3H8EA

Low ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
473
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGIMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
total genus 156
structure length 473
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8eA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8eA02
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3V2BA 3MRUA 4ETKA 3K2KA 5LRJA 4R76A 3NH4A 1CPSA 2V8HA 2AFUA 3IIFA 4MHYA 3PBBA 4NGRA 3V45A 2PIZA 3QNVA 2C6PA 3IC1A 4P6YA 3GPQA 2POKA 1ZLHA 1R43A 2GREA 2JBJA 2XD7A 3SJXA 1HEEA 1XRYA 3SJEA 1SPVA 3CDXA 1XJOA 2F8HA 3ISZA 1DTDA 4MCPA 3D67A 3KI9A 4TU0A 5K8NA 3Q71A 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 5JM6A 5DUSA 2ZEHA 3PFOA 1DE4C 3VFQA 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4NFRA 4P4FA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 2L8RA 1HDQA 3FECA 1YW4A 5HIHA 4FUUA 1YD9A 3KQXA 2XEGA 4NGMA 3D66A 1HJZA 2JBKA 1VIXA 3FX6A 3GQOA 4ETJA 4GVWA 4ZI6A 3PB4X 3EWRA 3S9MA 3FVLA 4UIAA 1VHUA 1IGBA 5CB3A 2PRQA 2ZENA 3IIDA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 4GVVA 2EWBA 2VRIA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 2XEFA 1ZR5A 4NGQA 5K8PA 2GLJA 5CB5A 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 3SIGA 5HXDA 4H2KA 4K0CA 1QQ9A 5FSXA 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 3LMSA 4FAIA 4OC1A 2CTCA 1Y7EA 4OKOA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 4ESSA 2V77A 4UEFA 2PJ9A 2ZEGA 4JCAA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 4ABLA 1FT7A 2IMOA 3Q6ZA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 2FG1A 5FSVA 1UWYA 3B2YA 4ABKA 2OR4A 2BFRA 2BCOA 3B3CA 4JLLA 4ONWA 3CPXA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 5E3BA 2FVGA 3D7FA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3EW5A 3GPGA 3SIIA 3PB7X 2ZEFA 5FSZA 5AILA 3KASA 3RAMA 1LAPA 2AFCA 1AYEA 2C6GA 4R6TA 5F09A 4UMLA 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4GUAA 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 3EWQA 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 4J5QA 4J5SA 1LAMA 2BO9A 4DUKA 4Q7AA 4ZY0A 2V8DA 2BFQA 4GM5A 1TF9A 5CPAA 4JGKA 2FAVA 5CBMA 2DX6A 5CMSA 3MN8A 5THWA 4RUHA 4IQYA 1NSAA 4MCQA 2Q51A 5HOLA 3GB0A 4ZX9A 4NGNA 2C1CA 4FWUA 4J5RA 3L2NA 3T8WA 3BXMA 4D86A 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 1PYTB 3IWWA 5FSUA 3CT9A 4PXEA 7CPAA 1TKHA 4J4ZA 3EWOA 1YMEA 3ETIA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 1ZR3A 3IO1A 2PIYA 2I3CA 1TXZA 2IJZA 1NJRA 2PJCA 2EEEA 3B3VA 2FXKA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 4KSIA 1YLOA 2Q43A 4OC5A 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 5FSYA 1ARLA 3SIHA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 3H8GA 4MHPA 1ZG7A 3S9LA 3EKEA 2ZOGA 3GLJA 4NGSA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 3SIJA 5HVFA 3TX8A 1Y0YA 2ZEDA 4KYBA 4FBEA 4WJBA 5IB9A 4ZX8A 2X47A 3K9TA 4ZYQA 4TWEA 3SJGA 1YW6A 1LANA 2LGRA 3EWPA 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3EJFA 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 2AFZA 4WWVA 2Q4ZA 3WC5A 3GQEA 1CBXA 3NFZA 4MHZA 4P44A 4EWTA 3S9NA 3V7ZA 1TKJA 2AFOA 3KR4A 2C6CA 4PXCA 5LRGA 1LFWA 4JVVA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 1TKFA 3GPOA 3RBUA 3EJGA 4R7MA 4MCSA 4OP4A 5ELYA 2F7VA 4YWYA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1TY8A 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 3PBEA 4P4IA 4B6ZA 4IAVA 4CPAA 2WZNA 2ACFA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 2ZEPA 3JZTA
chains in the Genus database with same CATH superfamily
