4X2TA

X-ray crystal structure of the orally available aminopeptidase inhibitor, tosedostat, bound to the m17 leucyl aminopeptidase from p. falciparum
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
519
structure length
516
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of an orally available aminopeptidase inhibitor, Tosedostat, bound to anti-malarial drug targets PfA-M1 and PfA-M17.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 171
structure length 516
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4x2tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x2tA02
5CBMA 2AFZA 2AFSA 2EK8A 2CTCA 2EK9A 2EEEA 1ARLA 3SIJA 4NFRA 4P4JA 2WYRA 3PRTA 2AFUA 4PXDA 1Y0RA 2PVWA 2ACFA 2PJ3A 1TKJA 3FEDA 4OC0A 1ZG7A 3WT4A 4GM5A 4MHPA 2PIZA 5HVGA 2CIJA 1IY7A 3EJFA 2POKA 3L2NA 3GPQA 3EWPA 1VHOA 2ZEPA 4TU0A 2I3CA 3FECA 2PRQA 3Q71A 2QVPA 3CDXA 5LRKA 2DEAA 4CPAA 5LYFA 4PPZA 2PJBA 2QYVA 4EMEA 4MMOA 1BPMA 5THWA 4UIAA 1TKHA 3Q6ZA 2BOAA 2ZEHA 4ZY0A 3DLJA 4R8FA 5K8OA 3EJGA 4KYBA 2PJ7A 3IIBA 1ZR5A 2J9AA 4G1PA 4ETKA 2FXKA 4RUHA 1YLOA 4NJRA 2Q43A 1YW4A 2AFOA 1H8LA 1F2OA 2ZEEA 3B3WA 3EWOA 3B3CA 2FG1A 3WC5A 1DTDA 1Q7LA 1VHEA 1YW6A 4PQAA 2QJ8A 5F09A 1VIXA 1LAPA 5JM6A 1ELMP 4JYWA 4MXUA 1HDQA 3D7GA 2ZEGA 2AFXA 4OIDA 3SJEA 1XRYA 2ZEMA 4H2KA 3VARA 4X2TA 3KHZA 4NGNA 3T8WA 5K8MA 4DJLA 4ZX9A 2C1CA 8CPAA 1FT7A 3CT9A 4PXBA 4J5RA 1PYTB 2X47A 3FX6A 1TXZA 2PJ4A 3KGQA 5HVHA 5CB3A 1ZLIA 4B6ZA 1XJOA 3NFZA 4A94A 4FUUA 2GLJA 4OC4A 5LRJA 3LWUA 4OP4A 1ZR3A 1FNOA 1CPXA 3IIDA 3NH8A 3GB0A 1IGBA 2BFRA 2JBKA 1LANA 1BPNA 3B3SA 4UIBA 4UF4A 5DUSA 4GVWA 4MCPA 5K8NA 4FAIA 1UWYA 2ZEDA 2Q4ZA 3ISZA 1YMEA 2PIYA 4R76A 2BCOA 3B7IA 4UEFA 2OOTA 1TF9A 4P44A 5FSYA 3BXMA 4P4IA 4JGKA 2PJ8A 4PXCA 2V8HA 3RAMA 3B3TA 3LMSA 3PEIA 1LAMA 3V7ZA 1F57A 2BO9A 2OR4A 1VHUA 2F7VA 4ONWA 5D8NA 4OC5A 4X8IA 4P4DA 2PJ5A 3PB6X 1VGYA 1Y0YA 2AFMA 5I4MA 2JBJA 3HLPA 3KQXA 3H8GA 4MCSA 2NSMA 2XEGA 2ZEOA 1BAVA 1YD9A 1ARMA 3KASA 4D86A 2FVGA 3KHXA 2AFWA 1CP7A 2CF4A 3SIHA 2RB7A 2PJAA 2ANPA 1M4LA 1RTQA 5HXDA 1EE3P 3FF3A 4MHYA 3S9NA 2NYQA 2C6GA 3D67A 5FSXA 4NGQA 5FSUA 4JLLA 3D7HA 4OMEA 4MRIA 4PXEA 4NGPA 3EW5A 2V77A 3VFQA 4A39A 1LOKA 1R3NA 5AILA 3BI0A 3FMCA 3IIFA 1ZLHA 5LYIA 2V8VA 4ABLA 3D7FA 3FEEA 1Z2LA 3PB7X 1ZG9A 5HOLA 3V45A 3V2BA 3KI9A 3RZAA 4FBEA 1Y7EA 4Q7AA 2EWBA 2O53A 4WWVA 4JCAA 3D7DA 4OIWA 5CMSA 1TKFA 2XD7A 2IJZA 1LFWA 4MCQA 3FVLA 3IWWA 4WJBA 3IC1A 1AYEA 3GQOA 3BI1A 2IQ6A 4MCRA 4NGTA 2XEFA 4OC1A 1PCAA 2JEWA 3JRUA 3GLJA 3WC7A 4P10A 4R7MA 4P4BA 4K0CA 5FSVA 7CPAA 2VL1A 1QMUA 4J4ZA 2C6CA 2GLFA 2PCUA 2HB6A 2O4HA 3BHXA 3TC8A 4ZY2A 1QQ9A 3SI0A 3HUVA 3GPGA 2ZENA 4GUAA 3DGVA 4ABKA 3SJFA 2VRIA 1AMPA 4IAVA 4X3RA 3QNVA 3PB4X 3V38A 3IJ3A 4J5SA 5CB5A 4Z65A 1F2PA 2ABZA 4DUKA 3WC6A 4W9YA 3D4UA 5JGFA 2F8HA 3CPAA 5LYLA 5FSZA 1KWMA 3D66A 4TNUA 1TXRA 1TF8A 4ESSA 2LGRA 4UEZA 3EWQA 3KL9A 1CPSA 5HVFA 1GYTA 2PJ9A 2GREA 1CX8A 3PFEA 3KR4A 2FAVA 1CP6A 1R43A 1Z5RA 4DYOA 4TWEA 4FWUA 2GU2A 3B3VA 4MHZA 5K8PA 1Z8LA 5D29A 4OKOA 3SIGA 1XBUA 4MHNA 2PJCA 4P4EA 1XMBA 4P6YA 4A38A 3H8EA 4ZX8A 3I1UA 2AFCA 2ZOGA 4NGMA 5LRGA 3SJGA 4ZI6A 1HEEA 2PE3A 4AXVA 4YWYA 2L8RA 3ETIA 3IFEA 1HJZA 4ETJA 3MRUA 5JH9A 1XFOA 3K9TA 4LQGA 2IMOA 3GPOA 4R6TA 4BD9A 1BLLE 4KSIA 5DS0A 3K2KA 4IHMA 1ZG8A 1CG2A 4NGRA 3S9LA 4P45A 1JQGA 3ISXA 3EWRA 2ZELA 3NH5A 3PB8X 4GVVA 2CTBA 5J1QA 4A37A 2PJ2A 3JZTA 3VH9A 4ZY1A 3PFOA 2PVVA 4IQYA 2V8GA 2G9DA 3SI2A 1LCPA 3TX8A 4JZ0A 4UEEA 3WABA 1CBXA 4EFDA 4J5QA 3N5FA 3GUXA 3SIIA 3KZWA 2ZEFA 2XEIA 2PJ0A 1YSJA 1NJRA 4IK2A 3S9MA 2BFQA 4P4FA 2V8DA 3KR5A 4NGSA 3D68A 2Q51A 2C6PA 4K3NA 2PJ6A 3CPXA 3PBEA 3H8FA 3VATA 3PB9X 2PJ1A 1TY8A 4O23A 3B35A 5CPAA 3PBBA 3RBUA 2XEJA 3SI1A 3MN8A 4OC3A 3KQZA 4F9UA 2WZNA 3SJXA 5HIHA 3FJUA 3B2YA 3GQEA 2RFHA 3IO1A 3EKEA 2HC9A 4ZYQA 4NJQA 4YU9A 3NH4A 4F8ZA 3IEHA 4JVVA 1NSAA 5E3BA 5LYDA 4F9VA 4UMLA 2DX6A 3FH4A 5ELYA 4OC2A 1DE4C 1OBRA 2ZOFA 5IB9A 1HDUA 6CPAA 4EWTA 1ELLP 1SPVA 3NA6A
chains in the Genus database with same CATH superfamily
