4X2TA

X-ray crystal structure of the orally available aminopeptidase inhibitor, tosedostat, bound to the m17 leucyl aminopeptidase from p. falciparum
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
519
structure length
516
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title X-ray crystal structures of an orally available aminopeptidase inhibitor, Tosedostat, bound to anti-malarial drug targets PfA-M1 and PfA-M17.
pubmed doi rcsb
source organism Plasmodium falciparum (isolate 3d7)
molecule tags Hydrolase/hydrolase inhibitor
total genus 171
structure length 516
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4x2tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4x2tA02
2PJ3A 4MRIA 2V77A 1CX8A 3Q71A 2ZEMA 5K8OA 2L8RA 2FG1A 3EWOA 2FAVA 4BD9A 3MRUA 4OC5A 4PXCA 1BLLE 2QJ8A 4R7MA 3VFQA 2V8GA 1PYTB 2Q4ZA 1XMBA 5HOLA 2XEGA 4OC0A 1TKJA 4ONWA 2G9DA 3TC8A 4OC3A 3GPGA 3K2KA 3D4UA 4OP4A 1XJOA 3SJXA 2ZOGA 4J5QA 1SPVA 2CTBA 5CMSA 3DLJA 2ZOFA 2PJ5A 4ZY1A 1CG2A 1CPSA 4MHZA 2QYVA 3WC6A 2O53A 1TXRA 3I1UA 2ZEHA 2JBKA 1XFOA 4GVWA 5HVHA 2DX6A 4A38A 3SJEA 1BAVA 2AFUA 2PIYA 4FWUA 2C1CA 1ZLHA 3SIGA 4TWEA 3B2YA 2PJBA 5K8PA 3N5FA 4UMLA 3CT9A 4B6ZA 2BCOA 1XRYA 3D66A 2ZEEA 4UF4A 3VH9A 1Q7LA 4OKOA 4DUKA 3GQEA 3KL9A 3KQXA 4FAIA 4W9YA 2AFXA 3ISZA 3D7GA 1YSJA 3PRTA 1VHUA 3FVLA 3IIFA 4JCAA 1ZR5A 1H8LA 1Y0RA 2F8HA 4NGQA 4OC4A 4R6TA 2JBJA 1TKFA 3LMSA 3V38A 4IK2A 3FMCA 5DUSA 2PJ0A 1FT7A 1TKHA 4AXVA 3LWUA 3D7HA 4RUHA 1QQ9A 2PVWA 3WABA 3PB7X 5LYDA 4P6YA 3SIJA 4P4BA 4ETJA 4PPZA 4D86A 1YLOA 2LGRA 2PJCA 1OBRA 3RAMA 4MHPA 4F9UA 1VGYA 3FX6A 4P4FA 4EWTA 5HVFA 2QVPA 5AILA 2XEJA 2V8DA 4A94A 4MCPA 3WC5A 4DJLA 3PEIA 3IFEA 1DE4C 2C6PA 4NGSA 3PFEA 3V45A 1TF9A 4MMOA 3D7FA 2EWBA 4NGRA 1HDQA 1JQGA 6CPAA 4IQYA 4UIBA 4NGNA 1NJRA 1AYEA 4P4IA 4WWVA 3BXMA 3IJ3A 4OMEA 3SI2A 4K0CA 2ZEDA 4TNUA 4ZI6A 3B3WA 4ZYQA 4OC1A 4JLLA 1CP7A 3H8FA 3GLJA 5F09A 3EJGA 4YU9A 2ANPA 3DGVA 3EW5A 2OR4A 4YWYA 3ETIA 3IIDA 4FBEA 3QNVA 3L2NA 2BO9A 5ELYA 2ZEOA 2PRQA 1PCAA 2OOTA 3PB8X 5I4MA 3ISXA 2EK8A 4NJQA 2BFRA 4MCSA 2PIZA 2PJ2A 8CPAA 5HIHA 3BI1A 1F2OA 1HDUA 3V7ZA 4P10A 4WJBA 4UEZA 4ZY2A 3FEDA 2XEIA 3V2BA 4ESSA 2GLFA 5K8NA 2VRIA 1BPMA 3H8GA 2PCUA 5LYFA 3BHXA 3FEEA 4X8IA 1YD9A 1F57A 3KQZA 2PE3A 3HLPA 2ZEPA 3FF3A 5JGFA 4J5SA 3PB9X 4J5RA 4PXDA 3EWRA 4EFDA 4J4ZA 2PJ8A 2AFZA 2V8VA 3KHXA 1F2PA 5IB9A 3RZAA 5JH9A 4PXEA 2Q51A 4JVVA 3GB0A 2EK9A 3KGQA 1LAPA 5CB5A 1Z8LA 3B3TA 5LYIA 3GPOA 1GYTA 2ZEGA 3D67A 4FUUA 1XBUA 1VHEA 3B3SA 1TY8A 1TXZA 1YMEA 4CPAA 2IMOA 1FNOA 3K9TA 5DS0A 2ZENA 2CF4A 4JZ0A 1RTQA 5LRJA 3PFOA 2PJAA 3NH8A 3KASA 7CPAA 4R76A 2XEFA 5E3BA 4KYBA 3FECA 5THWA 2RB7A 1DTDA 3IO1A 4UEEA 4ZY0A 4PQAA 3KI9A 2AFCA 2BOAA 3JZTA 3FH4A 4R8FA 5HXDA 2CTCA 2GU2A 3NA6A 5FSVA 3MN8A 2Q43A 5D8NA 2PJ1A 4EMEA 2AFOA 1ZLIA 2PJ4A 3PBBA 4MHNA 1Y7EA 1HEEA 3B7IA 3S9NA 2AFSA 4H2KA 2BFQA 3KR5A 3PB4X 4GVVA 4X3RA 4IHMA 4OIWA 5D29A 4OIDA 3SIIA 3GUXA 3VARA 2JEWA 2AFMA 3SJFA 4P45A 2FXKA 2POKA 1IY7A 3SJGA 5CB3A 2I3CA 2RFHA 4Z65A 2PJ9A 3EKEA 4F8ZA 1KWMA 1ARMA 4MCRA 4P4EA 1Y0YA 2XD7A 4JGKA 5CPAA 1NSAA 1VHOA 1ELLP 3SIHA 2PJ6A 2X47A 4K3NA 3NH4A 5CBMA 4F9VA 3WC7A 3NFZA 3EWPA 1AMPA 4UIAA 3IC1A 1LCPA 2ZELA 3S9LA 4NGMA 3H8EA 4NGPA 2F7VA 3T8WA 1ZG8A 3EWQA 1Z5RA 1R43A 5FSYA 4ZX9A 2PJ7A 3Q6ZA 3S9MA 4ETKA 3KHZA 4ABKA 1ELMP 2ABZA 4LQGA 2ACFA 4GUAA 1IGBA 3JRUA 4P44A 3FJUA 4PXBA 2ZEFA 1HJZA 5FSXA 1CP6A 1VIXA 3B35A 4NJRA 1LAMA 2HB6A 3PBEA 5FSZA 4NFRA 4ZX8A 2DEAA 1YW6A 3B3VA 4KSIA 3CPAA 3EJFA 2O4HA 4NGTA 1YW4A 2AFWA 2IJZA 3PB6X 4Q7AA 3D68A 4MHYA 3IIBA 3HUVA 2IQ6A 4ABLA 1ZR3A 3VATA 1QMUA 3CDXA 1CBXA 4GM5A 1UWYA 2HC9A 4OC2A 4G1PA 1Z2LA 5LRGA 1LOKA 4A39A 3TX8A 3GQOA 3WT4A 1R3NA 2GREA 5LRKA 4MCQA 3SI1A 5FSUA 1LFWA 2C6CA 1BPNA 3D7DA 3CPXA 4X2TA 4UEFA 2PVVA 2NSMA 2FVGA 4P4DA 3BI0A 4JYWA 3NH5A 3GPQA 4A37A 5JM6A 4P4JA 2J9AA 1ZG7A 2NYQA 1CPXA 3SI0A 2CIJA 2C6GA 5J1QA 1M4LA 3RBUA 2GLJA 3KZWA 3IEHA 1LANA 3IWWA 5LYLA 2V8HA 5K8MA 2WYRA 4TU0A 2WZNA 1ARLA 3KR4A 4DYOA 1TF8A 1ZG9A 4IAVA 3B3CA 1EE3P 2VL1A 4O23A 5HVGA 4MXUA 2EEEA
chains in the Genus database with same CATH superfamily