1CX8A 4X2TA 2Z3PA 1IOFA 1TXRA 1F57A 3FNCA 3BHXA 2FIWA 2V8VA 8CPAA 1BLLE 2B5GB 3V2BA 1NSLA 2FT0A 3SXNA 2KQVA 1YGHA 4ETKA 3A9LA 3D8PA 3GY9A 1QSRA 3MRUA 3K2KA 5LRJA 4AB7A 4R76A 1VKCA 3NH4A 1CPSA 2V8HA 1XIXA 2CNTA 4PSWA 2AFUA 1YVOA 3IIFA 3GIUA 4MHYA 3PBBA 4NGRA 3V45A 4B11A 4XPKA 3R1KA 2PIZA 1Z8TA 1Z8WA 3QNVA 2W2GA 1Z4EA 2C6PA 3G8WA 3IC1A 4KUBA 4P6YA 3TE4A 3GPQA 4HKFA 4QVTA 2EO8A 2POKA 4M85A 2OU2A 1ZLHA 1R43A 2GREA 2BUEA 2HQYA 2JBJA 1I12A 2XD7A 2O28A 3DR8A 3RNZA 3SJXA 1HEEA 1XRYA 2PR1A 4UA3A 3SJEA 1SPVA 1IYKA 3CDXA 1XJOA 2F8HA 2R7HA 3F5BA 2ZXVA 3ISZA 3W6XA 1B6BA 1DTDA 3D67A 4MCPA 4E8OA 4OAEA 3KI9A 4TU0A 3JTKA 1S60A 5K8NA 2EBJA 3VWEA 3NE8A 3Q71A 3D7GA 4UWJA 4FD5A 4Z65A 1PU9A 5D8NA 2OH1A 1YVKA 3BJ7A 3FEEA 3JUWA 3R95A 3TCVA 4F8ZA 5HMNA 3C26A 4M3SA 1QSNA 2GE3A 4CGOA 2RC4A 3FRMA 1Z5RA 2J8NA 1JWQA 2HUZA 4RS2A 5JM6A 1OZPA 2PSWA 5HH1A 5IB0A 5DUSA 3H4QA 2ZEHA 3PFOA 1DE4C 3UY5A 4L89A 4NCZA 3VFQA 4OC2A 6CPAA 3CXQA 5LYDA 1IB1E 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 2Z0ZA 4HPSA 1ARMA 4KLVA 4F9UA 3NH8A 4JXRA 4JD6A 2ZOFA 3D68A 2PJ4A 3N5FA 2B4BA 4NFRA 4P4FA 3TC8A 5LRKA 3PRTA 2JZFA 4KSAA 2G3AA 3FF3A 4XNHC 4P4JA 1I21A 3WC7A 2PVVA 3S6GA 1XFOA 4LUAA 2L8RA 1HDQA 3FECA 4CYNA 5J8FA 1YW4A 4I49A 5HIHA 4UFVA 3FIXA 2OB0A 1YD9A 4FUUA 1KUVA 4X5KA 3KQXA 2XEGA 4NGMA 5A27A 2EUIA 3D66A 4R87A 1HJZA 1IYLA 3ZZIA 2D4OA 2JLMA 2FE7A 1UFHA 2JBKA 1VIXA 3FX6A 2H5MA 2EVNA 3GQOA 4ETJA 2RNKA 4GVWA 4ZI6A 2QMLA 3PB4X 4F6AA 3EWRA 2QECA 1M1DA 1XOVA 2ARHA 2ATRA 3S9MA 3S6FA 4II9A 3PZJA 4C7IA 3FVLA 4KS9A 4NF1A 4UCMA 1VHUA 4UIAA 4XPLA 1IGBA 5CB3A 2I00A 2PRQA 2Z3MA 5F49A 2ZENA 2YGWA 3IIDA 3S6KA 2Q7SA 3T9YA 1IIDA 2PJ3A 4G1PA 2GFQA 2ZEMA 1BO4A 1Q2YA 4MHDA 5AGEA 4PPZA 4BMHA 2HB6A 4YU9A 4CRYB 5F46A 4GVVA 4B10A 5GCNA 2EWBA 2VRIA 1GHEA 3EO4A 3PEIA 3IU1A 5LYIA 2PJBA 4PSXA 2Q0YA 4GS4A 4PXDA 4AVAA 1PCAA 1BPNA 1WK4A 4KOSA 2CF4A 3KKWA 5F48A 3FB3A 5F47A 3WT4A 3PGPA 1QMUA 4FD6A 5JH9A 2PVWA 2XEFA 1ZR5A 4NGQA 5JQ4A 1KUXA 1XE4A 3LACA 5K8PA 2PQ8A 4RN7A 2GLJA 5CB5A 3RO0A 3WR7A 4KVME 4JYWA 2Z3OA 1RXTA 5AG4A 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 3SIGA 1CM0A 2VI7A 4H2KA 4K0CA 1QQ9A 4J3GA 4A32A 5HXDA 5FSXA 5LYFA 4Y49C 2REEA 4KZTA 3FH4A 3TOBA 4BD9A 3B7IA 4B12A 2NSMA 1Q7LA 4KOWA 3BLNA 3R9GA 2CTBA 3CPAA 3P2HA 4KUAA 3D3SA 2YNCC 3S6HA 4DNCA 2YNEA 2CIJA 4M6HA 3TO9A 4CAEA 1GYTA 4UEEA 4KOTA 3IEHA 4NEXA 4NJRA 5DWNA 2Q4YA 5C88A 5G20A 4A30A 3IFEA 3R9EA 5G22A 2DEAA 3B35A 4B5PA 4NGPA 1IY7A 2ANPA 2FIAA 1CP6A 3RBUA 1TF8A 3K9UA 2AFMA 3LMSA 3ZJ0A 4KLWA 4FAIA 1I1DA 2K5TA 4OC1A 2CTCA 1Y7EA 3QAHA 4M6GA 2GIVA 4OKOA 4PXBA 2ZW6A 3WABA 4O23A 2EK9A 4K3NA 1RO5A 2RB7A 2VL1A 2ZPAA 4ESSA 2V77A 2Z11A 4UEFA 1IICA 2PJ9A 1P0HA 2ZEGA 3QB8A 4JCAA 3SXOA 3VH9A 1R3NA 2PJ7A 3W6SA 1QSTA 2FS5A 3SJFA 1YLEA 4BBHA 2R98A 2CXAA 2FSRA 4OIDA 1XMTA 2GANA 1M4IA 4ABLA 1FT7A 1VHSA 2IMOA 4AG9A 3Q6ZA 3B3SA 1AMPA 4FD7A 4MJ8A 3R96A 4UWIA 4A2ZA 2G0BA 3D2MA 2QYVA 2B4DB 2OZUA 2V8GA 4P4DA 2B58A 4EMEA 1MJ9A 3F8KA 2FG1A 5FSVA 1S3ZA 1UWYA 4ABKA 2KCWA 2OR4A 3B2YA 4IUSA 4AVBA 2BFRA 1IOIA 2BCOA 2AE6A 3B3CA 4JLLA 2QIRA 4ONWA 3R9FA 3CPXA 3T90A 5CNPA 2IQ6A 4C2XA 4B5OA 3VARA 3KL9A 4KORA 1Y9WA 2DXQA 4P10A 1LCPA 2NMTA 4MXUA 4B13A 4KSFA 5E3BA 2FVGA 2Z3LA 3D7FA 4MFQA 3VATA 5BWAB 2ZW5A 3KHXA 1JQGA 2Q4VA 2J9AA 4IK2A 1M4DA 1RTQA 1MK4A 3DLJA 4Q36A 1CPXA 1LOKA 1QSOA 3SI2A 4DYOA 1LRZA 4KOXA 3EW5A 3GPGA 3SIIA 4JXQA 3PB7X 2ZEFA 2WSAA 1AUGA 2Q44A 5FSZA 1TIQA 5AILA 2Z10A 3EC4A 3KASA 5FVJA 3RAMA 4CGMA 1LAPA 2VZYA 2AFCA 3QAYA 1AYEA 4CAFA 2C6GA 4UCPA 4R6TA 5F09A 4UMLA 3OWCA 4QUSA 4HNXB 5ISVA 3IIBA 3EXNA 5J1QA 2X7BA 1N71A 1FNOA 4KOVA 3I3GA 4OMEA 5AG6A 4CAVA 1Y9KA 2B4DA 5EC4A 4CGPA 4UIBA 1OBRA 3IU2A 1B87A 3CXPA 4MCRA 3KR5A 4GUAA 2VEZA 4H6UA 3CZXA 4OADA 1ZG9A 4OC4A 2PRBA 3TO7A 2HC9A 2WYRA 4MHNA 2CY2A 2DF5A 3E0KA 4OC0A 5DS0A 3EWQA 2R1IA 5H84A 5KTDA 4R3KA 2FXFA 4LX9A 4MMOA 4XPDC 3F0AA 1Y7RA 2PJ2A 4NGTA 2PJ5A 5LYLA 2BEIA 4J5QA 1L0CA 4J5SA 1LAMA 2BO9A 4XNHB 2JZDA 1YREA 3IWEA 4DUKA 4Q7AA 4ZY0A 2V8DA 2BFQA 1K4JA 4GM5A 1TF9A 2I79A 2ZW4A 4K30A 4L8AA 1YX0A 1MJBA 4UBRA 5CPAA 4JGKA 2FAVA 5CBMA 4R3LA 2DX6A 5CMSA 4QC6A 3MN8A 5THWA 4RUHA 4IQYA 3RYOA 1NSAA 3DSBA 4MCQA 2Q51A 5HOLA 1Z8XA 3GB0A 4ZX9A 3JVNA 4NGNA 1IU8A 2C1CA 3IWGA 4F0YA 4FWUA 4J5RA 2OZHA 3L2NA 4B5PB 1S5KA 3T8WA 4YWYA 4RI1A 3BXMA 4D86A 1EE3P 1M44A 2CNSA 3SI1A 4Y49B 3PB9X 3IJ3A 4R8FA 5G1ZA 3RZAA 3DGVA 4JWPA 4CYQA 1P4NA 4IF5A 4C68A 3DNSA 2O4HA 4ZY2A 2JDCA 4BINA 4E0AA 2VZZA 1PYTB 3IWWA 5FSUA 3NE7A 2ZW7A 2AJ6A 3CT9A 1ON0A 4PXEA 7CPAA 1TKHA 2PDOA 4MFJA 4J4ZA 4MFKA 4ONUA 5KTAA 3EWOA 2WCTA 1YMEA 1YQEA 3ETIA 2QJ8A 4W9YA 1VGYA 2VBQA 2ZEOA 4FD4A 1YK3A 2CNMA 3CXSA 3NA6A 4A39A 1ZR3A 3IO1A 2PIYA 2I3CA 4U5YA 1TXZA 2IJZA 1NJRA 2PJCA 2EEEA 3B3VA 5AG7A 4PK3A 4PK2A 2FXKA 1S7NA 