4GS4A 3F5BA 3ZZIA 3SXNA 3TE4A 5CBMA 4NXYA 2AFZA 5GCNA 1GHEA 2AFSA 2EK8A 3TO6A 2CNMA 2CTCA 2EK9A 4M6HA 2EEEA 2ZPAA 2B4DA 1ARLA 3SIJA 3F8KA 3NE7A 4NFRA 4P4JA 2WYRA 3PRTA 3B8GA 2ZXVA 2AFUA 2WUUA 3CXPA 4PXDA 1Y0RA 2PVWA 2ACFA 2PJ3A 4MY0A 1TKJA 2ODFA 4ZBGA 3FEDA 2FL4A 4OC0A 4AVBA 4QBJA 1AUGA 1ZG7A 1Z9UA 4GM5A 4PK2A 3WT4A 4MHPA 3R9EA 1VHSA 2PIZA 4UBRA 4NEXA 4KSFA 5HVGA 2CIJA 4MJ8A 1IY7A 4Y49B 3EJFA 1QSTA 2POKA 1P0HA 3L2NA 3GPQA 2OB0A 3CZXA 4FD7A 2JEVA 5BWAB 3EWPA 1VHOA 2CXAA 2ZEPA 3P2FA 4TU0A 2I3CA 4PV6A 3FECA 3QAYA 2PRQA 5AG4A 4E0AA 3Q71A 4LQ6A 2QVPA 2HUZA 3CDXA 4CYQA 1MJ9A 5LRKA 1MK4A 2DEAA 4CPAA 1KZFA 5LYFA 2R1IA 4PPZA 2PJBA 2W2GA 2EBJA 3DR6A 2QYVA 4EMEA 5F48A 2J8MA 4MMOA 3FBUA 1BPMA 2Q4YA 5THWA 4PK3A 1M4IA 4UIAA 1KUYA 3S6KA 1TKHA 3Q6ZA 3K9UA 3I3GA 2FE7A 3D8PA 2BOAA 2ZEHA 2B4DB 3E0KA 3QB8A 4ZY0A 4H6ZA 4KOSA 3DLJA 4R8FA 5K8OA 2D4OA 2ZW6A 3EJGA 3R1KA 4KYBA 2PJ7A 3GY9A 3IIBA 1YVKA 2Y0MA 1ZR5A 1XIXA 4K30A 2Q44A 3R96A 2A4NA 2J9AA 3RYOA 4G1PA 4ETKA 1MJAA 4NCZA 2FXKA 4KOYA 4MHDA 5DWMA 4RUHA 2B5GB 4KOVA 1YLOA 4NJRA 2AJ6A 2Q43A 1YW4A 2VZZA 2AFOA 2OH1A 5I0CA 1H8LA 4U9ZA 1F2OA 2ZEEA 3B3WA 3EWOA 2FG1A 3B3CA 3N7ZA 3WC5A 1DTDA 1YW6A 1Q7LA 1VHEA 2P6FA 4PQAA 2QJ8A 5F09A 1VIXA 2FS5A 2Z11A 3IWEA 3G8WA 3DNSA 3P2HA 1LAPA 4CAFA 4C2ZA 5JQ4A 5JM6A 1ELMP 4BINA 4U9YA 4JYWA 4CGNA 4MXUA 1B87A 2EVNA 1YQEA 3DDDA 4YGOA 4A33A 4CYNA 1N71A 1HDQA 1PU9A 3D7GA 2ZEGA 4A95A 2AFXA 4I49A 4OIDA 2YNDA 3SJEA 1XRYA 2B3UA 1ZO0A 2ZEMA 4H2KA 4KS9A 3ZJ0A 3VARA 4X2TA 3KHZA 3SXOA 5IV0A 1RO5A 4A30A 1SQHA 2GANA 5J8FA 4B12A 4NGNA 1I1DA 1QSMA 4QUSA 3T8WA 4NF1A 2KCWA 3R95A 3UY5A 5K8MA 4DJLA 4ZX9A 2C1CA 2FSRA 2OZGA 5G22A 4EWTA 5F47A 2VEZA 2Z3NA 4KSAA 8CPAA 1FT7A 3CT9A 2JZFA 4PXBA 3TTHA 1IB1E 4J5RA 1PYTB 2X47A 5FVJA 3WR7A 3FX6A 1TXZA 2PJ4A 2PR8A 2QMLA 2NMTA 4Q36A 3KGQA 4KLWA 5HVHA 5CB3A 1S5KA 2CNTA 4HNWB 1ZLIA 2EUIA 1RXTA 4R9MA 4B5PA 1XJOA 4B6ZA 3NFZA 4A94A 4FUUA 4KVXA 2GLJA 4OC4A 5LRJA 5J8CA 3LWUA 4OP4A 1ZR3A 1FNOA 1CPXA 2R7HA 3IIDA 3LODA 3GB0A 3NH8A 4QC6A 1IGBA 5CNPA 2BFRA 2JBKA 1LANA 1BPNA 1FY7A 3B3SA 4ZGYB 3T90A 1Q2YA 4UIBA 4UF4A 5DUSA 4GVWA 4MCPA 5K8NA 4FAIA 1MJBA 1UWYA 2ZEDA 4ORFA 2Q4ZA 3ISZA 1YMEA 2PIYA 4B13A 4R76A 2BCOA 3B7IA 4XNHB 2ZW4A 4UEFA 1Z8XA 2OOTA 1TF9A 3I9SA 2WPXA 2FXFA 1XE4A 4P44A 5FSYA 4KOWA 4CAWA 3JTKA 2Z3MA 3H4QA 4KOTA 3BXMA 1NMTA 4Q38A 4B5PB 2BL1A 2EO8A 4CYOA 4P4IA 3S6GA 4JGKA 2PJ8A 4PXCA 1VKCA 3RNZA 4MFPA 2V8HA 5JPHA 4LX9A 2K5TA 3RAMA 2VZYA 3B3TA 3GYAA 3LMSA 3GIUA 3PEIA 1LAMA 3V7ZA 2X7BA 3FXTA 1F57A 2BO9A 2OR4A 1VHUA 2F7VA 2OZHA 4ONWA 3W91A 4OAEA 5D8NA 4OC5A 3CXSA 4X8IA 4FD4A 2Q4VA 4P4DA 2PJ5A 4CAVA 3PB6X 2WCTA 4R3KA 4IUSA 4E2AA 2BSWA 1VGYA 1Y0YA 4E8OA 2AFMA 4M6GA 5I4MA 2JBJA 3HLPA 2C27A 5EC4A 4DNCA 3KQXA 3H8GA 3BLNA 4MCSA 1I12A 1BAVA 2NSMA 2XEGA 1YD9A 1ARMA 2ZEOA 3KASA 4D86A 2FVGA 3KHXA 1P4NA 2AFWA 4YFJA 1CP7A 2CF4A 3SIHA 3VWEA 2RB7A 2Z3KA 2PJAA 1X10A 4UFWA 1V0CA 1CM0A 2ANPA 3IU1A 1M4LA 3TO9A 1RTQA 5HXDA 1XF8A 3C26A 1EE3P 3A9LA 4HNYB 3FF3A 4R3LA 4MHYA 1XEBA 4CGLA 3S9NA 4FD6A 2REEA 5C88A 2NYQA 2C6GA 4UCMA 3D67A 3W6SA 5FSXA 5KTCA 4NGQA 5FSUA 4JLLA 2VBQA 4UCNA 5KTAA 4JXQA 2JDDA 4RN7A 3D7HA 2R98A 4AB7A 4OMEA 4MRIA 2Z0ZA 1XOVA 4XPDC 4PXEA 1KUVA 2DF5A 3EW5A 4MI4A 4NGPA 2V77A 4CAEA 5H84A 3VFQA 4A39A 1LOKA 1U6MA 1I21A 4JJXA 4KUBA 1R3NA 4UA3A 2Z10A 5AILA 3BI0A 2ZW7A 3FMCA 2DPSA 2GFQA 3IIFA 1ZLHA 4M6IA 5LYIA 2V8VA 4ABLA 3BJ8A 4QB9A 4AVCA 3D7FA 3FEEA 1Z2LA 3D3SA 3PB7X 1ZG9A 5HOLA 3V45A 1L0CA 2Z3OA 2JLMA 3V2BA 2OU2A 3KI9A 4UCPA 2JZDA 4MBUA 5HMNA 2HV2A 5IX3A 5G1ZA 3RZAA 1S7FA 4RI1A 4EFDA 2QIRA 4MFQA 4II9A 4XPDB 2QECA 4FBEA 1Y7EA 2R8VA 2FT0A 3JVNA 4Q7AA 2Q7BA 3QAHA 2EWBA 4L89A 4PSWA 2O53A 4WWVA 4KVME 5H86A 4JCAA 3D7DA 1YX0A 5CMSA 4OIWA 4UWJA 4L8AA 5KTDA 1TKFA 1QSNA 3H5ZA 2XD7A 2IJZA 2ZW5A 1LFWA 4MCQA 3FVLA 3IWWA 5AG7A 3TT2A 2I00A 3EFAA 4ONUA 4F6AA 3TOBA 4WJBA 1A2ZA 3NE8A 1NSLA 4B11A 3IC1A 4CRYB 1AYEA 3IU2A 4KORA 3GQOA 3BI1A 4KOXA 2IQ6A 4MCRA 4NGTA 1S7NA 4U5YA 2XEFA 4OC1A 3PP9A 4HPSA 3EO4A 1PCAA 2JEWA 4JXRA 3JRUA 3GLJA 3WC7A 1UFHA 4P10A 3T9YA 4R7MA 2YNCA 4P4BA 4K0CA 3R9FA 3S6FA 5FSVA 7CPAA 2VL1A 1QMUA 1PUAA 2PRBA 4B10A 4J4ZA 2Z3PA 2C6CA 2GLFA 2PCUA 4OADA 2HB6A 5DWNA 1YK3A 2O4HA 2PR1A 3BHXA 2PC1A 4MFZA 3TC8A 5E96A 4ZY2A 1QQ9A 1WK4A 3TFYA 3SI0A 3HUVA 3GPGA 2ATRA 2ZENA 4GUAA 3DGVA 4ABKA 1K4JA 3SJFA 1Q2DA 4MFJA 2VRIA 1AMPA 5AGEA 4IAVA 2VQYA 1IOIA 1IIDA 2GIVA 3QNVA 1OZPA 4X3RA 1QSRA 1CJWA 3FIXA 3FYNA 3PB4X 3V38A 3D2PA 3IJ3A 4J5SA 5CB5A 2IL4A 1F2PA 4KZTA 4Z65A 4A2ZA 1IICA 2ABZA 4DUKA 3EY5A 2BEIA 3WC6A 4AG7A 4W9YA 1Q2CA 2B4BA 3D4UA 5JGFA 2F8HA 3CPAA 2O28A 5LYLA 5FSZA 1Z4RA 1KWMA 3D66A 4TNUA 2Q7SA 1M44A 4CS0B 1TXRA 3SHPA 1YR0A 2VXKA 1TF8A 4ESSA 1S7LA 3W6XA 5A27A 4J3GA 2LGRA 1S7KA 