2PJ3A 2Z10A 3JUWA 2VXKA 4MRIA 2V77A 1CX8A 3Q71A 4M3SA 2ZEMA 5K8OA 2L8RA 2FG1A 3EWOA 1L0CA 2IL4A 5G21A 3D8PA 2FAVA 2F5IA 4KVOE 4CGOA 1Q2CA 4BD9A 3MRUA 4OC5A 4PXCA 1BLLE 2QJ8A 4B10A 4R7MA 2OZHA 3VFQA 2JDDA 2V8GA 1PYTB 2Q4ZA 1XMBA 4PK2A 5DWNA 3ZZIA 5HOLA 2XEGA 3NE8A 2ZPAA 4OC0A 4OADA 1TKJA 2VBQA 3DNSA 4ONWA 2G9DA 4XPDC 4A31A 2I00A 4I49A 3TC8A 3TT2A 4OC3A 2ZW7A 4AVAA 1KUYA 2DPSA 3GPGA 3K2KA 3D4UA 1S60A 4L8AA 2P6EA 1XJOA 3C26A 4OP4A 3SJXA 2ZOGA 5AG4A 4UFVA 4MFJA 4J5QA 4BMHA 1SPVA 2GE3A 2Q0YA 2CTBA 2VEZA 3IU1A 5CMSA 2B4DA 3DLJA 2ZOFA 3G8WA 2PJ5A 4K30A 4ZY1A 1CG2A 1CPSA 4MFQA 4CGNA 4CGPA 2B3UA 4MHZA 2QYVA 4MBUA 2B4BA 2O53A 1TXRA 4XNHB 3WC6A 3I1UA 2WPXA 2ZEHA 4NF1A 4JXRA 2JBKA 2WUUA 1S7LA 4KVXA 4C2ZA 1XFOA 4H6ZA 1IIDA 4GVWA 3TO6A 3FB3A 4CAFA 4CGMA 1YVKA 4CS0B 5HVHA 2DX6A 1VHSA 1YVOA 2H5MA 1TIQA 3PGPA 4KOXA 4A38A 2FIAA 3SJEA 1BAVA 2R7HA 4C68A 2AFUA 4UWJA 2PIYA 3LACA 3W6SA 4KSAA 4FWUA 1A2ZA 1ON0A 1ZLHA 3SIGA 2C1CA 2JZEA 2I79A 3B2YA 2PJBA 4KOWA 4TWEA 3JTKA 3CZXA 5K8PA 3N5FA 3EC4A 3EFAA 5H86A 4UMLA 3GYAA 3GIUA 4R3LA 3CT9A 4B6ZA 2BCOA 1XRYA 2JZDA 1YGHA 2EO8A 1Y9WA 2PDOA 2ZEEA 3D66A 1PUAA 1Q7LA 4UF4A 2EVNA 2Z3LA 1WK4A 4OKOA 3SHPA 3WR7A 3GQEA 3KL9A 4DUKA 3KQXA 3TE4A 4CAWA 4FAIA 1Q2DA 5C88A 4W9YA 2AFXA 3ISZA 3D7GA 1YSJA 2Q44A 1LRZA 3PRTA 2ZXVA 3TO7A 1VHUA 4GXHA 3FVLA 3IIFA 2FT0A 4JCAA 1Z8TA 5IB0A 1ZR5A 1H8LA 1Y0RA 2F8HA 4RN7A 4NGQA 4XPDB 1RO5A 2VI7A 4A32A 4OC4A 4R6TA 2JBJA 4UFXA 1TKFA 3LMSA 3V38A 4IK2A 1VKCA 3FMCA 3R9FA 5DUSA 2PJ0A 3I3GA 1FT7A 1TKHA 2P6FA 4AXVA 1YLEA 2P6GA 5G22A 2YNEA 5C82A 3BJ8A 5CNPA 3LWUA 3D7HA 4RUHA 1QQ9A 1Z4EA 1YX0A 2PVWA 4FD7A 3WABA 3NE7A 1WWZA 4AG9A 1QSRA 3PB7X 5LYDA 4PSWA 4HKFA 3SIJA 3F0AA 4ETJA 4P6YA 4P4BA 2QIRA 2FXFA 4PPZA 3S6FA 4D86A 4KOYA 1YLOA 2LGRA 1JWQA 1Z9UA 2PJCA 1OBRA 1Z8XA 3RAMA 2HQYA 4J3GA 4MHPA 4YRHA 4F9UA 1VGYA 3FX6A 4P4FA 2W2GA 1Y7RA 2QVPA 5AILA 5HVFA 3A9LA 2XEJA 2V8DA 4EWTA 4A94A 2J8NA 2YGWA 4RI1A 4MCPA 3WC5A 4CAXA 4E0AA 4DJLA 4UWIA 3PEIA 3IFEA 1DE4C 2C6PA 2KQVA 3FRMA 4NGSA 1K4JA 3PFEA 4JJXA 3V45A 4M6GA 1PU9A 1TF9A 4MMOA 4KSFA 4PSXA 3D7FA 2EWBA 4NGRA 4F6AA 1HDQA 1JQGA 2Q4VA 4Q36A 6CPAA 2BEIA 2X7BA 4IQYA 2YNDA 1Q2YA 4FD5A 4UIBA 4B14A 2RC4A 4NGNA 2B5GB 1NJRA 1AYEA 3T9YA 4P4IA 1XIXA 2J8RA 4AG7A 3UY5A 4WWVA 2CY2A 3BXMA 3IJ3A 4OMEA 3SI2A 5KTCA 4KUAA 4LUAA 4K0CA 2ZEDA 4A33A 4TNUA 4ZI6A 4Y49C 3B3WA 4E2AA 4ZYQA 4C7HA 4OC1A 4JLLA 1CP7A 2BSWA 3H8FA 3GLJA 1YQEA 5FVJA 5F09A 3EJGA 1X10A 4QB9A 3TOBA 1M1DA 4KLVA 5AGEA 2ANPA 2P0WA 4YU9A 3DGVA 2ZW5A 3CXPA 3EW5A 2OR4A 1IYKA 4NCZA 4IF5A 2B3VA 2DPTA 1B87A 4YWYA 3ETIA 2HV2A 3IIDA 1I12A 2JDCA 2RNKA 3D3SA 4R87A 3QNVA 4FBEA 5BWAB 3L2NA 2BO9A 5ELYA 2AJ6A 1IOFA 2ZEOA 2PRQA 4CYNA 1PCAA 4CAVA 2Q7BA 1CJWA 1M4IA 2OOTA 3TCVA 3PB8X 5I4MA 3ISXA 2B4DB 2EK8A 4NJQA 2BFRA 4MCSA 2DF5A 2PIZA 4U9YA 3R9EA 2Z3NA 5F46A 2PJ2A 3S6HA 8CPAA 5HIHA 2VZYA 3BI1A 1KZFA 4KUBA 4JD6A 4DNCA 1MJAA 1U6MA 2R8VA 2K5TA 2GANA 1F2OA 3S6GA 3R1KA 1HDUA 3V7ZA 1Y9KA 4MFPA 1S7KA 4P10A 4UEZA 1XEBA 4JWPA 4WJBA 4ZY2A 5KTDA 3FEDA 2XEIA 3B8GA 1P0HA 4AB7A 3V2BA 4ESSA 1M4GA 1NMTA 2VRIA 2GLFA 5K8NA 2ZW4A 1BPMA 5EBVA 3H8GA 2PCUA 4M85A 3TO9A 3MGDA 4OLLA 5LYFA 3BHXA 3FEEA 4B11A 4RS2A 4X8IA 1YD9A 1F57A 3KQZA 1RXTA 2C27A 2PE3A 2Z3PA 3HLPA 2ZEPA 4ZGYB 3FF3A 5JGFA 4J5SA 1M4DA 4J5RA 3IWEA 3EWRA 3PB9X 4PXDA 3LODA 4J4ZA 4HNYB 4CYPA 1MJBA 2PJ8A 4EFDA 2AFZA 2V8VA 3KHXA 1F2PA 5IB9A 4KOSA 4R9MA 4Y49B 4U9ZA 4KZTA 3RZAA 1S7NA 2A4NA 4FD4A 4II9A 5JH9A 3T90A 1KUVA 3FYNA 4PXEA 3H5ZA 2Q51A 3F5BA 2QECA 3GKRA 4JVVA 1ZO0A 2ATRA 4M6HA 5HMNA 3H4QA 3GB0A 4FD6A 2EK9A 3KGQA 1IICA 1LAPA 5CB5A 1Z8LA 1V0CA 2ZW6A 5A28A 5E96A 3B3TA 3W6XA 3D2MA 5LYIA 5I0CA 2Z3MA 1XOVA 3GPOA 3SXOA 2Q4YA 3RNZA 1GYTA 2CNMA 4A95A 2ZEGA 1FY7A 3D67A 3K9UA 2PR8A 4FUUA 1XBUA 1VHEA 3B3SA 1TY8A 1TXZA 4ONUA 1XF8A 1YMEA 4UBRA 4CPAA 2IMOA 1FNOA 4Q38A 3K9TA 2PRBA 4YFJA 5DS0A 4CYOA 2ZENA 2ODFA 2CF4A 2Y0MA 3N7ZA 4JZ0A 1RTQA 1N71A 2G3AA 4MY0A 5LRJA 3PFOA 2PJAA 3NH8A 4CRZB 3KASA 7CPAA 4R76A 5HH1A 2XEFA 5E3BA 1QSOA 4UCPA 5EMIA 3R95A 4KYBA 3FECA 1AUGA 5H84A 5THWA 2RB7A 1DTDA 3TOAA 3IO1A 5JQ4A 2CNSA 2PQ8A 4UEEA 3RYOA 1XMTA 4ZY0A 4PQAA 3R96A 3KI9A 2AFCA 4KS9A 4MHDA 4PK3A 4QVTA 5F47A 4C2YA 2BOAA 3JZTA 3FH4A 4R8FA 5HXDA 1IB1E 2CTCA 3QAHA 2WSAA 1IU8A 2JZFA 2GU2A 1UFHA 5FSVA 3NA6A 3MN8A 2Q43A 5D8NA 4U5YA 2WCTA 2PJ1A 1P4NA 4EMEA 2WPWA 2AFOA 1ZLIA 2PJ4A 3PBBA 2FS5A 4BBHA 1R57A 4MHNA 5CPAA 5G1ZA 1Y7EA 1HEEA 3B7IA 3S9NA 1NSLA 5EC4A 2AFSA 4H2KA 2QMLA 2BFQA 4A30A 3KR5A 3PB4X 4GVVA 4X3RA 3LD2A 4IHMA 2G3TA 3P2FA 3S6KA 4OIWA 3VWEA 3D2PA 5D29A 4OIDA 3SIIA 3GUXA 2FL4A 5DWMA 3R9GA 3VARA 2JEWA 2AFMA 3G3SA 3SJFA 1Z8WA 4UCMA 4P45A 2FXKA 3CXQA 