3TTHA 2PR8A 5AG5A 4C2ZA 5KTCA 4MI4A 2PJ0A 4MY0A 3ISXA 2OZGA 2JZEA 2O53A 1BAVA 1ZLIA 2BOAA 4KSIA 1YLOA 2Q43A 3FBUA 4OC5A 3V8IA 4CGLA 4R57A 2RFHA 2EK8A 4CYPA 1NMTA 4GXHA 4M6IA 5K8OA 3GYAA 1ELMP 4C2YA 5J8CA 1CG2A 5E96A 4NJQA 2C27A 4A38A 4CAXA 5FSYA 1ARLA 4H6ZA 3SIHA 3LD2A 4Q38A 2P6EA 2PCUA 3HLPA 1ZG8A 4A94A 3GKRA 1YSJA 4ZY1A 4F0XA 1S7KA 3VWDA 1F2OA 5C82A 4YRHA 4UFWA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 4ORFA 5HVGA 3FXTA 3H8GA 2WPXA 2J8RA 1ZG7A 1M4GA 4HNYB 4MHPA 2P6FA 2FCKA 1ZO0A 2HV2A 3LODA 3S9LA 3EKEA 4UCNA 1YR0A 2BL1A 2ZOGA 3GLJA 4NGSA 3JRUA 1QSMA 1Z2LA 3TO6A 2B3UA 2Z3KA 4EVYA 4OIWA 4CS0B 2AFSA 4YFJA 5EBVA 1S7FA 4NSQA 2ABZA 4MY3A 4X3RA 5A28A 2NYQA 3SIJA 5HVFA 1CJWA 4KVXA 2P0WA 3TX8A 1Y0YA 2ZEDA 4KYBA 2BSWA 4MFLA 4FBEA 4WJBA 5IB9A 4ZX8A 2X47A 3B8GA 4ZYQA 2IL4A 3K9TA 2Y0MA 4TWEA 3SJGA 5I0CA 1YW6A 3DR6A 2JDDA 1LANA 1XEBA 4MBUA 2LGRA 4KOYA 1MJAA 3EWPA 2Z3NA 1H8LA 1NE9A 1KWMA 2JEWA 3D4UA 3V38A 1BOBA 3KZWA 4ZBGA 5EMIA 3KQZA 5K8MA 2PC1A 2D4PA 1J4JA 1KZFA 1XF8A 2PJ8A 3EJFA 5DWMA 3H8EA 3KGQA 1ELLP 3N7ZA 4P45A 4A95A 4P4BA 4AXVA 4JZ0A 3SHPA 2REFA 4UFXA 4XPDB 2P6GA 4MFZA 5JGFA 3FEDA 3FYNA 3DDDA 4UEZA 4ZGYB 2A4NA 2AFZA 3I9SA 4E2AA 4WWVA 2Q4ZA 3WC5A 5JPHA 3GQEA 1CBXA 3NFZA 4MFPA 4MHZA 4P44A 4EWTA 3S9NA 4KOUA 3TOAA 3EY5A 3V7ZA 1TKJA 2AFOA 1S7LA 3KR4A 2C6CA 2J8MA 4CGNA 4PXCA 5LRGA 1LFWA 4JVVA 1V0CA 2YNCA 5H86A 3FMCA 3H5ZA 4U9YA 4U9ZA 2XEJA 4OLLA 4EFDA 4QBJA 1HDUA 1SQHA 1CP7A 3EFAA 2WUUA 4YGOA 1VHEA 2B3VA 5IX3A 2F5IA 3PFEA 1FY7A 2B5GA 3GPOA 3EJGA 4R7MA 1TKFA 1WWZA 4MCSA 2F7VA 1X10A 4OP4A 5ELYA 3NH5A 1F2PA 2ODFA 2PJ6A 3G3SA 4TNUA 5D29A 4UF4A 4KVOE 2WPWA 4CRZB 4H89A 2PE3A 3GUXA 3IGRA 2XEIA 5I4MA 2VQYA 3D7DA 3TFYA 2G9DA 4PV6A 3W91A 4LQ6A 2JEVA 2ZEEA 4A37A 4F9VA 1KUYA 2GLFA 1X12A 3B3TA 4MRIA 3TT2A 3FJUA 2PJ1A 4CYOA 4A33A 2FL4A 3MGDA 4P4EA 1XBUA 1TY8A 4B14A 1BPMA 1M4LA 2Q04A 2G3TA 2VXKA 1Y0RA 3HUVA 3BI0A 4QB9A 1Q2DA 3H8FA 1R57A 4CAWA 5HVHA 3I1UA 5IV0A 4X8IA 1Z9UA 1XMBA 2YNDA 3PBEA 4P4IA 4B6ZA 1U6MA 4IAVA 2Q7BA 4A31A 4CPAA 2WZNA 2ACFA 2AFXA 3D2PA 2DPSA 2DPTA 5G21A 2GU2A 4NXYA 1A2ZA 2AFWA 3P2FA 3SI0A 2R8VA 3PP9A 1PUAA 1Z4RA 4IHMA 4C7HA 4R9MA 3LWUA 2ZELA 3PB6X 4HNWB 4JLYA 4AVCA 4AG7A 1Q2CA 2ZEPA 3JZTA 4JJXA 3BJ8A
chains in the Genus database with same CATH topology
1CX8A 4X2TA 1TXRA 1F57A 3BHXA 2V8VA 8CPAA 1BLLE 3V2BA 3MRUA 4ETKA 3K2KA 5LRJA 4R76A 3NH4A 1CPSA 2V8HA 2AFUA 3IIFA 4MHYA 3PBBA 4NGRA 3V45A 2PIZA 3QNVA 2C6PA 3IC1A 4P6YA 3GPQA 2POKA 1ZLHA 1R43A 2GREA 2JBJA 2XD7A 3SJXA 1HEEA 1XRYA 3SJEA 1SPVA 3CDXA 1XJOA 2F8HA 3ISZA 1DTDA 4MCPA 3D67A 3KI9A 4TU0A 5K8NA 3Q71A 3D7GA 4Z65A 5D8NA 3FEEA 4F8ZA 1Z5RA 5JM6A 5DUSA 2ZEHA 3PFOA 1DE4C 3VFQA 4OC2A 6CPAA 5LYDA 4DJLA 2QVPA 3B3WA 3PB8X 2PJAA 1ARMA 4F9UA 3NH8A 2ZOFA 3D68A 2PJ4A 3N5FA 4NFRA 4P4FA 3TC8A 5LRKA 3PRTA 3FF3A 4P4JA 3WC7A 2PVVA 1XFOA 2L8RA 1HDQA 3FECA 1YW4A 5HIHA 4FUUA 1YD9A 3KQXA 2XEGA 4NGMA 3D66A 1HJZA 2JBKA 1VIXA 3FX6A 3GQOA 4ETJA 4GVWA 4ZI6A 3PB4X 3EWRA 3S9MA 3FVLA 4UIAA 1VHUA 1IGBA 5CB3A 2PRQA 2ZENA 3IIDA 2PJ3A 4G1PA 2ZEMA 4PPZA 2HB6A 4YU9A 4GVVA 2EWBA 2VRIA 5LYIA 3PEIA 2PJBA 4PXDA 1PCAA 1BPNA 2CF4A 3WT4A 1QMUA 5JH9A 2PVWA 2XEFA 1ZR5A 4NGQA 5K8PA 2GLJA 5CB5A 4JYWA 3WC6A 1VHOA 4PQAA 3BI1A 3KHZA 3SIGA 5HXDA 4H2KA 4K0CA 1QQ9A 5FSXA 5LYFA 3FH4A 4BD9A 3B7IA 2NSMA 1Q7LA 2CTBA 3CPAA 2CIJA 1GYTA 4UEEA 3IEHA 4NJRA 3IFEA 2DEAA 3B35A 4NGPA 1IY7A 2ANPA 1CP6A 1TF8A 2AFMA 3LMSA 4FAIA 4OC1A 2CTCA 1Y7EA 4OKOA 4PXBA 3WABA 4O23A 2EK9A 4K3NA 2RB7A 2VL1A 4ESSA 2V77A 4UEFA 2PJ9A 2ZEGA 4JCAA 3VH9A 1R3NA 2PJ7A 3SJFA 4OIDA 4ABLA 1FT7A 2IMOA 3Q6ZA 3B3SA 1AMPA 2QYVA 2V8GA 4P4DA 4EMEA 2FG1A 5FSVA 1UWYA 3B2YA 4ABKA 2OR4A 2BFRA 2BCOA 3B3CA 4JLLA 4ONWA 3CPXA 2IQ6A 3VARA 3KL9A 4P10A 1LCPA 4MXUA 5E3BA 2FVGA 3D7FA 3VATA 3KHXA 1JQGA 2J9AA 4IK2A 1RTQA 3DLJA 1CPXA 1LOKA 3SI2A 4DYOA 3EW5A 3GPGA 3SIIA 3PB7X 2ZEFA 5FSZA 5AILA 3KASA 3RAMA 1LAPA 2AFCA 1AYEA 2C6GA 4R6TA 5F09A 4UMLA 3IIBA 5J1QA 1FNOA 4OMEA 4UIBA 1OBRA 4MCRA 3KR5A 4GUAA 4OC4A 1ZG9A 2HC9A 2WYRA 4MHNA 4OC0A 5DS0A 3EWQA 4MMOA 2PJ2A 4NGTA 2PJ5A 5LYLA 4J5QA 4J5SA 1LAMA 2BO9A 4DUKA 4Q7AA 4ZY0A 2V8DA 2BFQA 4GM5A 1TF9A 5CPAA 4JGKA 2FAVA 5CBMA 2DX6A 5CMSA 3MN8A 5THWA 4RUHA 4IQYA 1NSAA 4MCQA 2Q51A 5HOLA 3GB0A 4ZX9A 