4UEZA 4XPLA 4FD5A 4JLYA 3EWQA 3KL9A 1YVOA 1CPSA 5HVFA 1GYTA 2G0BA 2JZEA 2PJ9A 3IGRA 4EVYA 2GREA 1CX8A 1YGHA 3PFEA 3KR4A 5G21A 3D2MA 1Y7RA 4F0XA 2FAVA 5F46A 1CP6A 3KKWA 1B6BA 1R43A 1Z5RA 3MGDA 4DYOA 3F0AA 4TWEA 3V8IA 4FWUA 2GU2A 3B3VA 4MFKA 2B58A 4MFLA 4MHZA 4UFXA 4CGMA 5K8PA 5IB0A 1Z8LA 2REFA 5D29A 4OKOA 4A31A 4M85A 3TO7A 4NSQA 4CGOA 3SIGA 1XBUA 2P6EA 3JUWA 4MHNA 4F0YA 4X5KA 2PJCA 4P4EA 2YNCC 2PSWA 4CRZB 1XMBA 4P6YA 4IF5A 1X12A 3IWGA 2G3AA 3FRMA 4GXHA 4MY3A 4A38A 2J8RA 4B5OA 3H8EA 1Z8TA 4ZX8A 5AG6A 2YNEA 5ISVA 3I1UA 2AFCA 2ZOGA 3FB3A 4NGMA 5LRGA 3SJGA 1QSOA 2FIWA 4R57A 2I79A 4ZI6A 2Q04A 1HEEA 2PE3A 4JD6A 4YWYA 2L8RA 4AXVA 3ETIA 3IFEA 1HJZA 4ETJA 3DR8A 3MRUA 4LUAA 3BJ7A 1KUXA 5JH9A 1XFOA 3K9TA 4LQGA 4KUAA 2AE6A 4XPKA 4CGPA 2IMOA 5F49A 3GPOA 2P6GA 5AG5A 1LRZA 1IYLA 4R6TA 4BD9A 1BLLE 4KSIA 5DS0A 3TCVA 2H5MA 1IOFA 3K2KA 5G20A 4IHMA 5A28A 3DSBA 2KQVA 1TIQA 1ZG8A 1CG2A 4NGRA 1WWZA 4HKFA 3S9LA 4P45A 1JQGA 2RNKA 3EWRA 2ZELA 3ISXA 3PGPA 1Y9WA 2Q0YA 4KOUA 3NH5A 3PB8X 4GVVA 1Z8WA 1XMTA 2G3TA 5HH1A 2YGWA 2DXQA 4Y49C 1NE9A 2CTBA 5J1QA 4C68A 3RO0A 4A37A 2PJ2A 3JZTA 1JWQA 3CXQA 3VH9A 2J8NA 4ZY1A 3PFOA 2PVVA 4IQYA 1BOBA 2V8GA 4KLVA 3EXNA 4B14A 2CY2A 1S60A 2G9DA 3SI2A 2GE3A 1LCPA 3TX8A 4JZ0A 4UEEA 3WABA 1CBXA 4RS2A 4J5QA 1Y9KA 3N5FA 4CAXA 3FNCA 3GUXA 2PQ8A 2HQYA 3SIIA 3KZWA 4JWPA 1IU8A 2ZEFA 2XEIA 4XNHC 2PJ0A 1YSJA 1NJRA 4IK2A 3S9MA 3EC4A 2BFQA 4P4FA 2V8DA 3TOAA 4AG9A 4PSXA 5C82A 3KR5A 4H89A 4NGSA 4CYPA 2FIAA 3D68A 2C6PA 2Q51A 4K3NA 2PJ6A 3CPXA 3PBEA 4UWIA 4C7IA 4AVAA 3H8FA 4QVTA 1YLEA 4UFVA 3VATA 2WSAA 2JDCA 2PJ1A 3PB9X 2BUEA 4YRHA 5EMIA 1M1DA 1TY8A 5EBVA 1R57A 3VWDA 2CNSA 4O23A 3B35A 2F5IA 5CPAA 4KVOE 3R9GA 3PBBA 2ARHA 2P0WA 3RBUA 4C7HA 2D4PA 2XEJA 3SI1A 4A32A 3MN8A 4OC3A 3KQZA 3LACA 4F9UA 2WZNA 3PZJA 2WPWA 1S3ZA 4R87A 3SJXA 1M4DA 5HIHA 3FJUA 3B2YA 3GQEA 2OZUA 2RFHA 3OWCA 3IO1A 3EKEA 2HC9A 4ZYQA 4NJQA 4YU9A 3NH4A 2PDOA 4F8ZA 1YREA 4HNXB 3LD2A 4M3SA 2VI7A 3IEHA 4JVVA 2B3VA 1NSAA 5E3BA 5LYDA 4F9VA 1ON0A 4C2YA 4UMLA 2FCKA 1IYKA 1J4JA 4BBHA 2DX6A 2DPTA 2Z3LA 3FH4A 1M4GA 4C2XA 2B5GA 2RC4A 5ELYA 1BO4A 4OC2A 1DE4C 1OBRA 2ZOFA 3G3SA 4BMHA 1Z4EA 5IB9A 1HDUA 4H6UA 6CPAA 3GKRA 3S6HA 1ELLP 1SPVA 3NA6A 4OLLA
chains in the Genus database with same CATH topology
5CBMA 2AFZA 2AFSA 2EK8A 2CTCA 2EK9A 2EEEA 1ARLA 3SIJA 4NFRA 4P4JA 2WYRA 3PRTA 2AFUA 4PXDA 1Y0RA 2PVWA 2ACFA 2PJ3A 1TKJA 3FEDA 4OC0A 1ZG7A 3WT4A 4GM5A 4MHPA 2PIZA 5HVGA 2CIJA 1IY7A 3EJFA 2POKA 3L2NA 3GPQA 3EWPA 1VHOA 2ZEPA 4TU0A 2I3CA 3FECA 2PRQA 3Q71A 2QVPA 3CDXA 5LRKA 2DEAA 4CPAA 5LYFA 4PPZA 2PJBA 2QYVA 4EMEA 4MMOA 1BPMA 5THWA 4UIAA 1TKHA 3Q6ZA 2BOAA 2ZEHA 4ZY0A 3DLJA 4R8FA 5K8OA 3EJGA 4KYBA 2PJ7A 3IIBA 1ZR5A 2J9AA 4G1PA 4ETKA 2FXKA 4RUHA 1YLOA 4NJRA 2Q43A 1YW4A 2AFOA 1H8LA 1F2OA 2ZEEA 3B3WA 3EWOA 3B3CA 2FG1A 3WC5A 1DTDA 1Q7LA 1VHEA 1YW6A 4PQAA 2QJ8A 5F09A 1VIXA 1LAPA 5JM6A 1ELMP 4JYWA 4MXUA 1HDQA 3D7GA 2ZEGA 2AFXA 4OIDA 3SJEA 1XRYA 2ZEMA 4H2KA 3VARA 4X2TA 3KHZA 4NGNA 3T8WA 5K8MA 4DJLA 4ZX9A 2C1CA 8CPAA 1FT7A 3CT9A 4PXBA 4J5RA 1PYTB 2X47A 3FX6A 1TXZA 2PJ4A 3KGQA 5HVHA 5CB3A 1ZLIA 4B6ZA 1XJOA 3NFZA 4A94A 4FUUA 2GLJA 4OC4A 5LRJA 3LWUA 4OP4A 1ZR3A 1FNOA 1CPXA 3IIDA 3NH8A 3GB0A 1IGBA 2BFRA 2JBKA 1LANA 1BPNA 3B3SA 4UIBA 4UF4A 5DUSA 4GVWA 4MCPA 5K8NA 4FAIA 1UWYA 2ZEDA 2Q4ZA 3ISZA 1YMEA 2PIYA 4R76A 2BCOA 3B7IA 4UEFA 2OOTA 1TF9A 4P44A 5FSYA 3BXMA 4P4IA 4JGKA 2PJ8A 4PXCA 2V8HA 3RAMA 3B3TA 3LMSA 3PEIA 1LAMA 3V7ZA 1F57A 2BO9A 2OR4A 1VHUA 2F7VA 4ONWA 5D8NA 4OC5A 4X8IA 4P4DA 2PJ5A 3PB6X 1VGYA 1Y0YA 2AFMA 5I4MA 2JBJA 3HLPA 3KQXA 3H8GA 4MCSA 2NSMA 2XEGA 2ZEOA 1BAVA 1YD9A 1ARMA 3KASA 4D86A 2FVGA 3KHXA 2AFWA 1CP7A 2CF4A 3SIHA 2RB7A 2PJAA 2ANPA 1M4LA 1RTQA 5HXDA 1EE3P 3FF3A 4MHYA 3S9NA 2NYQA 2C6GA 3D67A 5FSXA 4NGQA 5FSUA 4JLLA 3D7HA 4OMEA 4MRIA 4PXEA 4NGPA 3EW5A 2V77A 3VFQA 4A39A 1LOKA 1R3NA 5AILA 3BI0A 3FMCA 3IIFA 1ZLHA 5LYIA 2V8VA 4ABLA 3D7FA 3FEEA 1Z2LA 3PB7X 1ZG9A 5HOLA 3V45A 3V2BA 3KI9A 3RZAA 4FBEA 1Y7EA 4Q7AA 2EWBA 2O53A 4WWVA 4JCAA 3D7DA 4OIWA 5CMSA 1TKFA 2XD7A 2IJZA 1LFWA 4MCQA 3FVLA 3IWWA 4WJBA 3IC1A 1AYEA 3GQOA 3BI1A 2IQ6A 4MCRA 4NGTA 2XEFA 4OC1A 1PCAA 2JEWA 3JRUA 3GLJA 3WC7A 4P10A 4R7MA 4P4BA 4K0CA 5FSVA 7CPAA 2VL1A 1QMUA 4J4ZA 2C6CA 2GLFA 2PCUA 2HB6A 2O4HA 3BHXA 3TC8A 4ZY2A 1QQ9A 3SI0A 3HUVA 3GPGA 2ZENA 4GUAA 3DGVA 4ABKA 3SJFA 2VRIA 1AMPA 4IAVA 4X3RA 3QNVA 3PB4X 3V38A 