A;  3B3V A;  4PXD A;  5A27 A;  1Q2C A;  2P6E A;  2IJZ A;  2C6G A;  4CRZ B;  2ABZ A;  1WWZ A;  2ODF A;  3DSB A;  1Y0Y A;  3QAH A;  4NFR A;  1R3N A;  4CAX A;  1NJR A;  1HDU A;  2CNM A;  2FS5 A;  3A9L A;  4W9Y A;  4CAE A;  3EKE A;  2GLJ A;  4NGT A;  5K8P A;  4B14 A;  5CMS A;  3FIX A;  3EJG A;  3GQE A;  5E96 A;  5G20 A;  2B5G B;  3S9M A;  5FSY A;  2BSW A;  2PIY A;  3IC1 A;  4WWV A;  1TKF A;  4MHP A;  2OZG A;  2REE A;  2J9A A;  1XMT A;  5JQ4 A;  3NH4 A;  3KR4 A;  2POK A;  3B3S A;  2JZD A;  1YRE A;  2C27 A;  2CNS A;  3K2K A;  2VZY A;  4JLL A;  4U5Y A;  1F2P A;  1TXR A;  1LAM A;  3BLN A;  3B3C A;  2B3U A;  4LX9 A;  3KQX A;  5DUS A;  1XJO A;  1MJA A;  3B35 A;  2PJ4 A;  5AGE A;  3CPA A;  4BBH A;  4BMH A;  2J8M A;  3DLJ A;  2HUZ A;  3FB3 A;  7CPA A;  4MFJ A;  4OC2 A;  4KLW A;  1CPX A;  1IGB A;  5HVF A;  4UWJ A;  1JWQ A;  2PC1 A;  5G22 A;  4H6U A;  2DEA A;  4EME A;  1B87 A;  3PEI A;  4X2T A;  1YSJ A;  2VXK A;  1VHO A;  4XNH C;  4UFW A;  5FSU A;  2FSR A;  3MRU A;  4K3N A;  4JJX A;  4M6H A;  4Q7A A;  4U9Y A;  1F2O A;  1LRZ A;  2EK9 A;  2RB7 A;  2AFZ A;  5F49 A;  1TF8 A;  2B4D B;  5FSV A;  4JXR A;  1UFH A;  3NFZ A;  4GS4 A;  1BPN A;  2FXF A;  4JXQ A;  4XNH B;  4P4J A;  3KKW A;  3EWO A;  4A31 A;  1NMT A;  5BWA B;  1LFW A;  2GIV A;  4B13 A;  3GPO A;  4P44 A;  1QMU A;  1AMP A;  3ISZ A;  1NSA A;  1TKJ A;  4PQA A;  1SPV A;  3GUX A;  3QNV A;  2PRQ A;  2GU2 A;  2HV2 A;  3GYA A;  2ZW4 A;  2V8V A;  4KOX A;  4AVC A;  4HPS A;  5G21 A;  3UY5 A;  4F8Z A;  2Q43 A;  3FRM A;  1XBU A;  3D2P A;  4OC5 A;  4UEE A;  2I79 A;  3S6H A;  4FBE A;  4KUB A;  2AFU A;  1FNO A;  1M4G A;  4P4E A;  2PE3 A;  4E0A A;  1K4J A;  1S7L A;  2WCT A;  3ETI A;  3IID A;  3KI9 A;  4A32 A;  2ZEH A;  1FY7 A;  4M85 A;  4MFP A;  3RAM A;  4R76 A;  3LMS A;  5K8N A;  4NGR A;  3QAY A;  1DE4 C;  3EXN A;  3ISX A;  4TWE A;  3CXQ A;  3C26 A;  4UCN A;  2CNT A;  3G3S A;  2Z3N A;  4KOW A;  4J4Z A;  2AFM A;  2VQY A;  3SI1 A;  1I12 A;  2FT0 A;  3VFQ A;  2YND A;  4I49 A;  2Z3M A;  3SII A;  1Q2Y A;  1S5K A;  4X5K A;  1XOV