5JPHA 3PP9A 2POKA 1IY7A 4KORA 4JXQA 3SJGA 5CB3A 2I3CA 2RFHA 2VZZA 4NEXA 4B13A 2R98A 4KLWA 3GY9A 4Z65A 2PJ9A 3EKEA 4QBJA 4F8ZA 1KWMA 1M44A 1QSMA 4LQ6A 4CAEA 5A27A 1ARMA 4C7IA 4MCRA 4P4EA 5AG6A 3VWDA 1Y0YA 2XD7A 4JGKA 2Z3OA 4H89A 1NSAA 1VHOA 1ELLP 2AE6A 1XE4A 1J4JA 5AG7A 1S3ZA 4A2ZA 3SIHA 4NXYA 2PJ6A 2X47A 1KUXA 3OWCA 3P2HA 4K3NA 4MFZA 2PR1A 5CBMA 3NH4A 4F9VA 3WC7A 3NFZA 3EWPA 1AMPA 3SXNA 4UIAA 3BLNA 3IC1A 3W91A 1LCPA 2ZELA 4CRYB 3S9LA 1SQHA 4CYQA 3IWGA 4NGMA 2EUIA 3H8EA 4MFLA 4NGPA 2F7VA 3T8WA 1ZG8A 3EWQA 1Z5RA 2FCKA 4GS4A 4LX9A 1R43A 4JLYA 5KTAA 1YR0A 5FSYA 4ZX9A 2PJ7A 5IV0A 4MFKA 3ZJ0A 3Q6ZA 2KCWA 4HNWB 1I21A 4R3KA 3S9MA 3RO0A 4ETKA 5AG5A 3KHZA 4ABKA 1ELMP 3FXTA 4AVCA 2ABZA 4LQGA 2ACFA 1IOIA 2JLMA 2FIWA 4F0YA 4GUAA 1IGBA 2B58A 2OZGA 3JRUA 2OU2A 4IUSA 1S7FA 4P44A 3FJUA 4PXBA 2ZEFA 1HJZA 5FSXA 1CP6A 1VIXA 3B35A 4NJRA 4BINA 5IX3A 2ARHA 4KVME 1LAMA 2HB6A 3PBEA 5FSZA 4NFRA 3F8KA 4ZX8A 2DEAA 1YW6A 3B3VA 4KSIA 4M6IA 4MI4A 4NSQA 3CPAA 3EJFA 4XPKA 5G20A 1X12A 2O4HA 1QSTA 2PC1A 1YW4A 2AFWA 2YNCA 3I9SA 4NGTA 2IJZA 3PB6X 2VQYA 4Q7AA 3BJ7A 5J8CA 3D68A 2CNTA 4CGLA 3VH9A 4MHYA 4MY3A 4HPSA 2R1IA 4X5KA 3IIBA 4B5PA 3HUVA 2D4OA 2IQ6A 4ABLA 1ZR3A 2Z3KA 4YGOA 3VATA 1QMUA 1MK4A 3DSBA 3V8IA 3CDXA 4UFWA 4B5PB 1CBXA 1Z4RA 3PZJA 1QSNA 4MJ8A 2O28A 3EO4A 5ISVA 4GM5A 1UWYA 2OB0A 2HC9A 4OC2A 4AVBA 3FNCA 4G1PA 1Z2LA 5GCNA 2JEVA 1LOKA 5LRGA 4A39A 2REFA 3E0KA 3TX8A 2EBJA 3KKWA 1IYLA 4R57A 1BO4A 3IGRA 3GQOA 5J8FA 4ORFA 1OZPA 3DDDA 3WT4A 1BOBA 1R3NA 2GREA 5LRKA 4MCQA 3SI1A 4KOUA 1YK3A 5FSUA 2REEA 1LFWA 2C6CA 2PSWA 1BPNA 2Q04A 3DR6A 4ZBGA 5F49A 4UA3A 3D7DA 3IU2A 4PV6A 3CPXA 4X2TA 5F48A 1B6BA 4UEFA 1NE9A 4XPLA 2PVVA 4KOTA 4QC6A 2NSMA 4L89A 2FVGA 2DXQA 4P4DA 3BI0A 2FSRA 4B12A 4C2XA 4JYWA 3NH5A 2Q7SA 4B5OA 2Z0ZA 2CXAA 3GPQA 2G0BA 4A37A 3FBUA 5JM6A 2HUZA 3JVNA 2D4PA 4P4JA 4EVYA 2J9AA 1ZG7A 2NYQA 2OZUA 3QB8A 1CPXA 3SI0A 2J8MA 2CIJA 1CM0A 4XNHC 1YREA 3DR8A 3TTHA 4HNXB 2C6GA 4F0XA 3TFYA 5J1QA 3FIXA 1M4LA 1MJ9A 3RBUA 2NMTA 2GLJA 3EXNA 4OAEA 2GFQA 4H6UA 3KZWA 3IEHA 1LANA 3IWWA 2BL1A 1GHEA 4QUSA 4UCNA 3QAYA 5LYLA 2V8HA 5K8MA 2WYRA 4TU0A 4E8OA 1S5KA 1ARLA 2WZNA 2OH1A 3KR4A 1I1DA 2FE7A 4KOVA 2B5GA 4DYOA 1TF8A 1ZG9A 4IAVA 3B3CA 3CXSA 1EE3P 2VL1A 4O23A 2GIVA 5HVGA 3EY5A 2YNCC 2BUEA 4MXUA 2EEEA 2Z11A
chains in the Genus database with same CATH topology
2PJ3A 4MRIA 2V77A 1CX8A 3Q71A 2ZEMA 5K8OA 2L8RA 2FG1A 3EWOA 2FAVA 4BD9A 3MRUA 4OC5A 4PXCA 1BLLE 2QJ8A 4R7MA 3VFQA 2V8GA 1PYTB 2Q4ZA 1XMBA 5HOLA 2XEGA 4OC0A 1TKJA 4ONWA 2G9DA 3TC8A 4OC3A 3GPGA 3K2KA 3D4UA 4OP4A 1XJOA 3SJXA 2ZOGA 4J5QA 1SPVA 2CTBA 5CMSA 3DLJA 2ZOFA 2PJ5A 4ZY1A 1CG2A 1CPSA 4MHZA 2QYVA 3WC6A 2O53A 1TXRA 3I1UA 2ZEHA 2JBKA 1XFOA 4GVWA 5HVHA 2DX6A 4A38A 3SJEA 1BAVA 2AFUA 2PIYA 4FWUA 2C1CA 1ZLHA 3SIGA 4TWEA 3B2YA 2PJBA 5K8PA 3N5FA 4UMLA 3CT9A 4B6ZA 2BCOA 1XRYA 3D66A 2ZEEA 4UF4A 3VH9A 1Q7LA 4OKOA 4DUKA 3GQEA 3KL9A 3KQXA 4FAIA 4W9YA 2AFXA 3ISZA 3D7GA 1YSJA 3PRTA 1VHUA 3FVLA 3IIFA 4JCAA 1ZR5A 1H8LA 1Y0RA 2F8HA 4NGQA 4OC4A 4R6TA 2JBJA 1TKFA 3LMSA 3V38A 4IK2A 3FMCA 5DUSA 2PJ0A 1FT7A 1TKHA 4AXVA 3LWUA 3D7HA 4RUHA 1QQ9A 2PVWA 3WABA 3PB7X 5LYDA 4P6YA 3SIJA 4P4BA 4ETJA 4PPZA 4D86A 1YLOA 2LGRA 2PJCA 1OBRA 3RAMA 4MHPA 4F9UA 1VGYA 3FX6A 4P4FA 4EWTA 5HVFA 2QVPA 5AILA 2XEJA 2V8DA 4A94A 4MCPA 3WC5A 4DJLA 3PEIA 3IFEA 1DE4C 2C6PA 4NGSA 3PFEA 3V45A 1TF9A 4MMOA 3D7FA 2EWBA 4NGRA 1HDQA 1JQGA 6CPAA 4IQYA 4UIBA 4NGNA 1NJRA 1AYEA 4P4IA 4WWVA 3BXMA 3IJ3A 4OMEA 3SI2A 4K0CA 2ZEDA 4TNUA 4ZI6A 3B3WA 4ZYQA 4OC1A 4JLLA 1CP7A 3H8FA 3GLJA 5F09A 3EJGA 4YU9A 2ANPA 3DGVA 3EW5A 2OR4A 4YWYA 3ETIA 3IIDA 4FBEA 3QNVA 3L2NA 2BO9A 5ELYA 2ZEOA 2PRQA 1PCAA 2OOTA 3PB8X 5I4MA 3ISXA 2EK8A 4NJQA 2BFRA 4MCSA 2PIZA 2PJ2A 8CPAA 5HIHA 3BI1A 1F2OA 1HDUA 3V7ZA 4P10A 4WJBA 4UEZA 4ZY2A 3FEDA 2XEIA 3V2BA 4ESSA 2GLFA 5K8NA 2VRIA 1BPMA 3H8GA 2PCUA 5LYFA 3BHXA 3FEEA 4X8IA 1YD9A 1F57A 3KQZA 2PE3A 3HLPA 2ZEPA 3FF3A 5JGFA 4J5SA 3PB9X 4J5RA 4PXDA 3EWRA 4EFDA 4J4ZA 2PJ8A 2AFZA 2V8VA 3KHXA 1F2PA 5IB9A 3RZAA 5JH9A 4PXEA 2Q51A 4JVVA 3GB0A 2EK9A 3KGQA 1LAPA 5CB5A 1Z8LA 3B3TA 5LYIA 3GPOA 1GYTA 2ZEGA 3D67A 4FUUA 1XBUA 1VHEA 3B3SA 1TY8A 1TXZA 1YMEA 4CPAA 2IMOA 1FNOA 3K9TA 5DS0A 2ZENA 2CF4A 4JZ0A 1RTQA 5LRJA 3PFOA 2PJAA 3NH8A 3KASA 7CPAA 4R76A 2XEFA 5E3BA 4KYBA 3FECA 5THWA 2RB7A 1DTDA 3IO1A 4UEEA 4ZY0A 4PQAA 3KI9A 2AFCA 2BOAA 3JZTA 3FH4A 4R8FA 5HXDA 2CTCA 2GU2A 