3IJ3A 4J5SA 5CB5A 4Z65A 1F2PA 2ABZA 4DUKA 3WC6A 4W9YA 3D4UA 5JGFA 2F8HA 3CPAA 5LYLA 5FSZA 1KWMA 3D66A 4TNUA 1TXRA 1TF8A 4ESSA 2LGRA 4UEZA 3EWQA 3KL9A 1CPSA 5HVFA 1GYTA 2PJ9A 2GREA 1CX8A 3PFEA 3KR4A 2FAVA 1CP6A 1R43A 1Z5RA 4DYOA 4TWEA 4FWUA 2GU2A 3B3VA 4MHZA 5K8PA 1Z8LA 5D29A 4OKOA 3SIGA 1XBUA 4MHNA 2PJCA 4P4EA 1XMBA 4P6YA 4A38A 3H8EA 4ZX8A 3I1UA 2AFCA 2ZOGA 4NGMA 5LRGA 3SJGA 4ZI6A 1HEEA 2PE3A 4AXVA 4YWYA 2L8RA 3ETIA 3IFEA 1HJZA 4ETJA 3MRUA 5JH9A 1XFOA 3K9TA 4LQGA 2IMOA 3GPOA 4R6TA 4BD9A 1BLLE 4KSIA 5DS0A 3K2KA 4IHMA 1ZG8A 1CG2A 4NGRA 3S9LA 4P45A 1JQGA 3ISXA 3EWRA 2ZELA 3NH5A 3PB8X 4GVVA 2CTBA 5J1QA 4A37A 2PJ2A 3JZTA 3VH9A 4ZY1A 3PFOA 2PVVA 4IQYA 2V8GA 2G9DA 3SI2A 1LCPA 3TX8A 4JZ0A 4UEEA 3WABA 1CBXA 4EFDA 4J5QA 3N5FA 3GUXA 3SIIA 3KZWA 2ZEFA 2XEIA 2PJ0A 1YSJA 1NJRA 4IK2A 3S9MA 2BFQA 4P4FA 2V8DA 3KR5A 4NGSA 3D68A 2Q51A 2C6PA 4K3NA 2PJ6A 3CPXA 3PBEA 3H8FA 3VATA 3PB9X 2PJ1A 1TY8A 4O23A 3B35A 5CPAA 3PBBA 3RBUA 2XEJA 3SI1A 3MN8A 4OC3A 3KQZA 4F9UA 2WZNA 3SJXA 5HIHA 3FJUA 3B2YA 3GQEA 2RFHA 3IO1A 3EKEA 2HC9A 4ZYQA 4NJQA 4YU9A 3NH4A 4F8ZA 3IEHA 4JVVA 1NSAA 5E3BA 5LYDA 4F9VA 4UMLA 2DX6A 3FH4A 5ELYA 4OC2A 1DE4C 1OBRA 2ZOFA 5IB9A 1HDUA 6CPAA 4EWTA 1ELLP 1SPVA 3NA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBM A;  2AFZ A;  2AFS A;  2EK8 A;  2CTC A;  2EK9 A;  2EEE A;  1ARL A;  3SIJ A;  4NFR A;  4P4J A;  2WYR A;  3PRT A;  2AFU A;  4PXD A;  1Y0R A;  2PVW A;  2ACF A;  2PJ3 A;  1TKJ A;  3FED A;  4OC0 A;  1ZG7 A;  3WT4 A;  4GM5 A;  4MHP A;  2PIZ A;  5HVG A;  2CIJ A;  1IY7 A;  3EJF A;  2POK A;  3L2N A;  3GPQ A;  3EWP A;  1VHO A;  2ZEP A;  4TU0 A;  2I3C A;  3FEC A;  2PRQ A;  3Q71 A;  2QVP A;  3CDX A;  5LRK A;  2DEA A;  4CPA A;  5LYF A;  4PPZ A;  2PJB A;  2QYV A;  4EME A;  4MMO A;  1BPM A;  5THW A;  4UIA A;  1TKH A;  3Q6Z A;  2BOA A;  2ZEH A;  4ZY0 A;  3DLJ A;  4R8F A;  5K8O A;  3EJG A;  4KYB A;  2PJ7 A;  3IIB A;  1ZR5 A;  2J9A A;  4G1P A;  4ETK A;  2FXK A;  4RUH A;  1YLO A;  4NJR A;  2Q43 A;  1YW4 A;  2AFO A;  1H8L A;  1F2O A;  2ZEE A;  3B3W A;  3EWO A;  3B3C A;  2FG1 A;  3WC5 A;  1DTD A;  1Q7L A;  1VHE A;  1YW6 A;  4PQA A;  2QJ8 A;  5F09 A;  1VIX A;  1LAP A;  5JM6 A;  1ELM P;  4JYW A;  4MXU A;  1HDQ A;  3D7G A;  2ZEG A;  2AFX A;  4OID A;  3SJE A;  1XRY A;  2ZEM A;  4H2K A;  3VAR A;  4X2T A;  3KHZ A;  4NGN A;  3T8W A;  5K8M A;  4DJL A;  4ZX9 A;  2C1C A;  8CPA A;  1FT7 A;  3CT9 A;  4PXB A;  4J5R A;  1PYT B;  2X47 A;  3FX6 A;  1TXZ A;  2PJ4 A;  3KGQ A;  5HVH A;  5CB3 A;  1ZLI A;  4B6Z A;  1XJO A;  3NFZ A;  4A94 A;  4FUU A;  2GLJ A;  4OC4 A;  5LRJ A;  3LWU A;  4OP4 A;  1ZR3 A;  1FNO A;  1CPX A;  3IID A;  3NH8 A;  3GB0 A;  1IGB A;  2BFR A;  2JBK A;  1LAN A;  1BPN A;  3B3S A;  4UIB A;  4UF4 A;  5DUS A;  4GVW A;  4MCP A;  5K8N A;  4FAI A;  1UWY A;  2ZED A;  2Q4Z A;  3ISZ A;  1YME A;  2PIY A;  4R76 A;  2BCO A;  3B7I A;  4UEF A;  2OOT A;  1TF9 A;  4P44 A;  5FSY A;  3BXM A;  4P4I A;  4JGK A;  2PJ8 A;  4PXC A;  2V8H A;  3RAM A;  3B3T A;  3LMS A;  3PEI A;  1LAM A;  3V7Z A;  1F57 A;  2BO9 A;  2OR4 A;  1VHU A;  2F7V A;  4ONW A;  5D8N A;  4OC5 A;  4X8I A;  4P4D A;  2PJ5 A;  3PB6 X;  1VGY A;  1Y0Y A;  2AFM A;  5I4M A;  2JBJ A;  3HLP A;  3KQX A;  3H8G A;  4MCS A;  2NSM A;  2XEG A;  2ZEO A;  1BAV A;  1YD9 A;  1ARM A;  3KAS A;  4D86 A;  2FVG A;  3KHX A;  2AFW A;  1CP7 A;  2CF4 A;  3SIH A;  2RB7 A;  2PJA A;  2ANP A;  1M4L A;  1RTQ A;  5HXD A;  1EE3 P;  3FF3 A;  4MHY A;  3S9N A;  2NYQ A;  2C6G A;  3D67 A;  5FSX A;  4NGQ A;  5FSU A;  4JLL A;  3D7H A;  4OME A;  4MRI A;  4PXE A;  4NGP A;  3EW5 A;  2V77 A;  3VFQ A;  4A39 A;  1LOK A;  1R3N A;  5AIL A;  3BI0 A;  3FMC A;  3IIF A;  1ZLH A;  5LYI A;  2V8V A;  4ABL A;  3D7F A;  3FEE A;  1Z2L A;  3PB7 X;  1ZG9 A;  5HOL A;  3V45 A;  3V2B A;  3KI9 A;  3RZA A;  4FBE A;  1Y7E A;  4Q7A A;  2EWB A;  2O53 A;  4WWV A;  4JCA A;  3D7D A;  4OIW A;  5CMS A;  1TKF A;  2XD7 A;  2IJZ A;  1LFW A;  4MCQ A;  3FVL A;  3IWW A;  4WJB A;  3IC1 A;  1AYE A;  3GQO A;  3BI1 A;  2IQ6 A;  4MCR A;  4NGT A;  2XEF A;  4OC1 A;  1PCA A;  2JEW A;  3JRU A;  3GLJ A;  3WC7 A;  4P10 A;  4R7M A;  4P4B A;  4K0C A;  5FSV A;  7CPA A;  2VL1 A;  1QMU A;  4J4Z A;  2C6C A;  2GLF A;  2PCU A;  2HB6 A;  2O4H A;  3BHX A;  3TC8 A;  4ZY2 A;  1QQ9 A;  3SI0 A;  3HUV A;  3GPG A;  2ZEN A;  4GUA A;  3DGV A;  4ABK A;  3SJF A;  2VRI A;  