4NGNA 2C1CA 4FWUA 4J5RA 3L2NA 3T8WA 3BXMA 4D86A 1EE3P 3SI1A 3PB9X 3IJ3A 4R8FA 3RZAA 3DGVA 2O4HA 4ZY2A 1PYTB 3IWWA 5FSUA 3CT9A 4PXEA 7CPAA 1TKHA 4J4ZA 3EWOA 1YMEA 3ETIA 2QJ8A 4W9YA 1VGYA 2ZEOA 3NA6A 4A39A 1ZR3A 3IO1A 2PIYA 2I3CA 1TXZA 2IJZA 1NJRA 2PJCA 2EEEA 3B3VA 2FXKA 2PJ0A 3ISXA 2O53A 1BAVA 1ZLIA 2BOAA 4KSIA 1YLOA 2Q43A 4OC5A 2RFHA 2EK8A 5K8OA 1ELMP 1CG2A 4NJQA 4A38A 5FSYA 1ARLA 3SIHA 2PCUA 3HLPA 1ZG8A 4A94A 1YSJA 4ZY1A 1F2OA 4OC3A 2OOTA 4LQGA 1Z8LA 3D7HA 5HVGA 3H8GA 4MHPA 1ZG7A 3S9LA 3EKEA 2ZOGA 3GLJA 4NGSA 3JRUA 1Z2LA 4OIWA 2AFSA 2ABZA 4X3RA 2NYQA 3SIJA 5HVFA 3TX8A 1Y0YA 2ZEDA 4KYBA 4FBEA 4WJBA 5IB9A 4ZX8A 2X47A 3K9TA 4ZYQA 4TWEA 3SJGA 1YW6A 1LANA 2LGRA 3EWPA 1H8LA 1KWMA 2JEWA 3D4UA 3V38A 3KZWA 5K8MA 3KQZA 2PJ8A 3EJFA 3H8EA 3KGQA 1ELLP 4AXVA 4P45A 4P4BA 4JZ0A 5JGFA 3FEDA 4UEZA 2AFZA 4WWVA 2Q4ZA 3WC5A 3GQEA 1CBXA 3NFZA 4MHZA 4P44A 4EWTA 3S9NA 3V7ZA 1TKJA 2AFOA 3KR4A 2C6CA 4PXCA 5LRGA 1LFWA 4JVVA 3FMCA 2XEJA 4EFDA 1HDUA 1CP7A 1VHEA 3PFEA 1TKFA 3GPOA 3RBUA 3EJGA 4R7MA 4MCSA 4OP4A 5ELYA 2F7VA 4YWYA 3NH5A 1F2PA 2PJ6A 4TNUA 5D29A 4UF4A 2PE3A 3GUXA 5I4MA 2XEIA 3D7DA 2G9DA 2ZEEA 4A37A 4F9VA 2GLFA 3B3TA 4MRIA 3FJUA 2PJ1A 4P4EA 1XBUA 1TY8A 1BPMA 1M4LA 3HUVA 1Y0RA 3BI0A 3H8FA 5HVHA 3I1UA 4X8IA 1XMBA 3PBEA 4P4IA 4B6ZA 4IAVA 4CPAA 2WZNA 2ACFA 2AFXA 2GU2A 2AFWA 3SI0A 4IHMA 3LWUA 2ZELA 3PB6X 2ZEPA 3JZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3V2B A;  3MRU A;  4ETK A;  3K2K A;  5LRJ A;  4R76 A;  3NH4 A;  1CPS A;  2V8H A;  2AFU A;  3IIF A;  4MHY A;  3PBB A;  4NGR A;  3V45 A;  2PIZ A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  3GPQ A;  2POK A;  1ZLH A;  1R43 A;  2GRE A;  2JBJ A;  2XD7 A;  3SJX A;  1HEE A;  1XRY A;  3SJE A;  1SPV A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  1DTD A;  4MCP A;  3D67 A;  3KI9 A;  4TU0 A;  5K8N A;  3Q71 A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  5JM6 A;  5DUS A;  2ZEH A;  3PFO A;  1DE4 C;  3VFQ A;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4NFR A;  4P4F A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  2L8R A;  1HDQ A;  3FEC A;  1YW4 A;  5HIH A;  4FUU A;  1YD9 A;  3KQX A;  2XEG A;  4NGM A;  3D66 A;  1HJZ A;  2JBK A;  1VIX A;  3FX6 A;  3GQO A;  4ETJ A;  4GVW A;  4ZI6 A;  3PB4 X;  3EWR A;  3S9M A;  3FVL A;  4UIA A;  1VHU A;  1IGB A;  5CB3 A;  2PRQ A;  2ZEN A;  3IID A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  4GVV A;  2EWB A;  2VRI A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  2XEF A;  1ZR5 A;  4NGQ A;  5K8P A;  2GLJ A;  5CB5 A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  3SIG A;  5HXD A;  4H2K A;  4K0C A;  1QQ9 A;  5FSX A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  1Y7E A;  4OKO A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  4ESS A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  4JCA A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  4ABL A;  1FT7 A;  2IMO A;  3Q6Z A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  2FG1 A;  5FSV A;  1UWY A;  3B2Y A;  4ABK A;  2OR4 A;  2BFR A;  2BCO A;  3B3C A;  4JLL A;  4ONW A;  3CPX A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  5E3B A;  2FVG A;  3D7F A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3EW5 A;  3GPG A;  3SII A;  3PB7 X;  2ZEF A;  5FSZ A;  5AIL A;  3KAS A;  3RAM A;  1LAP A;  2AFC A;  1AYE A;  2C6G A;  4R6T A;  5F09 A;  4UML A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4GUA A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  3EWQ A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  4J5Q A;  4J5S A;  1LAM A;  2BO9 A;  4DUK A;  4Q7A A;  4ZY0 A;  2V8D A;  2BFQ A;  4GM5 A;  1TF9 A;  5CPA A;  4JGK A;  2FAV A;  5CBM A;  2DX6 A;  5CMS A;  3MN8 A;  5THW A;  4RUH A;  4IQY A;  1NSA A;  4MCQ A;  2Q51 A;  5HOL A;  3GB0 A;  4ZX9 A;  4NGN A;  2C1C A;  4FWU A;  4J5R A;  3L2N A;  3T8W A;  3BXM A;  4D86 A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  1PYT B;  3IWW A;  5FSU A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  4J4Z A;  3EWO A;  1YME A;  3ETI A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  1ZR3 A;  3IO1 A;  2PIY A;  2I3C A;  1TXZ A;  2IJZ A;  