3NA6A 5FSVA 3MN8A 2Q43A 5D8NA 2PJ1A 4EMEA 2AFOA 1ZLIA 2PJ4A 3PBBA 4MHNA 1Y7EA 1HEEA 3B7IA 3S9NA 2AFSA 4H2KA 2BFQA 3KR5A 3PB4X 4GVVA 4X3RA 4IHMA 4OIWA 5D29A 4OIDA 3SIIA 3GUXA 3VARA 2JEWA 2AFMA 3SJFA 4P45A 2FXKA 2POKA 1IY7A 3SJGA 5CB3A 2I3CA 2RFHA 4Z65A 2PJ9A 3EKEA 4F8ZA 1KWMA 1ARMA 4MCRA 4P4EA 1Y0YA 2XD7A 4JGKA 5CPAA 1NSAA 1VHOA 1ELLP 3SIHA 2PJ6A 2X47A 4K3NA 3NH4A 5CBMA 4F9VA 3WC7A 3NFZA 3EWPA 1AMPA 4UIAA 3IC1A 1LCPA 2ZELA 3S9LA 4NGMA 3H8EA 4NGPA 2F7VA 3T8WA 1ZG8A 3EWQA 1Z5RA 1R43A 5FSYA 4ZX9A 2PJ7A 3Q6ZA 3S9MA 4ETKA 3KHZA 4ABKA 1ELMP 2ABZA 4LQGA 2ACFA 4GUAA 1IGBA 3JRUA 4P44A 3FJUA 4PXBA 2ZEFA 1HJZA 5FSXA 1CP6A 1VIXA 3B35A 4NJRA 1LAMA 2HB6A 3PBEA 5FSZA 4NFRA 4ZX8A 2DEAA 1YW6A 3B3VA 4KSIA 3CPAA 3EJFA 2O4HA 4NGTA 1YW4A 2AFWA 2IJZA 3PB6X 4Q7AA 3D68A 4MHYA 3IIBA 3HUVA 2IQ6A 4ABLA 1ZR3A 3VATA 1QMUA 3CDXA 1CBXA 4GM5A 1UWYA 2HC9A 4OC2A 4G1PA 1Z2LA 5LRGA 1LOKA 4A39A 3TX8A 3GQOA 3WT4A 1R3NA 2GREA 5LRKA 4MCQA 3SI1A 5FSUA 1LFWA 2C6CA 1BPNA 3D7DA 3CPXA 4X2TA 4UEFA 2PVVA 2NSMA 2FVGA 4P4DA 3BI0A 4JYWA 3NH5A 3GPQA 4A37A 5JM6A 4P4JA 2J9AA 1ZG7A 2NYQA 1CPXA 3SI0A 2CIJA 2C6GA 5J1QA 1M4LA 3RBUA 2GLJA 3KZWA 3IEHA 1LANA 3IWWA 5LYLA 2V8HA 5K8MA 2WYRA 4TU0A 2WZNA 1ARLA 3KR4A 4DYOA 1TF8A 1ZG9A 4IAVA 3B3CA 1EE3P 2VL1A 4O23A 5HVGA 4MXUA 2EEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ3 A;  4MRI A;  2V77 A;  1CX8 A;  3Q71 A;  2ZEM A;  5K8O A;  2L8R A;  2FG1 A;  3EWO A;  2FAV A;  4BD9 A;  3MRU A;  4OC5 A;  4PXC A;  1BLL E;  2QJ8 A;  4R7M A;  3VFQ A;  2V8G A;  1PYT B;  2Q4Z A;  1XMB A;  5HOL A;  2XEG A;  4OC0 A;  1TKJ A;  4ONW A;  2G9D A;  3TC8 A;  4OC3 A;  3GPG A;  3K2K A;  3D4U A;  4OP4 A;  1XJO A;  3SJX A;  2ZOG A;  4J5Q A;  1SPV A;  2CTB A;  5CMS A;  3DLJ A;  2ZOF A;  2PJ5 A;  4ZY1 A;  1CG2 A;  1CPS A;  4MHZ A;  2QYV A;  3WC6 A;  2O53 A;  1TXR A;  3I1U A;  2ZEH A;  2JBK A;  1XFO A;  4GVW A;  5HVH A;  2DX6 A;  4A38 A;  3SJE A;  1BAV A;  2AFU A;  2PIY A;  4FWU A;  2C1C A;  1ZLH A;  3SIG A;  4TWE A;  3B2Y A;  2PJB A;  5K8P A;  3N5F A;  4UML A;  3CT9 A;  4B6Z A;  2BCO A;  1XRY A;  3D66 A;  2ZEE A;  4UF4 A;  3VH9 A;  1Q7L A;  4OKO A;  4DUK A;  3GQE A;  3KL9 A;  3KQX A;  4FAI A;  4W9Y A;  2AFX A;  3ISZ A;  3D7G A;  1YSJ A;  3PRT A;  1VHU A;  3FVL A;  3IIF A;  4JCA A;  1ZR5 A;  1H8L A;  1Y0R A;  2F8H A;  4NGQ A;  4OC4 A;  4R6T A;  2JBJ A;  1TKF A;  3LMS A;  3V38 A;  4IK2 A;  3FMC A;  5DUS A;  2PJ0 A;  1FT7 A;  1TKH A;  4AXV A;  3LWU A;  3D7H A;  4RUH A;  1QQ9 A;  2PVW A;  3WAB A;  3PB7 X;  5LYD A;  4P6Y A;  3SIJ A;  4P4B A;  4ETJ A;  4PPZ A;  4D86 A;  1YLO A;  2LGR A;  2PJC A;  1OBR A;  3RAM A;  4MHP A;  4F9U A;  1VGY A;  3FX6 A;  4P4F A;  4EWT A;  5HVF A;  2QVP A;  5AIL A;  2XEJ A;  2V8D A;  4A94 A;  4MCP A;  3WC5 A;  4DJL A;  3PEI A;  3IFE A;  1DE4 C;  2C6P A;  4NGS A;  3PFE A;  3V45 A;  1TF9 A;  4MMO A;  3D7F A;  2EWB A;  4NGR A;  1HDQ A;  1JQG A;  6CPA A;  4IQY A;  4UIB A;  4NGN A;  1NJR A;  1AYE A;  4P4I A;  4WWV A;  3BXM A;  3IJ3 A;  4OME A;  3SI2 A;  4K0C A;  2ZED A;  4TNU A;  4ZI6 A;  3B3W A;  4ZYQ A;  4OC1 A;  4JLL A;  1CP7 A;  3H8F A;  3GLJ A;  5F09 A;  3EJG A;  4YU9 A;  2ANP A;  3DGV A;  3EW5 A;  2OR4 A;  4YWY A;  3ETI A;  3IID A;  4FBE A;  3QNV A;  3L2N A;  2BO9 A;  5ELY A;  2ZEO A;  2PRQ A;  1PCA A;  2OOT A;  3PB8 X;  5I4M A;  3ISX A;  2EK8 A;  4NJQ A;  2BFR A;  4MCS A;  2PIZ A;  2PJ2 A;  8CPA A;  5HIH A;  3BI1 A;  1F2O A;  1HDU A;  3V7Z A;  4P10 A;  4WJB A;  4UEZ A;  4ZY2 A;  3FED A;  2XEI A;  3V2B A;  4ESS A;  2GLF A;  5K8N A;  2VRI A;  1BPM A;  3H8G A;  2PCU A;  5LYF A;  3BHX A;  3FEE A;  4X8I A;  1YD9 A;  1F57 A;  3KQZ A;  2PE3 A;  3HLP A;  2ZEP A;  3FF3 A;  5JGF A;  4J5S A;  3PB9 X;  4J5R A;  4PXD A;  3EWR A;  4EFD A;  4J4Z A;  2PJ8 A;  2AFZ A;  2V8V A;  3KHX A;  1F2P A;  5IB9 A;  3RZA A;  5JH9 A;  4PXE A;  2Q51 A;  4JVV A;  3GB0 A;  2EK9 A;  3KGQ A;  1LAP A;  5CB5 A;  1Z8L A;  3B3T A;  5LYI A;  3GPO A;  1GYT A;  2ZEG A;  3D67 A;  4FUU A;  1XBU A;  1VHE A;  3B3S A;  1TY8 A;  1TXZ A;  1YME A;  4CPA A;  2IMO A;  1FNO A;  3K9T A;  5DS0 A;  2ZEN A;  2CF4 A;  4JZ0 A;  1RTQ A;  5LRJ A;  3PFO A;  2PJA A;  3NH8 A;  3KAS A;  7CPA A;  4R76 A;  2XEF A;  5E3B A;  4KYB A;  3FEC A;  5THW A;  2RB7 A;  1DTD A;  3IO1 A;  4UEE A;  4ZY0 A;  4PQA A;  3KI9 A;  2AFC A;  2BOA A;  3JZT A;  3FH4 A;  4R8F A;  5HXD A;  2CTC A;  2GU2 