1AMP A;  4IAV A;  4X3R A;  3QNV A;  3PB4 X;  3V38 A;  3IJ3 A;  4J5S A;  5CB5 A;  4Z65 A;  1F2P A;  2ABZ A;  4DUK A;  3WC6 A;  4W9Y A;  3D4U A;  5JGF A;  2F8H A;  3CPA A;  5LYL A;  5FSZ A;  1KWM A;  3D66 A;  4TNU A;  1TXR A;  1TF8 A;  4ESS A;  2LGR A;  4UEZ A;  3EWQ A;  3KL9 A;  1CPS A;  5HVF A;  1GYT A;  2PJ9 A;  2GRE A;  1CX8 A;  3PFE A;  3KR4 A;  2FAV A;  1CP6 A;  1R43 A;  1Z5R A;  4DYO A;  4TWE A;  4FWU A;  2GU2 A;  3B3V A;  4MHZ A;  5K8P A;  1Z8L A;  5D29 A;  4OKO A;  3SIG A;  1XBU A;  4MHN A;  2PJC A;  4P4E A;  1XMB A;  4P6Y A;  4A38 A;  3H8E A;  4ZX8 A;  3I1U A;  2AFC A;  2ZOG A;  4NGM A;  5LRG A;  3SJG A;  4ZI6 A;  1HEE A;  2PE3 A;  4AXV A;  4YWY A;  2L8R A;  3ETI A;  3IFE A;  1HJZ A;  4ETJ A;  3MRU A;  5JH9 A;  1XFO A;  3K9T A;  4LQG A;  2IMO A;  3GPO A;  4R6T A;  4BD9 A;  1BLL E;  4KSI A;  5DS0 A;  3K2K A;  4IHM A;  1ZG8 A;  1CG2 A;  4NGR A;  3S9L A;  4P45 A;  1JQG A;  3ISX A;  3EWR A;  2ZEL A;  3NH5 A;  3PB8 X;  4GVV A;  2CTB A;  5J1Q A;  4A37 A;  2PJ2 A;  3JZT A;  3VH9 A;  4ZY1 A;  3PFO A;  2PVV A;  4IQY A;  2V8G A;  2G9D A;  3SI2 A;  1LCP A;  3TX8 A;  4JZ0 A;  4UEE A;  3WAB A;  1CBX A;  4EFD A;  4J5Q A;  3N5F A;  3GUX A;  3SII A;  3KZW A;  2ZEF A;  2XEI A;  2PJ0 A;  1YSJ A;  1NJR A;  4IK2 A;  3S9M A;  2BFQ A;  4P4F A;  2V8D A;  3KR5 A;  4NGS A;  3D68 A;  2Q51 A;  2C6P A;  4K3N A;  2PJ6 A;  3CPX A;  3PBE A;  3H8F A;  3VAT A;  3PB9 X;  2PJ1 A;  1TY8 A;  4O23 A;  3B35 A;  5CPA A;  3PBB A;  3RBU A;  2XEJ A;  3SI1 A;  3MN8 A;  4OC3 A;  3KQZ A;  4F9U A;  2WZN A;  3SJX A;  5HIH A;  3FJU A;  3B2Y A;  3GQE A;  2RFH A;  3IO1 A;  3EKE A;  2HC9 A;  4ZYQ A;  4NJQ A;  4YU9 A;  3NH4 A;  4F8Z A;  3IEH A;  4JVV A;  1NSA A;  5E3B A;  5LYD A;  4F9V A;  4UML A;  2DX6 A;  3FH4 A;  5ELY A;  4OC2 A;  1DE4 C;  1OBR A;  2ZOF A;  5IB9 A;  1HDU A;  6CPA A;  4EWT A;  1ELL P;  1SPV A;  3NA6 A; 
#chains in the Genus database with same CATH topology
 4GS4 A;  3F5B A;  3ZZI A;  3SXN A;  3TE4 A;  5CBM A;  4NXY A;  2AFZ A;  5GCN A;  1GHE A;  2AFS A;  2EK8 A;  3TO6 A;  2CNM A;  2CTC A;  2EK9 A;  4M6H A;  2EEE A;  2ZPA A;  2B4D A;  1ARL A;  3SIJ A;  3F8K A;  3NE7 A;  4NFR A;  4P4J A;  2WYR A;  3PRT A;  3B8G A;  2ZXV A;  2AFU A;  2WUU A;  3CXP A;  4PXD A;  1Y0R A;  2PVW A;  2ACF A;  2PJ3 A;  4MY0 A;  1TKJ A;  2ODF A;  4ZBG A;  3FED A;  2FL4 A;  4OC0 A;  4AVB A;  4QBJ A;  1AUG A;  1ZG7 A;  1Z9U A;  4GM5 A;  4PK2 A;  3WT4 A;  4MHP A;  3R9E A;  1VHS A;  2PIZ A;  4UBR A;  4NEX A;  4KSF A;  5HVG A;  2CIJ A;  4MJ8 A;  1IY7 A;  4Y49 B;  3EJF A;  1QST A;  2POK A;  1P0H A;  3L2N A;  3GPQ A;  2OB0 A;  3CZX A;  4FD7 A;  2JEV A;  5BWA B;  3EWP A;  1VHO A;  2CXA A;  2ZEP A;  3P2F A;  4TU0 A;  2I3C A;  4PV6 A;  3FEC A;  3QAY A;  2PRQ A;  5AG4 A;  4E0A A;  3Q71 A;  4LQ6 A;  2QVP A;  2HUZ A;  3CDX A;  4CYQ A;  1MJ9 A;  5LRK A;  1MK4 A;  2DEA A;  4CPA A;  1KZF A;  5LYF A;  2R1I A;  4PPZ A;  2PJB A;  2W2G A;  2EBJ A;  3DR6 A;  2QYV A;  4EME A;  5F48 A;  2J8M A;  4MMO A;  3FBU A;  1BPM A;  2Q4Y A;  5THW A;  4PK3 A;  1M4I A;  4UIA A;  1KUY A;  3S6K A;  1TKH A;  3Q6Z A;  3K9U A;  3I3G A;  2FE7 A;  3D8P A;  2BOA A;  2ZEH A;  2B4D B;  3E0K A;  3QB8 A;  4ZY0 A;  4H6Z A;  4KOS A;  3DLJ A;  4R8F A;  5K8O A;  2D4O A;  2ZW6 A;  3EJG A;  3R1K A;  4KYB A;  2PJ7 A;  3GY9 A;  3IIB A;  1YVK A;  2Y0M A;  1ZR5 A;  1XIX A;  4K30 A;  2Q44 A;  3R96 A;  2A4N A;  2J9A A;  3RYO A;  4G1P A;  4ETK A;  1MJA A;  4NCZ A;  2FXK A;  4KOY A;  4MHD A;  5DWM A;  4RUH A;  2B5G B;  4KOV A;  1YLO A;  4NJR A;  2AJ6 A;  2Q43 A;  1YW4 A;  2VZZ A;  2AFO A;  2OH1 A;  5I0C A;  1H8L A;  4U9Z A;  1F2O A;  2ZEE A;  3B3W A;  3EWO A;  2FG1 A;  3B3C A;  3N7Z A;  3WC5 A;  1DTD A;  1YW6 A;  1Q7L A;  1VHE A;  2P6F A;  4PQA A;  2QJ8 A;  5F09 A;  1VIX A;  2FS5 A;  2Z11 A;  3IWE A;  3G8W A;  3DNS A;  3P2H A;  1LAP A;  4CAF A;  4C2Z A;  5JQ4 A;  5JM6 A;  1ELM P;  4BIN A;  4U9Y A;  4JYW A;  4CGN A;  4MXU A;  1B87 A;  2EVN A;  1YQE A;  3DDD A;  4YGO A;  4A33 A;  4CYN A;  1N71 A;  1HDQ A;  1PU9 A;  3D7G A;  2ZEG A;  4A95 A;  2AFX A;  4I49 A;  4OID A;  2YND A;  3SJE A;  1XRY A;  2B3U A;  1ZO0 A;  2ZEM A;  4H2K A;  4KS9 A;  3ZJ0 A;  3VAR A;  4X2T A;  3KHZ A;  3SXO A;  5IV0 A;  1RO5 A;  4A30 A;  1SQH A;  2GAN A;  5J8F A;  4B12 A;  4NGN A;  1I1D A;  1QSM A;  4QUS A;  3T8W A;  4NF1 A;  2KCW