1NJR A;  2PJC A;  2EEE A;  3B3V A;  2FXK A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  4KSI A;  1YLO A;  2Q43 A;  4OC5 A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  5FSY A;  1ARL A;  3SIH A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  3EKE A;  2ZOG A;  3GLJ A;  4NGS A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  3SIJ A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4KYB A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  2X47 A;  3K9T A;  4ZYQ A;  4TWE A;  3SJG A;  1YW6 A;  1LAN A;  2LGR A;  3EWP A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3EJF A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  3GQE A;  1CBX A;  3NFZ A;  4MHZ A;  4P44 A;  4EWT A;  3S9N A;  3V7Z A;  1TKJ A;  2AFO A;  3KR4 A;  2C6C A;  4PXC A;  5LRG A;  1LFW A;  4JVV A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  1TKF A;  3GPO A;  3RBU A;  3EJG A;  4R7M A;  4MCS A;  4OP4 A;  5ELY A;  2F7V A;  4YWY A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1TY8 A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  3PBE A;  4P4I A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2ACF A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  2ZEP A;  3JZT A; 
#chains in the Genus database with same CATH topology
 1CX8 A;  4X2T A;  2Z3P A;  1IOF A;  1TXR A;  1F57 A;  3FNC A;  3BHX A;  2FIW A;  2V8V A;  8CPA A;  1BLL E;  2B5G B;  3V2B A;  1NSL A;  2FT0 A;  3SXN A;  2KQV A;  1YGH A;  4ETK A;  3A9L A;  3D8P A;  3GY9 A;  1QSR A;  3MRU A;  3K2K A;  5LRJ A;  4AB7 A;  4R76 A;  1VKC A;  3NH4 A;  1CPS A;  2V8H A;  1XIX A;  2CNT A;  4PSW A;  2AFU A;  1YVO A;  3IIF A;  3GIU A;  4MHY A;  3PBB A;  4NGR A;  3V45 A;  4B11 A;  4XPK A;  3R1K A;  2PIZ A;  1Z8T A;  1Z8W A;  3QNV A;  2W2G A;  1Z4E A;  2C6P A;  3G8W A;  3IC1 A;  4KUB A;  4P6Y A;  3TE4 A;  3GPQ A;  4HKF A;  4QVT A;  2EO8 A;  2POK A;  4M85 A;  2OU2 A;  1ZLH A;  1R43 A;  2GRE A;  2BUE A;  2HQY A;  2JBJ A;  1I12 A;  2XD7 A;  2O28 A;  3DR8 A;  3RNZ A;  3SJX A;  1HEE A;  1XRY A;  2PR1 A;  4UA3 A;  3SJE A;  1SPV A;  1IYK A;  3CDX A;  1XJO A;  2F8H A;  2R7H A;  3F5B A;  2ZXV A;  3ISZ A;  3W6X A;  1B6B A;  1DTD A;  3D67 A;  4MCP A;  4E8O A;  4OAE A;  3KI9 A;  4TU0 A;  3JTK A;  1S60 A;  5K8N A;  2EBJ A;  3VWE A;  3NE8 A;  3Q71 A;  3D7G A;  4UWJ A;  4FD5 A;  4Z65 A;  1PU9 A;  5D8N A;  2OH1 A;  1YVK A;  3BJ7 A;  3FEE A;  3JUW A;  3R95 A;  3TCV A;  4F8Z A;  5HMN A;  3C26 A;  4M3S A;  1QSN A;  2GE3 A;  4CGO A;  2RC4 A;  3FRM A;  1Z5R A;  2J8N A;  1JWQ A;  2HUZ A;  4RS2 A;  5JM6 A;  1OZP A;  2PSW A;  5HH1 A;  5IB0 A;  5DUS A;  3H4Q A;  2ZEH A;  3PFO A;  1DE4 C;  3UY5 A;  4L89 A;  4NCZ A;  3VFQ A;  4OC2 A;  6CPA A;  3CXQ A;  5LYD A;  1IB1 E;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  2Z0Z A;  4HPS A;  1ARM A;  4KLV A;  4F9U A;  3NH8 A;  4JXR A;  4JD6 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  2B4B A;  4NFR A;  4P4F A;  3TC8 A;  5LRK A;  3PRT A;  2JZF A;  4KSA A;  2G3A A;  3FF3 A;  4XNH C;  4P4J A;  1I21 A;  3WC7 A;  2PVV A;  3S6G A;  1XFO A;  4LUA A;  2L8R A;  1HDQ A;  3FEC A;  4CYN A;  5J8F A;  1YW4 A;  4I49 A;  5HIH A;  4UFV A;  3FIX A;  2OB0 A;  1YD9 A;  4FUU A;  1KUV A;  4X5K A;  3KQX A;  2XEG A;  4NGM A;  5A27 A;  2EUI A;  3D66 A;  4R87 A;  1HJZ A;  1IYL A;  3ZZI A;  2D4O A;  2JLM A;  2FE7 A;  1UFH A;  2JBK A;  1VIX A;  3FX6 A;  2H5M A;  2EVN A;  3GQO A;  4ETJ A;  2RNK A;  4GVW A;  4ZI6 A;  2QML A;  3PB4 X;  4F6A A;  3EWR A;  2QEC A;  1M1D A;  1XOV A;  2ARH A;  2ATR A;  3S9M A;  3S6F A;  4II9 A;  3PZJ A;  4C7I A;  3FVL A;  4KS9 A;  4NF1 A;  4UCM A;  1VHU A;  4UIA A;  4XPL A;  1IGB A;  5CB3 A;  2I00 A;  2PRQ A;  2Z3M A;  5F49 A;  2ZEN A;  2YGW A;  3IID A;  3S6K A;  2Q7S A;  3T9Y A;  1IID A;  2PJ3 A;  4G1P A;  2GFQ A;  2ZEM A;  1BO4 A;  1Q2Y A;  4MHD A;  5AGE A;  4PPZ A;  4BMH A;  2HB6 A;  4YU9 A;  4CRY B;  5F46 A;  4GVV A;  4B10 A;  5GCN A;  2EWB A;  2VRI A;  1GHE A;  3EO4 A;  3PEI A;  3IU1 A;  5LYI A;  2PJB A;  4PSX A;  2Q0Y A;  4GS4 A;  4PXD A;  4AVA A;  1PCA A;  1BPN A;  1WK4 A;  4KOS A;  2CF4 A;  3KKW A;  5F48 A;  3FB3 A;  5F47 A;  3WT4 A;  3PGP A;  1QMU A;  4FD6 A;  5JH9 A;  2PVW A;  