A;  3NA6 A;  5FSV A;  3MN8 A;  2Q43 A;  5D8N A;  2PJ1 A;  4EME A;  2AFO A;  1ZLI A;  2PJ4 A;  3PBB A;  4MHN A;  1Y7E A;  1HEE A;  3B7I A;  3S9N A;  2AFS A;  4H2K A;  2BFQ A;  3KR5 A;  3PB4 X;  4GVV A;  4X3R A;  4IHM A;  4OIW A;  5D29 A;  4OID A;  3SII A;  3GUX A;  3VAR A;  2JEW A;  2AFM A;  3SJF A;  4P45 A;  2FXK A;  2POK A;  1IY7 A;  3SJG A;  5CB3 A;  2I3C A;  2RFH A;  4Z65 A;  2PJ9 A;  3EKE A;  4F8Z A;  1KWM A;  1ARM A;  4MCR A;  4P4E A;  1Y0Y A;  2XD7 A;  4JGK A;  5CPA A;  1NSA A;  1VHO A;  1ELL P;  3SIH A;  2PJ6 A;  2X47 A;  4K3N A;  3NH4 A;  5CBM A;  4F9V A;  3WC7 A;  3NFZ A;  3EWP A;  1AMP A;  4UIA A;  3IC1 A;  1LCP A;  2ZEL A;  3S9L A;  4NGM A;  3H8E A;  4NGP A;  2F7V A;  3T8W A;  1ZG8 A;  3EWQ A;  1Z5R A;  1R43 A;  5FSY A;  4ZX9 A;  2PJ7 A;  3Q6Z A;  3S9M A;  4ETK A;  3KHZ A;  4ABK A;  1ELM P;  2ABZ A;  4LQG A;  2ACF A;  4GUA A;  1IGB A;  3JRU A;  4P44 A;  3FJU A;  4PXB A;  2ZEF A;  1HJZ A;  5FSX A;  1CP6 A;  1VIX A;  3B35 A;  4NJR A;  1LAM A;  2HB6 A;  3PBE A;  5FSZ A;  4NFR A;  4ZX8 A;  2DEA A;  1YW6 A;  3B3V A;  4KSI A;  3CPA A;  3EJF A;  2O4H A;  4NGT A;  1YW4 A;  2AFW A;  2IJZ A;  3PB6 X;  4Q7A A;  3D68 A;  4MHY A;  3IIB A;  3HUV A;  2IQ6 A;  4ABL A;  1ZR3 A;  3VAT A;  1QMU A;  3CDX A;  1CBX A;  4GM5 A;  1UWY A;  2HC9 A;  4OC2 A;  4G1P A;  1Z2L A;  5LRG A;  1LOK A;  4A39 A;  3TX8 A;  3GQO A;  3WT4 A;  1R3N A;  2GRE A;  5LRK A;  4MCQ A;  3SI1 A;  5FSU A;  1LFW A;  2C6C A;  1BPN A;  3D7D A;  3CPX A;  4X2T A;  4UEF A;  2PVV A;  2NSM A;  2FVG A;  4P4D A;  3BI0 A;  4JYW A;  3NH5 A;  3GPQ A;  4A37 A;  5JM6 A;  4P4J A;  2J9A A;  1ZG7 A;  2NYQ A;  1CPX A;  3SI0 A;  2CIJ A;  2C6G A;  5J1Q A;  1M4L A;  3RBU A;  2GLJ A;  3KZW A;  3IEH A;  1LAN A;  3IWW A;  5LYL A;  2V8H A;  5K8M A;  2WYR A;  4TU0 A;  2WZN A;  1ARL A;  3KR4 A;  4DYO A;  1TF8 A;  1ZG9 A;  4IAV A;  3B3C A;  1EE3 P;  2VL1 A;  4O23 A;  5HVG A;  4MXU A;  2EEE A; 
#chains in the Genus database with same CATH topology
 2PJ3 A;  2Z10 A;  3JUW A;  2VXK A;  4MRI A;  2V77 A;  1CX8 A;  3Q71 A;  4M3S A;  2ZEM A;  5K8O A;  2L8R A;  2FG1 A;  3EWO A;  1L0C A;  2IL4 A;  5G21 A;  3D8P A;  2FAV A;  2F5I A;  4KVO E;  4CGO A;  1Q2C A;  4BD9 A;  3MRU A;  4OC5 A;  4PXC A;  1BLL E;  2QJ8 A;  4B10 A;  4R7M A;  2OZH A;  3VFQ A;  2JDD A;  2V8G A;  1PYT B;  2Q4Z A;  1XMB A;  4PK2 A;  5DWN A;  3ZZI A;  5HOL A;  2XEG A;  3NE8 A;  2ZPA A;  4OC0 A;  4OAD A;  1TKJ A;  2VBQ A;  3DNS A;  4ONW A;  2G9D A;  4XPD C;  4A31 A;  2I00 A;  4I49 A;  3TC8 A;  3TT2 A;  4OC3 A;  2ZW7 A;  4AVA A;  1KUY A;  2DPS A;  3GPG A;  3K2K A;  3D4U A;  1S60 A;  4L8A A;  2P6E A;  1XJO A;  3C26 A;  4OP4 A;  3SJX A;  2ZOG A;  5AG4 A;  4UFV A;  4MFJ A;  4J5Q A;  4BMH A;  1SPV A;  2GE3 A;  2Q0Y A;  2CTB A;  2VEZ A;  3IU1 A;  5CMS A;  2B4D A;  3DLJ A;  2ZOF A;  3G8W A;  2PJ5 A;  4K30 A;  4ZY1 A;  1CG2 A;  1CPS A;  4MFQ A;  4CGN A;  4CGP A;  2B3U A;  4MHZ A;  2QYV A;  4MBU A;  2B4B A;  2O53 A;  1TXR A;  4XNH B;  3WC6 A;  3I1U A;  2WPX A;  2ZEH A;  4NF1 A;  4JXR A;  2JBK A;  2WUU A;  1S7L A;  4KVX A;  4C2Z A;  1XFO A;  4H6Z A;  1IID A;  4GVW A;  3TO6 A;  3FB3 A;  4CAF A;  4CGM A;  1YVK A;  4CS0 B;  5HVH A;  2DX6 A;  1VHS A;  1YVO A;  2H5M A;  1TIQ A;  3PGP A;  4KOX A;  4A38 A;  2FIA A;  3SJE A;  1BAV A;  2R7H A;  4C68 A;  2AFU A;  4UWJ A;  2PIY A;  3LAC A;  3W6S A;  4KSA A;  4FWU A;  1A2Z A;  1ON0 A;  1ZLH A;  3SIG A;  2C1C A;  2JZE A;  2I79 A;  3B2Y A;  2PJB A;  4KOW A;  4TWE A;  3JTK A;  3CZX A;  5K8P A;  3N5F A;  3EC4 A;  3EFA A;  5H86 A;  4UML A;  3GYA A;  3GIU A;  4R3L A;  3CT9 A;  4B6Z A;  2BCO A;  1XRY A;  2JZD A;  1YGH A;  2EO8 A;  1Y9W A;  2PDO A;  2ZEE A;  3D66 A;  1PUA A;  1Q7L A;  4UF4 A;  2EVN A;  2Z3L A;  1WK4 A;  4OKO A;  3SHP A;  3WR7 A;  3GQE A;  3KL9 A;  4DUK A;  3KQX A;  3TE4 A;  4CAW A;  4FAI A;  1Q2D A;  5C88 A;  4W9Y A;  2AFX A;  3ISZ A;  3D7G A;  1YSJ A;  2Q44 A;  1LRZ A;  3PRT A;  2ZXV A;  3TO7 A;  1VHU A;  4GXH A;  3FVL A;  3IIF A;  2FT0 A;  4JCA A;  1Z8T A;  5IB0 A;  1ZR5 A;  1H8L A;  1Y0R A;  2F8H A;  4RN7 A;  4NGQ A;  4XPD B;  1RO5 A;  2VI7 A;  4A32 A;  4OC4 A;  4R6T A;  2JBJ A;  4UFX A;  1TKF A;  3LMS A;  3V38 A;  4IK2 A;  1VKC A;  3FMC A;  3R9F A;  5DUS A;  2PJ0 A;  3I3G A;  1FT7 A;  1TKH A;  2P6F A;  4AXV A;  1YLE A;  2P6G A;  5G22 A;  2YNE A;  5C82 A;  3BJ8 A;  5CNP