A;  3R95 A;  3UY5 A;  5K8M A;  4DJL A;  4ZX9 A;  2C1C A;  2FSR A;  2OZG A;  5G22 A;  4EWT A;  5F47 A;  2VEZ A;  2Z3N A;  4KSA A;  8CPA A;  1FT7 A;  3CT9 A;  2JZF A;  4PXB A;  3TTH A;  1IB1 E;  4J5R A;  1PYT B;  2X47 A;  5FVJ A;  3WR7 A;  3FX6 A;  1TXZ A;  2PJ4 A;  2PR8 A;  2QML A;  2NMT A;  4Q36 A;  3KGQ A;  4KLW A;  5HVH A;  5CB3 A;  1S5K A;  2CNT A;  4HNW B;  1ZLI A;  2EUI A;  1RXT A;  4R9M A;  4B5P A;  1XJO A;  4B6Z A;  3NFZ A;  4A94 A;  4FUU A;  4KVX A;  2GLJ A;  4OC4 A;  5LRJ A;  5J8C A;  3LWU A;  4OP4 A;  1ZR3 A;  1FNO A;  1CPX A;  2R7H A;  3IID A;  3LOD A;  3GB0 A;  3NH8 A;  4QC6 A;  1IGB A;  5CNP A;  2BFR A;  2JBK A;  1LAN A;  1BPN A;  1FY7 A;  3B3S A;  4ZGY B;  3T90 A;  1Q2Y A;  4UIB A;  4UF4 A;  5DUS A;  4GVW A;  4MCP A;  5K8N A;  4FAI A;  1MJB A;  1UWY A;  2ZED A;  4ORF A;  2Q4Z A;  3ISZ A;  1YME A;  2PIY A;  4B13 A;  4R76 A;  2BCO A;  3B7I A;  4XNH B;  2ZW4 A;  4UEF A;  1Z8X A;  2OOT A;  1TF9 A;  3I9S A;  2WPX A;  2FXF A;  1XE4 A;  4P44 A;  5FSY A;  4KOW A;  4CAW A;  3JTK A;  2Z3M A;  3H4Q A;  4KOT A;  3BXM A;  1NMT A;  4Q38 A;  4B5P B;  2BL1 A;  2EO8 A;  4CYO A;  4P4I A;  3S6G A;  4JGK A;  2PJ8 A;  4PXC A;  1VKC A;  3RNZ A;  4MFP A;  2V8H A;  5JPH A;  4LX9 A;  2K5T A;  3RAM A;  2VZY A;  3B3T A;  3GYA A;  3LMS A;  3GIU A;  3PEI A;  1LAM A;  3V7Z A;  2X7B A;  3FXT A;  1F57 A;  2BO9 A;  2OR4 A;  1VHU A;  2F7V A;  2OZH A;  4ONW A;  3W91 A;  4OAE A;  5D8N A;  4OC5 A;  3CXS A;  4X8I A;  4FD4 A;  2Q4V A;  4P4D A;  2PJ5 A;  4CAV A;  3PB6 X;  2WCT A;  4R3K A;  4IUS A;  4E2A A;  2BSW A;  1VGY A;  1Y0Y A;  4E8O A;  2AFM A;  4M6G A;  5I4M A;  2JBJ A;  3HLP A;  2C27 A;  5EC4 A;  4DNC A;  3KQX A;  3H8G A;  3BLN A;  4MCS A;  1I12 A;  1BAV A;  2NSM A;  2XEG A;  1YD9 A;  1ARM A;  2ZEO A;  3KAS A;  4D86 A;  2FVG A;  3KHX A;  1P4N A;  2AFW A;  4YFJ A;  1CP7 A;  2CF4 A;  3SIH A;  3VWE A;  2RB7 A;  2Z3K A;  2PJA A;  1X10 A;  4UFW A;  1V0C A;  1CM0 A;  2ANP A;  3IU1 A;  1M4L A;  3TO9 A;  1RTQ A;  5HXD A;  1XF8 A;  3C26 A;  1EE3 P;  3A9L A;  4HNY B;  3FF3 A;  4R3L A;  4MHY A;  1XEB A;  4CGL A;  3S9N A;  4FD6 A;  2REE A;  5C88 A;  2NYQ A;  2C6G A;  4UCM A;  3D67 A;  3W6S A;  5FSX A;  5KTC A;  4NGQ A;  5FSU A;  4JLL A;  2VBQ A;  4UCN A;  5KTA A;  4JXQ A;  2JDD A;  4RN7 A;  3D7H A;  2R98 A;  4AB7 A;  4OME A;  4MRI A;  2Z0Z A;  1XOV A;  4XPD C;  4PXE A;  1KUV A;  2DF5 A;  3EW5 A;  4MI4 A;  4NGP A;  2V77 A;  4CAE A;  5H84 A;  3VFQ A;  4A39 A;  1LOK A;  1U6M A;  1I21 A;  4JJX A;  4KUB A;  1R3N A;  4UA3 A;  2Z10 A;  5AIL A;  3BI0 A;  2ZW7 A;  3FMC A;  2DPS A;  2GFQ A;  3IIF A;  1ZLH A;  4M6I A;  5LYI A;  2V8V A;  4ABL A;  3BJ8 A;  4QB9 A;  4AVC A;  3D7F A;  3FEE A;  1Z2L A;  3D3S A;  3PB7 X;  1ZG9 A;  5HOL A;  3V45 A;  1L0C A;  2Z3O A;  2JLM A;  3V2B A;  2OU2 A;  3KI9 A;  4UCP A;  2JZD A;  4MBU A;  5HMN A;  2HV2 A;  5IX3 A;  5G1Z A;  3RZA A;  1S7F A;  4RI1 A;  4EFD A;  2QIR A;  4MFQ A;  4II9 A;  4XPD B;  2QEC A;  4FBE A;  1Y7E A;  2R8V A;  2FT0 A;  3JVN A;  4Q7A A;  2Q7B A;  3QAH A;  2EWB A;  4L89 A;  4PSW A;  2O53 A;  4WWV A;  4KVM E;  5H86 A;  4JCA A;  3D7D A;  1YX0 A;  5CMS A;  4OIW A;  4UWJ A;  4L8A A;  5KTD A;  1TKF A;  1QSN A;  3H5Z A;  2XD7 A;  2IJZ A;  2ZW5 A;  1LFW A;  4MCQ A;  3FVL A;  3IWW A;  5AG7 A;  3TT2 A;  2I00 A;  3EFA A;  4ONU A;  4F6A A;  3TOB A;  4WJB A;  1A2Z A;  3NE8 A;  1NSL A;  4B11 A;  3IC1 A;  4CRY B;  1AYE A;  3IU2 A;  4KOR A;  3GQO A;  3BI1 A;  4KOX A;  2IQ6 A;  4MCR A;  4NGT A;  1S7N A;  4U5Y A;  2XEF A;  4OC1 A;  3PP9 A;  4HPS A;  3EO4 A;  1PCA A;  2JEW A;  4JXR A;  3JRU A;  3GLJ A;  3WC7 A;  1UFH A;  4P10 A;  3T9Y A;  4R7M A;  2YNC A;  4P4B A;  4K0C A;  3R9F A;  3S6F A;  5FSV A;  7CPA A;  2VL1 A;  1QMU A;  1PUA A;  2PRB A;  4B10 A;  4J4Z A;  2Z3P A;  2C6C A;  2GLF A;  2PCU A;  4OAD A;  2HB6 A;  5DWN A;  1YK3 A;  2O4H A;  2PR1 A;  3BHX A;  2PC1 A;  4MFZ A;  3TC8 A;  5E96 A;  4ZY2 A;  1QQ9 A;  1WK4 A;  3TFY A;  3SI0 A;  3HUV A;  3GPG A;  2ATR A;  2ZEN A;  4GUA A;  3DGV A;  4ABK A;  1K4J A;  3SJF A;  1Q2D A;  4MFJ A;  2VRI A;  1AMP A;  5AGE A;  4IAV A;  2VQY A;  1IOI A;  1IID A;  2GIV A;  3QNV A;  1OZP A;  4X3R A;  1QSR A;  1CJW A;  3FIX A;  3FYN A;  3PB4 X;  3V38 A;  3D2P A;  3IJ3 A;  4J5S A;  5CB5 A;  2IL4 A;  1F2P A;  4KZT A;  4Z65 A;  4A2Z A;  1IIC A;  2ABZ A;  4DUK A;  3EY5 