2XEF A;  1ZR5 A;  4NGQ A;  5JQ4 A;  1KUX A;  1XE4 A;  3LAC A;  5K8P A;  2PQ8 A;  4RN7 A;  2GLJ A;  5CB5 A;  3RO0 A;  3WR7 A;  4KVM E;  4JYW A;  2Z3O A;  1RXT A;  5AG4 A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  3SIG A;  1CM0 A;  2VI7 A;  4H2K A;  4K0C A;  1QQ9 A;  4J3G A;  4A32 A;  5HXD A;  5FSX A;  5LYF A;  4Y49 C;  2REE A;  4KZT A;  3FH4 A;  3TOB A;  4BD9 A;  3B7I A;  4B12 A;  2NSM A;  1Q7L A;  4KOW A;  3BLN A;  3R9G A;  2CTB A;  3CPA A;  3P2H A;  4KUA A;  3D3S A;  2YNC C;  3S6H A;  4DNC A;  2YNE A;  2CIJ A;  4M6H A;  3TO9 A;  4CAE A;  1GYT A;  4UEE A;  4KOT A;  3IEH A;  4NEX A;  4NJR A;  5DWN A;  2Q4Y A;  5C88 A;  5G20 A;  4A30 A;  3IFE A;  3R9E A;  5G22 A;  2DEA A;  3B35 A;  4B5P A;  4NGP A;  1IY7 A;  2ANP A;  2FIA A;  1CP6 A;  3RBU A;  1TF8 A;  3K9U A;  2AFM A;  3LMS A;  3ZJ0 A;  4KLW A;  4FAI A;  1I1D A;  2K5T A;  4OC1 A;  2CTC A;  1Y7E A;  3QAH A;  4M6G A;  2GIV A;  4OKO A;  4PXB A;  2ZW6 A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  1RO5 A;  2RB7 A;  2VL1 A;  2ZPA A;  4ESS A;  2V77 A;  2Z11 A;  4UEF A;  1IIC A;  2PJ9 A;  1P0H A;  2ZEG A;  3QB8 A;  4JCA A;  3SXO A;  3VH9 A;  1R3N A;  2PJ7 A;  3W6S A;  1QST A;  2FS5 A;  3SJF A;  1YLE A;  4BBH A;  2R98 A;  2CXA A;  2FSR A;  4OID A;  1XMT A;  2GAN A;  1M4I A;  4ABL A;  1FT7 A;  1VHS A;  2IMO A;  4AG9 A;  3Q6Z A;  3B3S A;  1AMP A;  4FD7 A;  4MJ8 A;  3R96 A;  4UWI A;  4A2Z A;  2G0B A;  3D2M A;  2QYV A;  2B4D B;  2OZU A;  2V8G A;  4P4D A;  2B58 A;  4EME A;  1MJ9 A;  3F8K A;  2FG1 A;  5FSV A;  1S3Z A;  1UWY A;  4ABK A;  2KCW A;  2OR4 A;  3B2Y A;  4IUS A;  4AVB A;  2BFR A;  1IOI A;  2BCO A;  2AE6 A;  3B3C A;  4JLL A;  2QIR A;  4ONW A;  3R9F A;  3CPX A;  3T90 A;  5CNP A;  2IQ6 A;  4C2X A;  4B5O A;  3VAR A;  3KL9 A;  4KOR A;  1Y9W A;  2DXQ A;  4P10 A;  1LCP A;  2NMT A;  4MXU A;  4B13 A;  4KSF A;  5E3B A;  2FVG A;  2Z3L A;  3D7F A;  4MFQ A;  3VAT A;  5BWA B;  2ZW5 A;  3KHX A;  1JQG A;  2Q4V A;  2J9A A;  4IK2 A;  1M4D A;  1RTQ A;  1MK4 A;  3DLJ A;  4Q36 A;  1CPX A;  1LOK A;  1QSO A;  3SI2 A;  4DYO A;  1LRZ A;  4KOX A;  3EW5 A;  3GPG A;  3SII A;  4JXQ A;  3PB7 X;  2ZEF A;  2WSA A;  1AUG A;  2Q44 A;  5FSZ A;  1TIQ A;  5AIL A;  2Z10 A;  3EC4 A;  3KAS A;  5FVJ A;  3RAM A;  4CGM A;  1LAP A;  2VZY A;  2AFC A;  3QAY A;  1AYE A;  4CAF A;  2C6G A;  4UCP A;  4R6T A;  5F09 A;  4UML A;  3OWC A;  4QUS A;  4HNX B;  5ISV A;  3IIB A;  3EXN A;  5J1Q A;  2X7B A;  1N71 A;  1FNO A;  4KOV A;  3I3G A;  4OME A;  5AG6 A;  4CAV A;  1Y9K A;  2B4D A;  5EC4 A;  4CGP A;  4UIB A;  1OBR A;  3IU2 A;  1B87 A;  3CXP A;  4MCR A;  3KR5 A;  4GUA A;  2VEZ A;  4H6U A;  3CZX A;  4OAD A;  1ZG9 A;  4OC4 A;  2PRB A;  3TO7 A;  2HC9 A;  2WYR A;  4MHN A;  2CY2 A;  2DF5 A;  3E0K A;  4OC0 A;  5DS0 A;  3EWQ A;  2R1I A;  5H84 A;  5KTD A;  4R3K A;  2FXF A;  4LX9 A;  4MMO A;  4XPD C;  3F0A A;  1Y7R A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  2BEI A;  4J5Q A;  1L0C A;  4J5S A;  1LAM A;  2BO9 A;  4XNH B;  2JZD A;  1YRE A;  3IWE A;  4DUK A;  4Q7A A;  4ZY0 A;  2V8D A;  2BFQ A;  1K4J A;  4GM5 A;  1TF9 A;  2I79 A;  2ZW4 A;  4K30 A;  4L8A A;  1YX0 A;  1MJB A;  4UBR A;  5CPA A;  4JGK A;  2FAV A;  5CBM A;  4R3L A;  2DX6 A;  5CMS A;  4QC6 A;  3MN8 A;  5THW A;  4RUH A;  4IQY A;  3RYO A;  1NSA A;  3DSB A;  4MCQ A;  2Q51 A;  5HOL A;  1Z8X A;  3GB0 A;  4ZX9 A;  3JVN A;  4NGN A;  1IU8 A;  2C1C A;  3IWG A;  4F0Y A;  4FWU A;  4J5R A;  2OZH A;  3L2N A;  4B5P B;  1S5K A;  3T8W A;  4YWY A;  4RI1 A;  3BXM A;  4D86 A;  1EE3 P;  1M44 A;  2CNS A;  3SI1 A;  4Y49 B;  3PB9 X;  3IJ3 A;  4R8F A;  5G1Z A;  3RZA A;  3DGV A;  4JWP A;  4CYQ A;  1P4N A;  4IF5 A;  4C68 A;  3DNS A;  2O4H A;  4ZY2 A;  2JDC A;  4BIN A;  4E0A A;  2VZZ A;  1PYT B;  3IWW A;  5FSU A;  3NE7 A;  2ZW7 A;  2AJ6 A;  3CT9 A;  1ON0 A;  4PXE A;  7CPA A;  1TKH A;  2PDO A;  4MFJ A;  4J4Z A;  4MFK A;  4ONU A;  5KTA A;  3EWO A;  2WCT A;  1YME A;  1YQE A;  3ETI A;  2QJ8 A;  4W9Y A;  1VGY A;  2VBQ A;  2ZEO A;  4FD4 A;  1YK3 A;  2CNM A;  3CXS A;  3NA6 A;  4A39 A;  1ZR3 A;  3IO1 A;  2PIY A;  2I3C A;  4U5Y A;  1TXZ A;  2IJZ A;  1NJR A;  2PJC A;  2EEE A;  3B3V A;  5AG7 A;  4PK3 A;  4PK2 A;  2FXK A;  1S7N A;  3TTH A;  