A;  3FXT A;  4CGP A;  2DF5 A;  4ABK A;  2B3V A;  1Z8T A;  4HNY B;  3GB0 A;  4F9U A;  1S3Z A;  3G8W A;  4A33 A;  4UCP A;  1M4I A;  2ZW5 A;  3H8G A;  1IID A;  3I1U A;  4LQ6 A;  2JDC A;  2AFS A;  3DR8 A;  3CDX A;  2WSA A;  3IJ3 A;  1Z9U A;  4KLV A;  4P4D A;  1MJ9 A;  5DS0 A;  1OZP A;  4L89 A;  4F0Y A;  3HUV A;  2A4N A;  3FEE A;  4NGQ A;  4KOT A;  3SI2 A;  4R87 A;  5AG6 A;  4B5O A;  4OME A;  2X7B A;  5ISV A;  3FJU A;  4OLL A;  4FD7 A;  4EFD A;  4OAE A;  2X47 A;  2Z11 A;  5THW A;  3IU2 A;  3SJG A;  1TY8 A;  1SQH A;  1QSO A;  1XFO A;  4JD6 A;  2V77 A;  3MN8 A;  4YFJ A;  1YD9 A;  2PJ3 A;  1Z5R A;  4QBJ A;  4U9Z A;  2ZOF A;  4CYP A;  4IAV A;  4NEX A;  5JPH A;  1KWM A;  4PXB A;  2VI7 A;  4NCZ A;  4ETJ A;  3EFA A;  5HIH A;  4R3L A;  1Z4R A;  3JUW A;  3FVL A;  1XIX A;  4R7M A;  3QB8 A;  2C6C A;  3IIF A;  1Y7E A;  2B58 A;  2G0B A;  2ZEN A;  4NGP A;  4C7I A;  2ZEP A;  4YWY A;  3TC8 A;  3TX8 A;  1M4D A;  3B7I A;  4R57 A;  2OU2 A;  2G3T A;  1KUY A;  1R57 A;  4KOV A;  5G1Z A;  2JEW A;  4F6A A;  3N7Z A;  4R6T A;  4CGO A;  3GIU A;  2PJ6 A;  5D8N A;  4MFQ A;  4CAW A;  3TOA A; 
#chains in the Genus database with same CATH homology
 1UWY A;  3GLJ A;  3SIJ A;  4MXU A;  4NGS A;  3H8F A;  1HEE A;  4X8I A;  3D7D A;  5CB3 A;  4P4B A;  5LYL A;  2VRI A;  4FUU A;  2V8G A;  3PFO A;  4ONW A;  3BI1 A;  4KSI A;  1YW6 A;  2FG1 A;  3IFE A;  4PPZ A;  5E3B A;  2EK8 A;  3RBU A;  3VAR A;  4A37 A;  4MCP A;  4TNU A;  3GQO A;  4IK2 A;  1CX8 A;  1ELM P;  2RFH A;  3EW5 A;  4F9V A;  4OP4 A;  5LRJ A;  1ZLH A;  4NJQ A;  4OIW A;  2ZOG A;  1VIX A;  4ZX9 A;  3V45 A;  4OC4 A;  2EEE A;  2PJ8 A;  5LRG A;  2WZN A;  8CPA A;  2ZED A;  4ZY1 A;  3SIH A;  5IB9 A;  3BXM A;  3HLP A;  4GM5 A;  2JBK A;  2ZEO A;  2PJ2 A;  4JVV A;  5CB5 A;  4DYO A;  2AFX A;  3DGV A;  1FT7 A;  2ZEE A;  2C6P A;  4JYW A;  3PB7 X;  3WAB A;  2QJ8 A;  4IQY A;  3WC7 A;  4H2K A;  2F7V A;  4UEF A;  3CPX A;  2Q4Z A;  3B3T A;  4P6Y A;  1ARL A;  1LAP A;  3D68 A;  1XRY A;  3SI0 A;  3SJF A;  1YLO A;  3IIB A;  3KGQ A;  4OC3 A;  5F09 A;  