A;  2BEI A;  3WC6 A;  4AG7 A;  4W9Y A;  1Q2C A;  2B4B A;  3D4U A;  5JGF A;  2F8H A;  3CPA A;  2O28 A;  5LYL A;  5FSZ A;  1Z4R A;  1KWM A;  3D66 A;  4TNU A;  2Q7S A;  1M44 A;  4CS0 B;  1TXR A;  3SHP A;  1YR0 A;  2VXK A;  1TF8 A;  4ESS A;  1S7L A;  3W6X A;  5A27 A;  4J3G A;  2LGR A;  1S7K A;  4UEZ A;  4XPL A;  4FD5 A;  4JLY A;  3EWQ A;  3KL9 A;  1YVO A;  1CPS A;  5HVF A;  1GYT A;  2G0B A;  2JZE A;  2PJ9 A;  3IGR A;  4EVY A;  2GRE A;  1CX8 A;  1YGH A;  3PFE A;  3KR4 A;  5G21 A;  3D2M A;  1Y7R A;  4F0X A;  2FAV A;  5F46 A;  1CP6 A;  3KKW A;  1B6B A;  1R43 A;  1Z5R A;  3MGD A;  4DYO A;  3F0A A;  4TWE A;  3V8I A;  4FWU A;  2GU2 A;  3B3V A;  4MFK A;  2B58 A;  4MFL A;  4MHZ A;  4UFX A;  4CGM A;  5K8P A;  5IB0 A;  1Z8L A;  2REF A;  5D29 A;  4OKO A;  4A31 A;  4M85 A;  3TO7 A;  4NSQ A;  4CGO A;  3SIG A;  1XBU A;  2P6E A;  3JUW A;  4MHN A;  4F0Y A;  4X5K A;  2PJC A;  4P4E A;  2YNC C;  2PSW A;  4CRZ B;  1XMB A;  4P6Y A;  4IF5 A;  1X12 A;  3IWG A;  2G3A A;  3FRM A;  4GXH A;  4MY3 A;  4A38 A;  2J8R A;  4B5O A;  3H8E A;  1Z8T A;  4ZX8 A;  5AG6 A;  2YNE A;  5ISV A;  3I1U A;  2AFC A;  2ZOG A;  3FB3 A;  4NGM A;  5LRG A;  3SJG A;  1QSO A;  2FIW A;  4R57 A;  2I79 A;  4ZI6 A;  2Q04 A;  1HEE A;  2PE3 A;  4JD6 A;  4YWY A;  2L8R A;  4AXV A;  3ETI A;  3IFE A;  1HJZ A;  4ETJ A;  3DR8 A;  3MRU A;  4LUA A;  3BJ7 A;  1KUX A;  5JH9 A;  1XFO A;  3K9T A;  4LQG A;  4KUA A;  2AE6 A;  4XPK A;  4CGP A;  2IMO A;  5F49 A;  3GPO A;  2P6G A;  5AG5 A;  1LRZ A;  1IYL A;  4R6T A;  4BD9 A;  1BLL E;  4KSI A;  5DS0 A;  3TCV A;  2H5M A;  1IOF A;  3K2K A;  5G20 A;  4IHM A;  5A28 A;  3DSB A;  2KQV A;  1TIQ A;  1ZG8 A;  1CG2 A;  4NGR A;  1WWZ A;  4HKF A;  3S9L A;  4P45 A;  1JQG A;  2RNK A;  3EWR A;  2ZEL A;  3ISX A;  3PGP A;  1Y9W A;  2Q0Y A;  4KOU A;  3NH5 A;  3PB8 X;  4GVV A;  1Z8W A;  1XMT A;  2G3T A;  5HH1 A;  2YGW A;  2DXQ A;  4Y49 C;  1NE9 A;  2CTB A;  5J1Q A;  4C68 A;  3RO0 A;  4A37 A;  2PJ2 A;  3JZT A;  1JWQ A;  3CXQ A;  3VH9 A;  2J8N A;  4ZY1 A;  3PFO A;  2PVV A;  4IQY A;  1BOB A;  2V8G A;  4KLV A;  3EXN A;  4B14 A;  2CY2 A;  1S60 A;  2G9D A;  3SI2 A;  2GE3 A;  1LCP A;  3TX8 A;  4JZ0 A;  4UEE A;  3WAB A;  1CBX A;  4RS2 A;  4J5Q A;  1Y9K A;  3N5F A;  4CAX A;  3FNC A;  3GUX A;  2PQ8 A;  2HQY A;  3SII A;  3KZW A;  4JWP A;  1IU8 A;  2ZEF A;  2XEI A;  4XNH C;  2PJ0 A;  1YSJ A;  1NJR A;  4IK2 A;  3S9M A;  3EC4 A;  2BFQ A;  4P4F A;  2V8D A;  3TOA A;  4AG9 A;  4PSX A;  5C82 A;  3KR5 A;  4H89 A;  4NGS A;  4CYP A;  2FIA A;  3D68 A;  2C6P A;  2Q51 A;  4K3N A;  2PJ6 A;  3CPX A;  3PBE A;  4UWI A;  4C7I A;  4AVA A;  3H8F A;  4QVT A;  1YLE A;  4UFV A;  3VAT A;  2WSA A;  2JDC A;  2PJ1 A;  3PB9 X;  2BUE A;  4YRH A;  5EMI A;  1M1D A;  1TY8 A;  5EBV A;  1R57 A;  3VWD A;  2CNS A;  4O23 A;  3B35 A;  2F5I A;  5CPA A;  4KVO E;  3R9G A;  3PBB A;  2ARH A;  2P0W A;  3RBU A;  4C7H A;  2D4P A;  2XEJ A;  3SI1 A;  4A32 A;  3MN8 A;  4OC3 A;  3KQZ A;  3LAC A;  4F9U A;  2WZN A;  3PZJ A;  2WPW A;  1S3Z A;  4R87 A;  3SJX A;  1M4D A;  5HIH A;  3FJU A;  3B2Y A;  3GQE A;  2OZU A;  2RFH A;  3OWC A;  3IO1 A;  3EKE A;  2HC9 A;  4ZYQ A;  4NJQ A;  4YU9 A;  3NH4 A;  2PDO A;  4F8Z A;  1YRE A;  4HNX B;  3LD2 A;  4M3S A;  2VI7 A;  3IEH A;  4JVV A;  2B3V A;  1NSA A;  5E3B A;  5LYD A;  4F9V A;  1ON0 A;  4C2Y A;  4UML A;  2FCK A;  1IYK A;  1J4J A;  4BBH A;  2DX6 A;  2DPT A;  2Z3L A;  3FH4 A;  1M4G A;  4C2X A;  2B5G A;  2RC4 A;  5ELY A;  1BO4 A;  4OC2 A;  1DE4 C;  1OBR A;  2ZOF A;  3G3S A;  4BMH A;  1Z4E A;  5IB9 A;  1HDU A;  4H6U A;  6CPA A;  3GKR A;  3S6H A;  1ELL P;  1SPV A;  3NA6 A;  4OLL A; 
#chains in the Genus database with same CATH homology
 5CBM A;  2AFZ A;  2AFS A;  2EK8 A;  2CTC A;  2EK9 A;  2EEE A;  1ARL A;  3SIJ A;  4NFR A;  4P4J A;  2WYR A;  3PRT A;  2AFU A;  4PXD A;  1Y0R A;  2PVW A;  2ACF A;  2PJ3 A;  1TKJ A;  3FED A;  4OC0 A;  1ZG7 A;  3WT4 A;  4GM5 A;  4MHP A;  2PIZ A;  5HVG A;  2CIJ A;  1IY7 A;  3EJF A;  2POK A;  3L2N A;  3GPQ A;  3EWP A;  1VHO A;  2ZEP A;  4TU0 A;  2I3C A;  3FEC A;  2PRQ A;  3Q71 A;  2QVP A;  3CDX A;  5LRK A;  2DEA A;  4CPA A;  5LYF A;  4PPZ A;  2PJB A;  2QYV A;  4EME A;  4MMO A;  1BPM A;  5THW A;  4UIA A;  1TKH A;  3Q6Z A;  2BOA A;  2ZEH A;  4ZY0 A;  3DLJ A;  4R8F A;  5K8O A;  3EJG A;  4KYB A;  2PJ7 A;  3IIB A;  1ZR5 A;  2J9A A;  4G1P A;  