2PR8 A;  5AG5 A;  4C2Z A;  5KTC A;  4MI4 A;  2PJ0 A;  4MY0 A;  3ISX A;  2OZG A;  2JZE A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  4KSI A;  1YLO A;  2Q43 A;  3FBU A;  4OC5 A;  3V8I A;  4CGL A;  4R57 A;  2RFH A;  2EK8 A;  4CYP A;  1NMT A;  4GXH A;  4M6I A;  5K8O A;  3GYA A;  1ELM P;  4C2Y A;  5J8C A;  1CG2 A;  5E96 A;  4NJQ A;  2C27 A;  4A38 A;  4CAX A;  5FSY A;  1ARL A;  4H6Z A;  3SIH A;  3LD2 A;  4Q38 A;  2P6E A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  3GKR A;  1YSJ A;  4ZY1 A;  4F0X A;  1S7K A;  3VWD A;  1F2O A;  5C82 A;  4YRH A;  4UFW A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  4ORF A;  5HVG A;  3FXT A;  3H8G A;  2WPX A;  2J8R A;  1ZG7 A;  1M4G A;  4HNY B;  4MHP A;  2P6F A;  2FCK A;  1ZO0 A;  2HV2 A;  3LOD A;  3S9L A;  3EKE A;  4UCN A;  1YR0 A;  2BL1 A;  2ZOG A;  3GLJ A;  4NGS A;  3JRU A;  1QSM A;  1Z2L A;  3TO6 A;  2B3U A;  2Z3K A;  4EVY A;  4OIW A;  4CS0 B;  2AFS A;  4YFJ A;  5EBV A;  1S7F A;  4NSQ A;  2ABZ A;  4MY3 A;  4X3R A;  5A28 A;  2NYQ A;  3SIJ A;  5HVF A;  1CJW A;  4KVX A;  2P0W A;  3TX8 A;  1Y0Y A;  2ZED A;  4KYB A;  2BSW A;  4MFL A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  2X47 A;  3B8G A;  4ZYQ A;  2IL4 A;  3K9T A;  2Y0M A;  4TWE A;  3SJG A;  5I0C A;  1YW6 A;  3DR6 A;  2JDD A;  1LAN A;  1XEB A;  4MBU A;  2LGR A;  4KOY A;  1MJA A;  3EWP A;  2Z3N A;  1H8L A;  1NE9 A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  1BOB A;  3KZW A;  4ZBG A;  5EMI A;  3KQZ A;  5K8M A;  2PC1 A;  2D4P A;  1J4J A;  1KZF A;  1XF8 A;  2PJ8 A;  3EJF A;  5DWM A;  3H8E A;  3KGQ A;  1ELL P;  3N7Z A;  4P45 A;  4A95 A;  4P4B A;  4AXV A;  4JZ0 A;  3SHP A;  2REF A;  4UFX A;  4XPD B;  2P6G A;  4MFZ A;  5JGF A;  3FED A;  3FYN A;  3DDD A;  4UEZ A;  4ZGY B;  2A4N A;  2AFZ A;  3I9S A;  4E2A A;  4WWV A;  2Q4Z A;  3WC5 A;  5JPH A;  3GQE A;  1CBX A;  3NFZ A;  4MFP A;  4MHZ A;  4P44 A;  4EWT A;  3S9N A;  4KOU A;  3TOA A;  3EY5 A;  3V7Z A;  1TKJ A;  2AFO A;  1S7L A;  3KR4 A;  2C6C A;  2J8M A;  4CGN A;  4PXC A;  5LRG A;  1LFW A;  4JVV A;  1V0C A;  2YNC A;  5H86 A;  3FMC A;  3H5Z A;  4U9Y A;  4U9Z A;  2XEJ A;  4OLL A;  4EFD A;  4QBJ A;  1HDU A;  1SQH A;  1CP7 A;  3EFA A;  2WUU A;  4YGO A;  1VHE A;  2B3V A;  5IX3 A;  2F5I A;  3PFE A;  1FY7 A;  2B5G A;  3GPO A;  3EJG A;  4R7M A;  1TKF A;  1WWZ A;  4MCS A;  2F7V A;  1X10 A;  4OP4 A;  5ELY A;  3NH5 A;  1F2P A;  2ODF A;  2PJ6 A;  3G3S A;  4TNU A;  5D29 A;  4UF4 A;  4KVO E;  2WPW A;  4CRZ B;  4H89 A;  2PE3 A;  3GUX A;  3IGR A;  2XEI A;  5I4M A;  2VQY A;  3D7D A;  3TFY A;  2G9D A;  4PV6 A;  3W91 A;  4LQ6 A;  2JEV A;  2ZEE A;  4A37 A;  4F9V A;  1KUY A;  2GLF A;  1X12 A;  3B3T A;  4MRI A;  3TT2 A;  3FJU A;  2PJ1 A;  4CYO A;  4A33 A;  2FL4 A;  3MGD A;  4P4E A;  1XBU A;  1TY8 A;  4B14 A;  1BPM A;  1M4L A;  2Q04 A;  2G3T A;  2VXK A;  1Y0R A;  3HUV A;  3BI0 A;  4QB9 A;  1Q2D A;  3H8F A;  1R57 A;  4CAW A;  5HVH A;  3I1U A;  5IV0 A;  4X8I A;  1Z9U A;  1XMB A;  2YND A;  3PBE A;  4P4I A;  4B6Z A;  1U6M A;  4IAV A;  2Q7B A;  4A31 A;  4CPA A;  2WZN A;  2ACF A;  2AFX A;  3D2P A;  2DPS A;  2DPT A;  5G21 A;  2GU2 A;  4NXY A;  1A2Z A;  2AFW A;  3P2F A;  3SI0 A;  2R8V A;  3PP9 A;  1PUA A;  1Z4R A;  4IHM A;  4C7H A;  4R9M A;  3LWU A;  2ZEL A;  3PB6 X;  4HNW B;  4JLY A;  4AVC A;  4AG7 A;  1Q2C A;  2ZEP A;  3JZT A;  4JJX A;  3BJ8 A; 
#chains in the Genus database with same CATH homology
 1CX8 A;  4X2T A;  1TXR A;  1F57 A;  3BHX A;  2V8V A;  8CPA A;  1BLL E;  3V2B A;  3MRU A;  4ETK A;  3K2K A;  5LRJ A;  4R76 A;  3NH4 A;  1CPS A;  2V8H A;  2AFU A;  3IIF A;  4MHY A;  3PBB A;  4NGR A;  3V45 A;  2PIZ A;  3QNV A;  2C6P A;  3IC1 A;  4P6Y A;  3GPQ A;  2POK A;  1ZLH A;  1R43 A;  2GRE A;  2JBJ A;  2XD7 A;  3SJX A;  1HEE A;  1XRY A;  3SJE A;  1SPV A;  3CDX A;  1XJO A;  2F8H A;  3ISZ A;  1DTD A;  4MCP A;  3D67 A;  3KI9 A;  4TU0 A;  5K8N A;  3Q71 A;  3D7G A;  4Z65 A;  5D8N A;  3FEE A;  4F8Z A;  1Z5R A;  5JM6 A;  5DUS A;  2ZEH A;  3PFO A;  1DE4 C;  3VFQ A;  4OC2 A;  6CPA A;  5LYD A;  4DJL A;  2QVP A;  3B3W A;  3PB8 X;  2PJA A;  1ARM A;  4F9U A;  3NH8 A;  2ZOF A;  3D68 A;  2PJ4 A;  3N5F A;  4NFR A;  4P4F A;  3TC8 A;  5LRK A;  3PRT A;  3FF3 A;  