2C1C A;  1ZG8 A;  2XEI A;  2AFC A;  3D7H A;  4X3R A;  1RTQ A;  1IY7 A;  3B3W A;  3PB4 X;  5J1Q A;  4JCA A;  3PRT A;  3KZW A;  2QVP A;  5FSX A;  3LWU A;  5JM6 A;  4ZY0 A;  3BHX A;  1BLL E;  3KR5 A;  3JZT A;  2OOT A;  4G1P A;  4UIA A;  2AFO A;  4MCR A;  1GYT A;  2BFQ A;  4P10 A;  1Z2L A;  4AXV A;  4PXE A;  6CPA A;  1Z8L A;  3KAS A;  1PYT B;  4YU9 A;  3PFE A;  5ELY A;  2V8D A;  2DX6 A;  2PCU A;  4A38 A;  2O53 A;  1XMB A;  3KHZ A;  3KQZ A;  1ZG7 A;  3D7G A;  4JZ0 A;  1Q7L A;  3L2N A;  3H8E A;  1BPM A;  2BOA A;  4WJB A;  4MCQ A;  2EWB A;  4D86 A;  4MHZ A;  1TKH A;  1ZR3 A;  3NH8 A;  1VHU A;  2VL1 A;  4FAI A;  4GUA A;  1CPS A;  5K8M A;  1OBR A;  4O23 A;  4J5R A;  4DJL A;  4OKO A;  5JGF A;  3NH5 A;  3V38 A;  5I4M A;  4NGN A;  4UML A;  2IMO A;  3FX6 A;  2L8R A;  1ZLI A;  3K9T A;  4ETK A;  2V8H A;  5JH9 A;  4BD9 A;  4EWT A;  4CPA A;  3GPQ A;  2CTC A;  2PJ5 A;  2XEJ A;  1CG2 A;  4ZY2 A;  3WC6 A;  1BAV A;  1CP7 A;  2GRE A;  3KHX A;  2G9D A;  4OC1 A;  4ZX8 A;  5CBM A;  2HC9 A;  4K0C A;  1VGY A;  1R43 A;  4P4F A;  4MMO A;  1AYE A;  4UEZ A;  3EWP A;  4MCS A;  5LYD A;  3FF3 A;  4GVW A;  1EE3 P;  2ANP A;  3EJF A;  2AFW A;  4KYB A;  1CBX A;  3FH4 A;  5K8O A;  2PVW A;  2PJ0 A;  3IWW A;  3N5F A;  4J5S A;  3PBE A;  4ABL A;  4P4I A;  3Q6Z A;  4UIB A;  3JRU A;  4A39 A;  2ZEG A;  4ESS A;  1LOK A;  3D66 A;  5AIL A;  4DUK A;  1ARM A;  2NSM A;  1HJZ A;  2HB6 A;  3D4U A;  1M4L A;  3S9N A;  2O4H A;  4RUH A;  4MHY A;  2PJA A;  4Z65 A;  2PJC A;  1F57 A;  1QQ9 A;  2PVV A;  3NA6 A;  4NJR A;  2CF4 A;  4UF4 A;  3B2Y A;  2WYR A;  4IHM A;  3D67 A;  5HVG A;  3T8W A;  4GVV A;  3SJE A;  2BCO A;  3SJX A;  2BO9 A;  4FWU A;  2FXK A;  2NYQ A;  1Y0R A;  3V7Z A;  4ZI6 A;  2ZEM A;  3PB9 X;  2CTB A;  4OID A;  4P45 A;  3D7F A;  2Q51 A;  1HDQ A;  1H8L A;  3EWQ A;  2JBJ A;  1LAN A;  1ELL P;  3PB6 X;  4MRI A;  3FED A;  1PCA A;  2XD7 A;  3KL9 A;  1CP6 A;  1YW4 A;  2PJ9 A;  3FEC A;  3VAT A;  2CIJ A;  2PIZ A;  2PJ7 A;  4A94 A;  3WT4 A;  3Q71 A;  2PJ1 A;  3PBB A;  3WC5 A;  2I3C A;  2F8H A;  1DTD