3H8EA

Low ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
473
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGIMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 156
structure length 473
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8eA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8eA02
1TKJA 1EE3P 3HUVA 5LYDA 3L2NA 2C1CA 2PJBA 2IJZA 4K0CA 3HLPA 3FEEA 1CBXA 1HDUA 3DGVA 2ACFA 1ZLHA 5AILA 3D4UA 3PBEA 4NGPA 3WABA 3GPQA 2EEEA 2EWBA 1HJZA 2EK8A 5E3BA 2PVWA 3GPGA 3D7FA 1ZR5A 4MHNA 1ZG9A 1ZR3A 3EW5A 3SJEA 2ZEHA 3I1UA 4P44A 4AXVA 1ELLP 3H8GA 2XEIA 4OP4A 3VFQA 3VATA 3EJFA 3EWRA 1H8LA 4X3RA 3CDXA 1M4LA 2C6PA 3SJXA 1Y7EA 2CIJA 4JGKA 4KYBA 4MXUA 1AYEA 2PJCA 3PB6X 1YD9A 4OIWA 3PEIA 3JZTA 1DTDA 4J5SA 4ZX9A 3SI2A 5HVHA 3TC8A 5FSYA 5CB5A 3IIDA 2BO9A 4YWYA 4G1PA 4DYOA 2ZEFA 2V8VA 1KWMA 3GUXA 5HIHA 3SJGA 3SIHA 5K8OA 4MCPA 4GUAA 1CX8A 3WT4A 1VHUA 4NGRA 4ABLA 2C6GA 4O23A 1LOKA 4MHPA 4PXEA 4P4EA 1TKFA 4LQGA 2XEFA 3PRTA 4Z65A 2ZELA 2ZEGA 2F8HA 2J9AA 2C6CA 3IIFA 4MCSA 5LYFA 1QQ9A 1Z5RA 3D66A 4R8FA 4PPZA 4TWEA 5ELYA 1R43A 2BFRA 3GQOA 3BI1A 2PCUA 2HC9A 4IQYA 3PB8X 3KR4A 3V45A 3TX8A 5FSUA 2AFXA 2CTCA 4JVVA 3Q71A 4GVVA 4UEEA 1ARLA 5K8PA 5K8MA 1F57A 2PJ4A 2PJ8A 3D67A 4NGTA 2G9DA 4ZY1A 2GREA 4OC3A 2JBKA 4JZ0A 3IEHA 2AFZA 2VL1A 4MCRA 2V8GA 3ISXA 1HEEA 4FWUA 3B3SA 4BD9A 3WC7A 4R6TA 2XEGA 3S9LA 4PXDA 1TF8A 1BAVA 3B2YA 3CT9A 2ZEEA 3QNVA 3KHZA 6CPAA 3Q6ZA 2L8RA 4OC1A 1IGBA 3GPOA 4PXBA 1PYTB 4UMLA 1YW6A 2V8DA 3S9NA 4J4ZA 4R7MA 2Q43A 3GB0A 4P4BA 4GM5A 4ZYQA 4P4DA 3ISZA 1XMBA 3V38A 4X8IA 3IWWA 1VIXA 4K3NA 3MN8A 3KGQA 2ZEOA 1VHOA 2WYRA 2NSMA 4OC0A 5I4MA 4P10A 2LGRA 4FAIA 1Y0RA 3B3TA 3EKEA 4R76A 1ZG8A 2O4HA 3NH5A 1IY7A 2HB6A 2XEJA 2GLFA 5JM6A 2PJ0A 3D7DA 4PXCA 1TKHA 2PJ6A 1ZG7A 2BCOA 4IAVA 3SI1A 4NGMA 3S9MA 1OBRA 3SI0A 1BPNA 4OIDA 2FG1A 3PFEA 4NJQA 4F8ZA 3EJGA 3KHXA 3KQXA 4NGNA 3VARA 3FECA 5CMSA 5FSZA 1Z2LA 2ZENA 4H2KA 4FBEA 4OC4A 4D86A 1VGYA 5LRKA 2FAVA 1CP6A 4A94A 1JQGA 2ZOGA 4ZY2A 3FVLA 3FX6A 1UWYA 1XFOA 3SIIA 2IMOA 2BFQA 2PJ5A 2QYVA 3PB9X 3N5FA 4PQAA 5CB3A 5D8NA 1YSJA 2PVVA 5HOLA 3RBUA 4UIBA 5HXDA 3VH9A 1VHEA 4P4JA 2ZEPA 2JEWA 3CPXA 3IFEA 3ETIA 5D29A 2F7VA 3WC5A 4UF4A 3JRUA 2ZEDA 4ABKA 3PB4X 2OR4A 4NJRA 2PE3A 3K2KA 1BLLE 1CP7A 3PB7X 3IJ3A 3KZWA 3BXMA 3B3VA 1GYTA 4MMOA 3FH4A 5DS0A 4UEFA 5F09A 1AMPA 4F9VA 4RUHA 1XJOA 