4P4J A;  3WC7 A;  2PVV A;  1XFO A;  2L8R A;  1HDQ A;  3FEC A;  1YW4 A;  5HIH A;  4FUU A;  1YD9 A;  3KQX A;  2XEG A;  4NGM A;  3D66 A;  1HJZ A;  2JBK A;  1VIX A;  3FX6 A;  3GQO A;  4ETJ A;  4GVW A;  4ZI6 A;  3PB4 X;  3EWR A;  3S9M A;  3FVL A;  4UIA A;  1VHU A;  1IGB A;  5CB3 A;  2PRQ A;  2ZEN A;  3IID A;  2PJ3 A;  4G1P A;  2ZEM A;  4PPZ A;  2HB6 A;  4YU9 A;  4GVV A;  2EWB A;  2VRI A;  5LYI A;  3PEI A;  2PJB A;  4PXD A;  1PCA A;  1BPN A;  2CF4 A;  3WT4 A;  1QMU A;  5JH9 A;  2PVW A;  2XEF A;  1ZR5 A;  4NGQ A;  5K8P A;  2GLJ A;  5CB5 A;  4JYW A;  3WC6 A;  1VHO A;  4PQA A;  3BI1 A;  3KHZ A;  3SIG A;  5HXD A;  4H2K A;  4K0C A;  1QQ9 A;  5FSX A;  5LYF A;  3FH4 A;  4BD9 A;  3B7I A;  2NSM A;  1Q7L A;  2CTB A;  3CPA A;  2CIJ A;  1GYT A;  4UEE A;  3IEH A;  4NJR A;  3IFE A;  2DEA A;  3B35 A;  4NGP A;  1IY7 A;  2ANP A;  1CP6 A;  1TF8 A;  2AFM A;  3LMS A;  4FAI A;  4OC1 A;  2CTC A;  1Y7E A;  4OKO A;  4PXB A;  3WAB A;  4O23 A;  2EK9 A;  4K3N A;  2RB7 A;  2VL1 A;  4ESS A;  2V77 A;  4UEF A;  2PJ9 A;  2ZEG A;  4JCA A;  3VH9 A;  1R3N A;  2PJ7 A;  3SJF A;  4OID A;  4ABL A;  1FT7 A;  2IMO A;  3Q6Z A;  3B3S A;  1AMP A;  2QYV A;  2V8G A;  4P4D A;  4EME A;  2FG1 A;  5FSV A;  1UWY A;  3B2Y A;  4ABK A;  2OR4 A;  2BFR A;  2BCO A;  3B3C A;  4JLL A;  4ONW A;  3CPX A;  2IQ6 A;  3VAR A;  3KL9 A;  4P10 A;  1LCP A;  4MXU A;  5E3B A;  2FVG A;  3D7F A;  3VAT A;  3KHX A;  1JQG A;  2J9A A;  4IK2 A;  1RTQ A;  3DLJ A;  1CPX A;  1LOK A;  3SI2 A;  4DYO A;  3EW5 A;  3GPG A;  3SII A;  3PB7 X;  2ZEF A;  5FSZ A;  5AIL A;  3KAS A;  3RAM A;  1LAP A;  2AFC A;  1AYE A;  2C6G A;  4R6T A;  5F09 A;  4UML A;  3IIB A;  5J1Q A;  1FNO A;  4OME A;  4UIB A;  1OBR A;  4MCR A;  3KR5 A;  4GUA A;  4OC4 A;  1ZG9 A;  2HC9 A;  2WYR A;  4MHN A;  4OC0 A;  5DS0 A;  3EWQ A;  4MMO A;  2PJ2 A;  4NGT A;  2PJ5 A;  5LYL A;  4J5Q A;  4J5S A;  1LAM A;  2BO9 A;  4DUK A;  4Q7A A;  4ZY0 A;  2V8D A;  2BFQ A;  4GM5 A;  1TF9 A;  5CPA A;  4JGK A;  2FAV A;  5CBM A;  2DX6 A;  5CMS A;  3MN8 A;  5THW A;  4RUH A;  4IQY A;  1NSA A;  4MCQ A;  2Q51 A;  5HOL A;  3GB0 A;  4ZX9 A;  4NGN A;  2C1C A;  4FWU A;  4J5R A;  3L2N A;  3T8W A;  3BXM A;  4D86 A;  1EE3 P;  3SI1 A;  3PB9 X;  3IJ3 A;  4R8F A;  3RZA A;  3DGV A;  2O4H A;  4ZY2 A;  1PYT B;  3IWW A;  5FSU A;  3CT9 A;  4PXE A;  7CPA A;  1TKH A;  4J4Z A;  3EWO A;  1YME A;  3ETI A;  2QJ8 A;  4W9Y A;  1VGY A;  2ZEO A;  3NA6 A;  4A39 A;  1ZR3 A;  3IO1 A;  2PIY A;  2I3C A;  1TXZ A;  2IJZ A;  1NJR A;  2PJC A;  2EEE A;  3B3V A;  2FXK A;  2PJ0 A;  3ISX A;  2O53 A;  1BAV A;  1ZLI A;  2BOA A;  4KSI A;  1YLO A;  2Q43 A;  4OC5 A;  2RFH A;  2EK8 A;  5K8O A;  1ELM P;  1CG2 A;  4NJQ A;  4A38 A;  5FSY A;  1ARL A;  3SIH A;  2PCU A;  3HLP A;  1ZG8 A;  4A94 A;  1YSJ A;  4ZY1 A;  1F2O A;  4OC3 A;  2OOT A;  4LQG A;  1Z8L A;  3D7H A;  5HVG A;  3H8G A;  4MHP A;  1ZG7 A;  3S9L A;  3EKE A;  2ZOG A;  3GLJ A;  4NGS A;  3JRU A;  1Z2L A;  4OIW A;  2AFS A;  2ABZ A;  4X3R A;  2NYQ A;  3SIJ A;  5HVF A;  3TX8 A;  1Y0Y A;  2ZED A;  4KYB A;  4FBE A;  4WJB A;  5IB9 A;  4ZX8 A;  2X47 A;  3K9T A;  4ZYQ A;  4TWE A;  3SJG A;  1YW6 A;  1LAN A;  2LGR A;  3EWP A;  1H8L A;  1KWM A;  2JEW A;  3D4U A;  3V38 A;  3KZW A;  5K8M A;  3KQZ A;  2PJ8 A;  3EJF A;  3H8E A;  3KGQ A;  1ELL P;  4AXV A;  4P45 A;  4P4B A;  4JZ0 A;  5JGF A;  3FED A;  4UEZ A;  2AFZ A;  4WWV A;  2Q4Z A;  3WC5 A;  3GQE A;  1CBX A;  3NFZ A;  4MHZ A;  4P44 A;  4EWT A;  3S9N A;  3V7Z A;  1TKJ A;  2AFO A;  3KR4 A;  2C6C A;  4PXC A;  5LRG A;  1LFW A;  4JVV A;  3FMC A;  2XEJ A;  4EFD A;  1HDU A;  1CP7 A;  1VHE A;  3PFE A;  1TKF A;  3GPO A;  3RBU A;  3EJG A;  4R7M A;  4MCS A;  4OP4 A;  5ELY A;  2F7V A;  4YWY A;  3NH5 A;  1F2P A;  2PJ6 A;  4TNU A;  5D29 A;  4UF4 A;  2PE3 A;  3GUX A;  5I4M A;  2XEI A;  3D7D A;  2G9D A;  2ZEE A;  4A37 A;  4F9V A;  2GLF A;  3B3T A;  4MRI A;  3FJU A;  2PJ1 A;  4P4E A;  1XBU A;  1TY8 A;  1BPM A;  1M4L A;  3HUV A;  1Y0R A;  3BI0 A;  3H8F A;  5HVH A;  3I1U A;  4X8I A;  1XMB A;  3PBE A;  4P4I A;  4B6Z A;  4IAV A;  4CPA A;  2WZN A;  2ACF A;  2AFX A;  2GU2 A;  2AFW A;  3SI0 A;  4IHM A;  3LWU A;  2ZEL A;  3PB6 X;  2ZEP A;  3JZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...