4ETK A;  2FXK A;  4RUH A;  1YLO A;  4NJR A;  2Q43 A;  1YW4 A;  2AFO A;  1H8L A;  1F2O A;  2ZEE A;  3B3W A;  3EWO A;  3B3C A;  2FG1 A;  3WC5 A;  1DTD A;  1Q7L A;  1VHE A;  1YW6 A;  4PQA A;  2QJ8 A;  5F09 A;  1VIX A;  1LAP A;  5JM6 A;  1ELM P;  4JYW A;  4MXU A;  1HDQ A;  3D7G A;  2ZEG A;  2AFX A;  4OID A;  3SJE A;  1XRY A;  2ZEM A;  4H2K A;  3VAR A;  4X2T A;  3KHZ A;  4NGN A;  3T8W A;  5K8M A;  4DJL A;  4ZX9 A;  2C1C A;  8CPA A;  1FT7 A;  3CT9 A;  4PXB A;  4J5R A;  1PYT B;  2X47 A;  3FX6 A;  1TXZ A;  2PJ4 A;  3KGQ A;  5HVH A;  5CB3 A;  1ZLI A;  4B6Z A;  1XJO A;  3NFZ A;  4A94 A;  4FUU A;  2GLJ A;  4OC4 A;  5LRJ A;  3LWU A;  4OP4 A;  1ZR3 A;  1FNO A;  1CPX A;  3IID A;  3NH8 A;  3GB0 A;  1IGB A;  2BFR A;  2JBK A;  1LAN A;  1BPN A;  3B3S A;  4UIB A;  4UF4 A;  5DUS A;  4GVW A;  4MCP A;  5K8N A;  4FAI A;  1UWY A;  2ZED A;  2Q4Z A;  3ISZ A;  1YME A;  2PIY A;  4R76 A;  2BCO A;  3B7I A;  4UEF A;  2OOT A;  1TF9 A;  4P44 A;  5FSY A;  3BXM A;  4P4I A;  4JGK A;  2PJ8 A;  4PXC A;  2V8H A;  3RAM A;  3B3T A;  3LMS A;  3PEI A;  1LAM A;  3V7Z A;  1F57 A;  2BO9 A;  2OR4 A;  1VHU A;  2F7V A;  4ONW A;  5D8N A;  4OC5 A;  4X8I A;  4P4D A;  2PJ5 A;  3PB6 X;  1VGY A;  1Y0Y A;  2AFM A;  5I4M A;  2JBJ A;  3HLP A;  3KQX A;  3H8G A;  4MCS A;  2NSM A;  2XEG A;  2ZEO A;  1BAV A;  1YD9 A;  1ARM A;  3KAS A;  4D86 A;  2FVG A;  3KHX A;  2AFW A;  1CP7 A;  2CF4 A;  3SIH A;  2RB7 A;  2PJA A;  2ANP A;  1M4L A;  1RTQ A;  5HXD A;  1EE3 P;  3FF3 A;  4MHY A;  3S9N A;  2NYQ A;  2C6G A;  3D67 A;  5FSX A;  4NGQ A;  5FSU A;  4JLL A;  3D7H A;  4OME A;  4MRI A;  4PXE A;  4NGP A;  3EW5 A;  2V77 A;  3VFQ A;  4A39 A;  1LOK A;  1R3N A;  5AIL A;  3BI0 A;  3FMC A;  3IIF A;  1ZLH A;  5LYI A;  2V8V A;  4ABL A;  3D7F A;  3FEE A;  1Z2L A;  3PB7 X;  1ZG9 A;  5HOL A;  3V45 A;  3V2B A;  3KI9 A;  3RZA A;  4FBE A;  1Y7E A;  4Q7A A;  2EWB A;  2O53 A;  4WWV A;  4JCA A;  3D7D A;  4OIW A;  5CMS A;  1TKF A;  2XD7 A;  2IJZ A;  1LFW A;  4MCQ A;  3FVL A;  3IWW A;  4WJB A;  3IC1 A;  1AYE A;  3GQO A;  3BI1 A;  2IQ6 A;  4MCR A;  4NGT A;  2XEF A;  4OC1 A;  1PCA A;  2JEW A;  3JRU A;  3GLJ A;  3WC7 A;  4P10 A;  4R7M A;  4P4B A;  4K0C A;  5FSV A;  7CPA A;  2VL1 A;  1QMU A;  4J4Z A;  2C6C A;  2GLF A;  2PCU A;  2HB6 A;  2O4H A;  3BHX A;  3TC8 A;  4ZY2 A;  1QQ9 A;  3SI0 A;  3HUV A;  3GPG A;  2ZEN A;  4GUA A;  3DGV A;  4ABK A;  3SJF A;  2VRI A;  1AMP A;  4IAV A;  4X3R A;  3QNV A;  3PB4 X;  3V38 A;  3IJ3 A;  4J5S A;  5CB5 A;  4Z65 A;  1F2P A;  2ABZ A;  4DUK A;  3WC6 A;  4W9Y A;  3D4U A;  5JGF A;  2F8H A;  3CPA A;  5LYL A;  5FSZ A;  1KWM A;  3D66 A;  4TNU A;  1TXR A;  1TF8 A;  4ESS A;  2LGR A;  4UEZ A;  3EWQ A;  3KL9 A;  1CPS A;  5HVF A;  1GYT A;  2PJ9 A;  2GRE A;  1CX8 A;  3PFE A;  3KR4 A;  2FAV A;  1CP6 A;  1R43 A;  1Z5R A;  4DYO A;  4TWE A;  4FWU A;  2GU2 A;  3B3V A;  4MHZ A;  5K8P A;  1Z8L A;  5D29 A;  4OKO A;  3SIG A;  1XBU A;  4MHN A;  2PJC A;  4P4E A;  1XMB A;  4P6Y A;  4A38 A;  3H8E A;  4ZX8 A;  3I1U A;  2AFC A;  2ZOG A;  4NGM A;  5LRG A;  3SJG A;  4ZI6 A;  1HEE A;  2PE3 A;  4AXV A;  4YWY A;  2L8R A;  3ETI A;  3IFE A;  1HJZ A;  4ETJ A;  3MRU A;  5JH9 A;  1XFO A;  3K9T A;  4LQG A;  2IMO A;  3GPO A;  4R6T A;  4BD9 A;  1BLL E;  4KSI A;  5DS0 A;  3K2K A;  4IHM A;  1ZG8 A;  1CG2 A;  4NGR A;  3S9L A;  4P45 A;  1JQG A;  3ISX A;  3EWR A;  2ZEL A;  3NH5 A;  3PB8 X;  4GVV A;  2CTB A;  5J1Q A;  4A37 A;  2PJ2 A;  3JZT A;  3VH9 A;  4ZY1 A;  3PFO A;  2PVV A;  4IQY A;  2V8G A;  2G9D A;  3SI2 A;  1LCP A;  3TX8 A;  4JZ0 A;  4UEE A;  3WAB A;  1CBX A;  4EFD A;  4J5Q A;  3N5F A;  3GUX A;  3SII A;  3KZW A;  2ZEF A;  2XEI A;  2PJ0 A;  1YSJ A;  1NJR A;  4IK2 A;  3S9M A;  2BFQ A;  4P4F A;  2V8D A;  3KR5 A;  4NGS A;  3D68 A;  2Q51 A;  2C6P A;  4K3N A;  2PJ6 A;  3CPX A;  3PBE A;  3H8F A;  3VAT A;  3PB9 X;  2PJ1 A;  1TY8 A;  4O23 A;  3B35 A;  5CPA A;  3PBB A;  3RBU A;  2XEJ A;  3SI1 A;  3MN8 A;  4OC3 A;  3KQZ A;  4F9U A;  2WZN A;  3SJX A;  5HIH A;  3FJU A;  3B2Y A;  3GQE A;  2RFH A;  3IO1 A;  3EKE A;  2HC9 A;  4ZYQ A;  4NJQ A;  4YU9 A;  3NH4 A;  4F8Z A;  3IEH A;  4JVV A;  1NSA A;  5E3B A;  5LYD A;  4F9V A;  4UML A;  2DX6 A;  3FH4 A;  5ELY A;  4OC2 A;  1DE4 C;  1OBR A;  2ZOF A;  5IB9 A;  1HDU A;  6CPA A;  4EWT A;  1ELL P;  1SPV A;  3NA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...