A;  3LWU A;  3D7H A;  4RUH A;  1QQ9 A;  1Z4E A;  1YX0 A;  2PVW A;  4FD7 A;  3WAB A;  3NE7 A;  1WWZ A;  4AG9 A;  1QSR A;  3PB7 X;  5LYD A;  4PSW A;  4HKF A;  3SIJ A;  3F0A A;  4ETJ A;  4P6Y A;  4P4B A;  2QIR A;  2FXF A;  4PPZ A;  3S6F A;  4D86 A;  4KOY A;  1YLO A;  2LGR A;  1JWQ A;  1Z9U A;  2PJC A;  1OBR A;  1Z8X A;  3RAM A;  2HQY A;  4J3G A;  4MHP A;  4YRH A;  4F9U A;  1VGY A;  3FX6 A;  4P4F A;  2W2G A;  1Y7R A;  2QVP A;  5AIL A;  5HVF A;  3A9L A;  2XEJ A;  2V8D A;  4EWT A;  4A94 A;  2J8N A;  2YGW A;  4RI1 A;  4MCP A;  3WC5 A;  4CAX A;  4E0A A;  4DJL A;  4UWI A;  3PEI A;  3IFE A;  1DE4 C;  2C6P A;  2KQV A;  3FRM A;  4NGS A;  1K4J A;  3PFE A;  4JJX A;  3V45 A;  4M6G A;  1PU9 A;  1TF9 A;  4MMO A;  4KSF A;  4PSX A;  3D7F A;  2EWB A;  4NGR A;  4F6A A;  1HDQ A;  1JQG A;  2Q4V A;  4Q36 A;  6CPA A;  2BEI A;  2X7B A;  4IQY A;  2YND A;  1Q2Y A;  4FD5 A;  4UIB A;  4B14 A;  2RC4 A;  4NGN A;  2B5G B;  1NJR A;  1AYE A;  3T9Y A;  4P4I A;  1XIX A;  2J8R A;  4AG7 A;  3UY5 A;  4WWV A;  2CY2 A;  3BXM A;  3IJ3 A;  4OME A;  3SI2 A;  5KTC A;  4KUA A;  4LUA A;  4K0C A;  2ZED A;  4A33 A;  4TNU A;  4ZI6 A;  4Y49 C;  3B3W A;  4E2A A;  4ZYQ A;  4C7H A;  4OC1 A;  4JLL A;  1CP7 A;  2BSW A;  3H8F A;  3GLJ A;  1YQE A;  5FVJ A;  5F09 A;  3EJG A;  1X10 A;  4QB9 A;  3TOB A;  1M1D A;  4KLV A;  5AGE A;  2ANP A;  2P0W A;  4YU9 A;  3DGV A;  2ZW5 A;  3CXP A;  3EW5 A;  2OR4 A;  1IYK A;  4NCZ A;  4IF5 A;  2B3V A;  2DPT A;  1B87 A;  4YWY A;  3ETI A;  2HV2 A;  3IID A;  1I12 A;  2JDC A;  2RNK A;  3D3S A;  4R87 A;  3QNV A;  4FBE A;  5BWA B;  3L2N A;  2BO9 A;  5ELY A;  2AJ6 A;  1IOF A;  2ZEO A;  2PRQ A;  4CYN A;  1PCA A;  4CAV A;  2Q7B A;  1CJW A;  1M4I A;  2OOT A;  3TCV A;  3PB8 X;  5I4M A;  3ISX A;  2B4D B;  2EK8 A;  4NJQ A;  2BFR A;  4MCS A;  2DF5 A;  2PIZ A;  4U9Y A;  3R9E A;  2Z3N A;  5F46 A;  2PJ2 A;  3S6H A;  8CPA A;  5HIH A;  2VZY A;  3BI1 A;  1KZF A;  4KUB A;  4JD6 A;  4DNC A;  1MJA A;  1U6M A;  2R8V A;  2K5T A;  2GAN A;  1F2O A;  3S6G A;  3R1K A;  1HDU A;  3V7Z A;  1Y9K A;  4MFP A;  1S7K A;  4P10 A;  4UEZ A;  1XEB A;  4JWP A;  4WJB A;  4ZY2 A;  5KTD A;  3FED A;  2XEI A;  3B8G A;  1P0H A;  4AB7 A;  3V2B A;  4ESS A;  1M4G A;  1NMT A;  2VRI A;  2GLF A;  5K8N A;  2ZW4 A;  1BPM A;  5EBV A;  3H8G A;  2PCU A;  4M85 A;  3TO9 A;  3MGD A;  4OLL A;  5LYF A;  3BHX A;  3FEE A;  4B11 A;  4RS2 A;  4X8I A;  1YD9 A;  1F57 A;  3KQZ A;  1RXT A;  2C27 A;  2PE3 A;  2Z3P A;  3HLP A;  2ZEP A;  4ZGY B;  3FF3 A;  5JGF A;  4J5S A;  1M4D A;  4J5R A;  3IWE A;  3EWR A;  3PB9 X;  4PXD A;  3LOD A;  4J4Z A;  4HNY B;  4CYP A;  1MJB A;  2PJ8 A;  4EFD A;  2AFZ A;  2V8V A;  3KHX A;  1F2P A;  5IB9 A;  4KOS A;  4R9M A;  4Y49 B;  4U9Z A;  4KZT A;  3RZA A;  1S7N A;  2A4N A;  4FD4 A;  4II9 A;  5JH9 A;  3T90 A;  1KUV A;  3FYN A;  4PXE A;  3H5Z A;  2Q51 A;  3F5B A;  2QEC A;  3GKR A;  4JVV A;  1ZO0 A;  2ATR A;  4M6H A;  5HMN A;  3H4Q A;  3GB0 A;  4FD6 A;  2EK9 A;  3KGQ A;  1IIC A;  1LAP A;  5CB5 A;  1Z8L A;  1V0C A;  2ZW6 A;  5A28 A;  5E96 A;  3B3T A;  3W6X A;  3D2M A;  5LYI A;  5I0C A;  2Z3M A;  1XOV A;  3GPO A;  3SXO A;  2Q4Y A;  3RNZ A;  1GYT A;  2CNM A;  4A95 A;  2ZEG A;  1FY7 A;  3D67 A;  3K9U A;  2PR8 A;  4FUU A;  1XBU A;  1VHE A;  3B3S A;  1TY8 A;  1TXZ A;  4ONU A;  1XF8 A;  1YME A;  4UBR A;  4CPA A;  2IMO A;  1FNO A;  4Q38 A;  3K9T A;  2PRB A;  4YFJ A;  5DS0 A;  4CYO A;  2ZEN A;  2ODF A;  2CF4 A;  2Y0M A;  3N7Z A;  4JZ0 A;  1RTQ A;  1N71 A;  2G3A A;  4MY0 A;  5LRJ A;  3PFO A;  2PJA A;  3NH8 A;  4CRZ B;  3KAS A;  7CPA A;  4R76 A;  5HH1 A;  2XEF A;  5E3B A;  1QSO A;  4UCP A;  5EMI A;  3R95 A;  4KYB A;  3FEC A;  1AUG A;  5H84 A;  5THW A;  2RB7 A;  1DTD A;  3TOA A;  3IO1 A;  5JQ4 A;  2CNS A;  2PQ8 A;  4UEE A;  3RYO A;  1XMT A;  4ZY0 A;  4PQA A;  3R96 A;  3KI9 A;  2AFC A;  4KS9 A;  4MHD A;  4PK3 A;  4QVT A;  5F47 A;  4C2Y A;  2BOA A;  3JZT A;  3FH4 A;  4R8F A;  5HXD A;  1IB1 E;  2CTC A;  3QAH A;  2WSA A;  1IU8 A;  2JZF A;  2GU2 A;  1UFH A;  5FSV A;  3NA6 A;  3MN8 A;  2Q43 A;  5D8N A;  4U5Y A;  2WCT A;  2PJ1 A;  1P4N A;  4EME A;  2WPW A;  2AFO A;  1ZLI A;  2PJ4 A;  3PBB A;  2FS5 A;  4BBH A;  1R57 A;  4MHN A;  5CPA A;  5G1Z A;  1Y7E A;  1HEE A;  3B7I A;  3S9N A;  1NSL A;  5EC4 A;  2AFS A;  4H2K A;  2QML A;  2BFQ A;  4A30 A;  3KR5 A;  3PB4 X;  4GVV A;  4X3R A;  3LD2 A;  4IHM