A;  3RZA A;  4ZYQ A;  3PB8 X;  3BI0 A;  3IO1 A;  2FAV A;  2IQ6 A;  2BFR A;  1JQG A;  5D29 A;  3S9L A;  1VHE A;  4J5Q A;  3FMC A;  5HVH A;  3V2B A;  1ZG9 A;  3CT9 A;  3EWR A;  2ZEF A;  4OC0 A;  2FVG A;  2ZEL A;  2LGR A;  4JGK A;  5CPA A;  1YME A;  4LQG A;  3SIG A;  1LCP A;  4PXC A;  4B6Z A;  3VH9 A;  2OR4 A;  2GLF A;  5HXD A;  3GPG A;  5FSZ A;  4R8F A;  5LRK A;  5HOL A;  4MHN A;  3IEH A;  2QYV A;  2XEF A;  1TF9 A;  5LYF A;  2XEG A;  1ZR5 A;  4NGM A;  5LYI A;  2ACF A;  1TXZ A;  2PJB A;  4TU0 A;  3B3V A;  4PXD A;  2IJZ A;  2C6G A;  2ABZ A;  4NFR A;  1Y0Y A;  1R3N A;  1NJR A;  1HDU A;  4W9Y A;  3EKE A;  2GLJ A;  4NGT A;  5K8P A;  5CMS A;  3EJG A;  3GQE A;  3S9M A;  5FSY A;  2PIY A;  3IC1 A;  4WWV A;  1TKF A;  4MHP A;  2J9A A;  3NH4 A;  3KR4 A;  2POK A;  3B3S A;  3K2K A;  4JLL A;  1F2P A;  1TXR A;  1LAM A;  3B3C A;  3KQX A;  5DUS A;  1XJO A;  3B35 A;  2PJ4 A;  3CPA A;  7CPA A;  3DLJ A;  4OC2 A;  1CPX A;  1IGB A;  5HVF A;  2DEA A;  4EME A;  3PEI A;  4X2T A;  1YSJ A;  1VHO A;  5FSU A;  3MRU A;  4K3N A;  4Q7A A;  1F2O A;  2EK9 A;  2RB7 A;  2AFZ A;  1TF8 A;  5FSV A;  3NFZ A;  1BPN A;  4P4J A;  3EWO A;  1LFW A;  3GPO A;  4P44 A;  1QMU A;  1AMP A;  3ISZ A;  1NSA A;  1TKJ A;  4PQA A;  1SPV A;  3GUX A;  3QNV A;  2PRQ A;  2GU2 A;  2V8V A;  4F8Z A;  2Q43 A;  1XBU A;  4FBE A;  4OC5 A;  4UEE A;  2AFU A;  1FNO A;  4P4E A;  2PE3 A;  3ETI A;  3IID A;  3KI9 A;  2ZEH A;  3RAM A;  4R76 A;  3LMS A;  5K8N A;  4NGR A;  1DE4 C;  3ISX A;  4TWE A;  4J4Z A;  2AFM A;  3SI1 A;  3VFQ A;  3SII A;  4ABK A;  3GB0 A;  4F9U A;  3H8G A;  3I1U A;  2AFS A;  3CDX A;  3IJ3 A;  4P4D A;  5DS0 A;  3HUV A;  3FEE A;  4NGQ A;  3SI2 A;  4OME A;  3FJU A;  4EFD A;  2X47 A;  5THW A;  3SJG A;  1TY8 A;  1XFO A;  2V77 A;  3MN8 A;  1YD9 A;  2PJ3 A;  1Z5R A;  2ZOF A;  4IAV A;  1KWM A;  4PXB A;  4ETJ A;  5HIH A;  3FVL A;  4R7M A;  2C6C A;  3IIF A;  1Y7E A;  2ZEN A;  4NGP A;  2ZEP A;  4YWY A;  3TC8 A;  3TX8 A;  3B7I A;  2JEW A;  4R6T A;  2PJ6 A;  5D8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...