A;  2G3T A;  3P2F A;  3S6K A;  4OIW A;  3VWE A;  3D2P A;  5D29 A;  4OID A;  3SII A;  3GUX A;  2FL4 A;  5DWM A;  3R9G A;  3VAR A;  2JEW A;  2AFM A;  3G3S A;  3SJF A;  1Z8W A;  4UCM A;  4P45 A;  2FXK A;  3CXQ A;  5JPH A;  3PP9 A;  2POK A;  1IY7 A;  4KOR A;  4JXQ A;  3SJG A;  5CB3 A;  2I3C A;  2RFH A;  2VZZ A;  4NEX A;  4B13 A;  2R98 A;  4KLW A;  3GY9 A;  4Z65 A;  2PJ9 A;  3EKE A;  4QBJ A;  4F8Z A;  1KWM A;  1M44 A;  1QSM A;  4LQ6 A;  4CAE A;  5A27 A;  1ARM A;  4C7I A;  4MCR A;  4P4E A;  5AG6 A;  3VWD A;  1Y0Y A;  2XD7 A;  4JGK A;  2Z3O A;  4H89 A;  1NSA A;  1VHO A;  1ELL P;  2AE6 A;  1XE4 A;  1J4J A;  5AG7 A;  1S3Z A;  4A2Z A;  3SIH A;  4NXY A;  2PJ6 A;  2X47 A;  1KUX A;  3OWC A;  3P2H A;  4K3N A;  4MFZ A;  2PR1 A;  5CBM A;  3NH4 A;  4F9V A;  3WC7 A;  3NFZ A;  3EWP A;  1AMP A;  3SXN A;  4UIA A;  3BLN A;  3IC1 A;  3W91 A;  1LCP A;  2ZEL A;  4CRY B;  3S9L A;  1SQH A;  4CYQ A;  3IWG A;  4NGM A;  2EUI A;  3H8E A;  4MFL A;  4NGP A;  2F7V A;  3T8W A;  1ZG8 A;  3EWQ A;  1Z5R A;  2FCK A;  4GS4 A;  4LX9 A;  1R43 A;  4JLY A;  5KTA A;  1YR0 A;  5FSY A;  4ZX9 A;  2PJ7 A;  5IV0 A;  4MFK A;  3ZJ0 A;  3Q6Z A;  2KCW A;  4HNW B;  1I21 A;  4R3K A;  3S9M A;  3RO0 A;  4ETK A;  5AG5 A;  3KHZ A;  4ABK A;  1ELM P;  3FXT A;  4AVC A;  2ABZ A;  4LQG A;  2ACF A;  1IOI A;  2JLM A;  2FIW A;  4F0Y A;  4GUA A;  1IGB A;  2B58 A;  2OZG A;  3JRU A;  2OU2 A;  4IUS A;  1S7F A;  4P44 A;  3FJU A;  4PXB A;  2ZEF A;  1HJZ A;  5FSX A;  1CP6 A;  1VIX A;  3B35 A;  4NJR A;  4BIN A;  5IX3 A;  2ARH A;  4KVM E;  1LAM A;  2HB6 A;  3PBE A;  5FSZ A;  4NFR A;  3F8K A;  4ZX8 A;  2DEA A;  1YW6 A;  3B3V A;  4KSI A;  4M6I A;  4MI4 A;  4NSQ A;  3CPA A;  3EJF A;  4XPK A;  5G20 A;  1X12 A;  2O4H A;  1QST A;  2PC1 A;  1YW4 A;  2AFW A;  2YNC A;  3I9S A;  4NGT A;  2IJZ A;  3PB6 X;  2VQY A;  4Q7A A;  3BJ7 A;  5J8C A;  3D68 A;  2CNT A;  4CGL A;  3VH9 A;  4MHY A;  4MY3 A;  4HPS A;  2R1I A;  4X5K A;  3IIB A;  4B5P A;  3HUV A;  2D4O A;  2IQ6 A;  4ABL A;  1ZR3 A;  2Z3K A;  4YGO A;  3VAT A;  1QMU A;  1MK4 A;  3DSB A;  3V8I A;  3CDX A;  4UFW A;  4B5P B;  1CBX A;  1Z4R A;  3PZJ A;  1QSN A;  4MJ8 A;  2O28 A;  3EO4 A;  5ISV A;  4GM5 A;  1UWY A;  2OB0 A;  2HC9 A;  4OC2 A;  4AVB A;  3FNC A;  4G1P A;  1Z2L A;  5GCN A;  2JEV A;  1LOK A;  5LRG A;  4A39 A;  2REF A;  3E0K A;  3TX8 A;  2EBJ A;  3KKW A;  1IYL A;  4R57 A;  1BO4 A;  3IGR A;  3GQO A;  5J8F A;  4ORF A;  1OZP A;  3DDD A;  3WT4 A;  1BOB A;  1R3N A;  2GRE A;  5LRK A;  4MCQ A;  3SI1 A;  4KOU A;  1YK3 A;  5FSU A;  2REE A;  1LFW A;  2C6C A;  2PSW A;  1BPN A;  2Q04 A;  3DR6 A;  4ZBG A;  5F49 A;  4UA3 A;  3D7D A;  3IU2 A;  4PV6 A;  3CPX A;  4X2T A;  5F48 A;  1B6B A;  4UEF A;  1NE9 A;  4XPL A;  2PVV A;  4KOT A;  4QC6 A;  2NSM A;  4L89 A;  2FVG A;  2DXQ A;  4P4D A;  3BI0 A;  2FSR A;  4B12 A;  4C2X A;  4JYW A;  3NH5 A;  2Q7S A;  4B5O A;  2Z0Z A;  2CXA A;  3GPQ A;  2G0B A;  4A37 A;  3FBU A;  5JM6 A;  2HUZ A;  3JVN A;  2D4P A;  4P4J A;  4EVY A;  2J9A A;  1ZG7 A;  2NYQ A;  2OZU A;  3QB8 A;  1CPX A;  3SI0 A;  2J8M A;  2CIJ A;  1CM0 A;  4XNH C;  1YRE A;  3DR8 A;  3TTH A;  4HNX B;  2C6G A;  4F0X A;  3TFY A;  5J1Q A;  3FIX A;  1M4L A;  1MJ9 A;  3RBU A;  2NMT A;  2GLJ A;  3EXN A;  4OAE A;  2GFQ A;  4H6U A;  3KZW A;  3IEH A;  1LAN A;  3IWW A;  2BL1 A;  1GHE A;  4QUS A;  4UCN A;  3QAY A;  5LYL A;  2V8H A;  5K8M A;  2WYR A;  4TU0 A;  4E8O A;  1S5K A;  1ARL A;  2WZN A;  2OH1 A;  3KR4 A;  1I1D A;  2FE7 A;  4KOV A;  2B5G A;  4DYO A;  1TF8 A;  1ZG9 A;  4IAV A;  3B3C A;  3CXS A;  1EE3 P;  2VL1 A;  4O23 A;  2GIV A;  5HVG A;  3EY5 A;  2YNC C;  2BUE A;  4MXU A;  2EEE A;  2Z11 A; 
#chains in the Genus database with same CATH homology
 2PJ3 A;  4MRI A;  2V77 A;  1CX8 A;  3Q71 A;  2ZEM A;  5K8O A;  2L8R A;  2FG1 A;  3EWO A;  2FAV A;  4BD9 A;  3MRU A;  4OC5 A;  4PXC A;  1BLL E;  2QJ8 A;  4R7M A;  3VFQ A;  2V8G A;  1PYT B;  2Q4Z A;  1XMB A;  5HOL A;  2XEG A;  4OC0 A;  1TKJ A;  4ONW A;  2G9D A;  3TC8 A;  4OC3 A;  3GPG A;  3K2K A;  3D4U A;  4OP4 A;  1XJO A;  3SJX A;  2ZOG A;  4J5Q A;  1SPV A;  2CTB A;  5CMS A;  3DLJ A;  2ZOF A;  2PJ5 A;  4ZY1 A;  1CG2 A;  1CPS A;  4MHZ A;  2QYV A;  3WC6 A;  2O53 A;  1TXR A;  3I1U A;  2ZEH A;  2JBK A;  1XFO A;  4GVW A;  5HVH A;  2DX6 A;  4A38 A;  3SJE A;  1BAV A;  2AFU A;  2PIY A;  4FWU A;  2C1C A;  1ZLH A;  3SIG A;  4TWE A;  3B2Y A;  2PJB A;  5K8P A;  3N5F A;  4UML A;  3CT9 A;  4B6Z A;  2BCO A;  1XRY A;  3D66 A;  2ZEE A;  4UF4 A;  3VH9 A;  1Q7L A;  4OKO A;  4DUK A;  3GQE A;  3KL9 A;  3KQX A;  4FAI A;  4W9Y A;  2AFX A;  3ISZ A;  3D7G A;  1YSJ A;  3PRT A;  1VHU A;  3FVL A;  3IIF A;  4JCA A;  1ZR5 A;  1H8L A;  1Y0R A;  2F8H A;  4NGQ A;  4OC4 A;  4R6T A;  2JBJ A;  1TKF A;  3LMS A;  3V38 A;  4IK2 A;  3FMC A;  5DUS A;  2PJ0 A;  1FT7 A;  1TKH A;  4AXV A;  3LWU A;  3D7H A;  4RUH A;  1QQ9 A;  2PVW A;  3WAB A;  3PB7 X;  5LYD A;  4P6Y A;  3SIJ A;  4P4B A;  4ETJ A;  4PPZ A;  4D86 A;  1YLO A;  2LGR A;  2PJC A;  1OBR A;  3RAM A;  4MHP A;  4F9U A;  1VGY A;  3FX6 A;  4P4F A;  4EWT A;  5HVF A;  2QVP A;  5AIL A;  2XEJ A;  2V8D A;  4A94 A;  4MCP A;  3WC5 A;  4DJL A;  3PEI A;  3IFE A;  1DE4 C;  2C6P A;  4NGS A;  3PFE A;  3V45 A;  1TF9 A;  4MMO A;  3D7F A;  2EWB A;  4NGR A;  1HDQ A;  1JQG A;  6CPA A;  4IQY A;  4UIB A;  4NGN A;  1NJR A;  1AYE A;  4P4I A;  4WWV A;  3BXM A;  3IJ3 A;  4OME A;  3SI2 A;  4K0C A;  2ZED A;  4TNU A;  4ZI6 A;  3B3W A;  4ZYQ A;  4OC1 A;  4JLL A;  1CP7 A;  3H8F A;  3GLJ A;  5F09 A;  3EJG A;  4YU9 A;  2ANP A;  3DGV A;  3EW5 A;  2OR4 A;  4YWY A;  3ETI A;  3IID A;  4FBE A;  3QNV A;  3L2N A;  2BO9 A;  5ELY A;  2ZEO A;  2PRQ A;  1PCA A;  2OOT A;  3PB8 X;  5I4M A;  3ISX A;  2EK8 A;  4NJQ A;  2BFR A;  4MCS A;  2PIZ A;  2PJ2 A;  8CPA A;  5HIH A;  3BI1 A;  1F2O A;  1HDU A;  3V7Z A;  4P10 A;  4WJB A;  4UEZ A;  4ZY2 A;  3FED A;  2XEI A;  3V2B A;  4ESS A;  2GLF A;  5K8N A;  2VRI A;  1BPM A;  3H8G A;  2PCU A;  5LYF A;  3BHX A;  3FEE A;  4X8I A;  1YD9 A;  1F57 A;  3KQZ A;  2PE3 A;  3HLP A;  2ZEP A;  3FF3 A;  5JGF A;  4J5S A;  3PB9 X;  4J5R A;  4PXD A;  3EWR A;  4EFD A;  4J4Z A;  2PJ8 A;  2AFZ A;  2V8V A;  3KHX A;  1F2P A;  5IB9 A;  3RZA A;  5JH9 A;  4PXE A;  2Q51 A;  4JVV A;  3GB0 A;  2EK9 A;  3KGQ A;  1LAP A;  5CB5 A;  1Z8L A;  3B3T A;  5LYI A;  3GPO A;  1GYT A;  2ZEG A;  3D67 A;  4FUU A;  1XBU A;  1VHE A;  3B3S A;  1TY8 A;  1TXZ A;  1YME A;  4CPA A;  2IMO A;  1FNO A;  3K9T A;  5DS0 A;  2ZEN A;  2CF4 A;  4JZ0 A;  1RTQ A;  5LRJ A;  3PFO A;  2PJA A;  3NH8 A;  3KAS A;  7CPA A;  4R76 A;  2XEF A;  5E3B A;  4KYB A;  3FEC A;  5THW A;  2RB7 A;  1DTD A;  3IO1 A;  4UEE A;  4ZY0 A;  4PQA A;  3KI9 A;  2AFC A;  2BOA A;  3JZT A;  3FH4 A;  4R8F A;  5HXD A;  2CTC A;  2GU2 A;  3NA6 A;  5FSV A;  3MN8 A;  2Q43 A;  5D8N A;  2PJ1 A;  4EME A;  2AFO A;  1ZLI A;  2PJ4 A;  3PBB A;  4MHN A;  1Y7E A;  1HEE A;  3B7I A;  3S9N A;  2AFS A;  4H2K A;  2BFQ A;  3KR5 A;  3PB4 X;  4GVV A;  4X3R A;  4IHM A;  4OIW A;  5D29 A;  4OID A;  3SII A;  3GUX A;  3VAR A;  2JEW A;  2AFM A;  3SJF A;  4P45 A;  2FXK A;  2POK A;  1IY7 A;  3SJG A;  5CB3 A;  2I3C A;  2RFH A;  4Z65 A;  2PJ9 A;  3EKE A;  4F8Z A;  1KWM A;  1ARM A;  4MCR A;  4P4E A;  1Y0Y A;  2XD7 A;  4JGK A;  5CPA A;  1NSA A;  1VHO A;  1ELL P;  3SIH A;  2PJ6 A;  2X47 A;  4K3N A;  3NH4 A;  5CBM A;  4F9V A;  3WC7 A;  3NFZ A;  3EWP A;  1AMP A;  4UIA A;  3IC1 A;  1LCP A;  2ZEL A;  3S9L A;  4NGM A;  3H8E A;  4NGP A;  2F7V A;  3T8W A;  1ZG8 A;  3EWQ A;  1Z5R A;  1R43 A;  5FSY A;  4ZX9 A;  2PJ7 A;  3Q6Z A;  3S9M A;  4ETK A;  3KHZ A;  4ABK A;  1ELM P;  2ABZ A;  4LQG A;  2ACF A;  4GUA A;  1IGB A;  3JRU A;  4P44 A;  3FJU A;  4PXB A;  2ZEF A;  1HJZ A;  5FSX A;  1CP6 A;  1VIX A;  3B35 A;  4NJR A;  1LAM A;  2HB6 A;  3PBE A;  5FSZ A;  4NFR A;  4ZX8 A;  2DEA A;  1YW6 A;  3B3V A;  4KSI A;  3CPA A;  3EJF A;  2O4H A;  4NGT A;  1YW4 A;  2AFW A;  2IJZ A;  3PB6 X;  4Q7A A;  3D68 A;  4MHY A;  3IIB A;  3HUV A;  2IQ6 A;  4ABL A;  1ZR3 A;  3VAT A;  1QMU A;  3CDX A;  1CBX A;  4GM5 A;  1UWY A;  2HC9 A;  4OC2 A;  4G1P A;  1Z2L A;  5LRG A;  1LOK A;  4A39 A;  3TX8 A;  3GQO A;  3WT4 A;  1R3N A;  2GRE A;  5LRK A;  4MCQ A;  3SI1 A;  5FSU A;  1LFW A;  2C6C A;  1BPN A;  3D7D A;  3CPX A;  4X2T A;  4UEF A;  2PVV A;  2NSM A;  2FVG A;  4P4D A;  3BI0 A;  4JYW A;  3NH5 A;  3GPQ A;  4A37 A;  5JM6 A;  4P4J A;  2J9A A;  1ZG7 A;  2NYQ A;  1CPX A;  3SI0 A;  2CIJ A;  2C6G A;  5J1Q A;  1M4L A;  3RBU A;  2GLJ A;  3KZW A;  3IEH A;  1LAN A;  3IWW A;  5LYL A;  2V8H A;  5K8M A;  2WYR A;  4TU0 A;  2WZN A;  1ARL A;  3KR4 A;  4DYO A;  1TF8 A;  1ZG9 A;  4IAV A;  3B3C A;  1EE3 P;  2VL1 A;  4O23 A;  5HVG A;  4MXU A;  2EEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...