3KQZA 4DJLA 4MRIA 4A38A 4X2TA 1LCPA 1YLOA 2O53A 5HVFA 3KR5A 5LYLA 2AFSA 1YMEA 5DUSA 3EWPA 5CPAA 1YW4A 5LYIA 3B7IA 3IC1A 4EMEA 1LANA 4KSIA 4CPAA 3KL9A 4MHYA 4OKOA 2RFHA 1QMUA 4JCAA 3NH4A 2ANPA 3NFZA 4JYWA 3LMSA 3PBBA 2V8HA 3KI9A 2CTBA 4TNUA 2AFMA 4Q7AA 1Q7LA 3D68A 4P6YA 3H8FA 3BI0A 1ARMA 4ESSA 4WWVA 7CPAA 5LRJA 1LFWA 5LRGA 1NJRA 4ONWA 4IK2A 3FEDA 3CPAA 5JH9A 5K8NA 5FSVA 3GQEA 2ZEMA 4ZY0A 1RTQA 5FSXA 1R3NA 4P4FA 4ZI6A 3B35A 2RB7A 4YU9A 3WC6A 3EWQA 3T8WA 1CG2A 5J1QA 3BHXA 2POKA 1TXRA 5HVGA 2AFCA 4NFRA 1SPVA 4DUKA 4MCQA 1TY8A 4NGQA 1FNOA 2AFUA 2PJ1A 3NH8A 2ZOFA 2CF4A 2FVGA 3V7ZA 1Y0YA 4W9YA 1CPSA 3KASA 4B6ZA 2VRIA 4F9UA 3D7GA 2ABZA 2FXKA 3D7HA 2NYQA 1ZLIA 4A37A 2BOAA 4NGSA 4FUUA 4EFDA 4EWTA 1F2OA 3EWOA 1PCAA 1LAMA 1F2PA 3NA6A 1HDQA 2OOTA 2JBJA 4P45A 4WJBA 2GU2A 3V2BA 3DLJA 2PJ7A 3PFOA 2PJAA 4JLLA 2I3CA 1CPXA 2QVPA 2PJ3A 2PRQA 3FMCA 4A39A 4OC5A 3K9TA 2EK9A 3FF3A 2QJ8A 4OC2A 3IO1A 3SJFA 3LWUA 3SIGA 1XRYA 1XBUA 4IHMA 8CPAA 4J5QA 2DEAA 2XD7A 2DX6A 3B3CA 4ETJA 2Q51A 4GVWA 1ELMP 4J5RA 1DE4C 4TU0A 1TXZA 2X47A 2PJ9A 1TF9A 2AFWA 3SIJA 2V77A 4UIAA 3GLJA 3MRUA 1Z8LA 2GLJA 2Q4ZA 4ZX8A 2PIYA 2AFOA 3FJUA 1NSAA 2WZNA 3B3WA 3RAMA 4OMEA 4P4IA 1BPMA 2PIZA 5THWA 2PJ2A 1FT7A 5CBMA 2IQ6A 3IIBA 4ETKA 3H8EA 4MHZA 4UEZA 5JGFA 1LAPA 5IB9A 3RZAA
chains in the Genus database with same CATH superfamily
4XPLA 1TKJA 1Z8WA 3R96A 1EE3P 3HUVA 4RN7A 5LYDA 3FIXA 3NE8A 2G3AA 1MJBA 2C1CA 3L2NA 4H6UA 4M6GA 4C2ZA 2FCKA 2PJBA 2IJZA 4EVYA 5AG4A 4K0CA 3HLPA 2AJ6A 3FNCA 3FEEA 3FYNA 1CBXA 5F46A 1HDUA 3DGVA 4UCNA 1SQHA 2ACFA 1ZLHA 5AILA 2WPXA 3D4UA 3GY9A 3PBEA 2Z3LA 4KUAA 3GPQA 2EEEA 2EWBA 3MGDA 5G20A 1HJZA 2REEA 2EK8A 5E3BA 2WCTA 2PVWA 3GPGA 2KQVA 4B11A 5A28A 2PQ8A 1ZR5A 3D7FA 3IGRA 4MHNA 2Z3MA 4UFWA 1ZG9A 3TE4A 1ZR3A 3EW5A 4A95A 3SJEA 3T90A 2Q4VA 2ZEHA 2OOTA 3F8KA 2PC1A 3I1UA 1XEBA 4MFKA 5IV0A 4P44A 3D8PA 4AXVA 4M6HA 1ELLP 3H8GA 2XEIA 2C27A 4FD5A 1Z4EA 3IWEA 3VFQA 4OP4A 3VATA 3EJFA 4YFJA 3EWRA 4XPKA 1H8LA 4X3RA 4R57A 3CDXA 2WUUA 1M4LA 1XF8A 5H84A 2C6PA 3SJXA 1Y7EA 2CIJA 4JGKA 4KYBA 2J8MA 2JZEA 3K9UA 4MXUA 3IWGA 1AYEA 1B87A 2CNMA 1YD9A 2PJCA 3PB6X 1A2ZA 4OIWA 4OADA 3PEIA 1P4NA 3EO4A 5F47A 3JZTA 3S6KA 4KLWA 1DTDA 1YX0A 1NMTA 5HH1A 4CGLA 4J5SA 4ZX9A 3SI2A 5HVHA 2OB0A 3TC8A 5FSYA 5CB5A 3IIDA 1TIQA 2BO9A 3DSBA 4YWYA 4G1PA 4DYOA 2ZEFA 1VKCA 2V8VA 1KWMA 2Z3OA 5HIHA 3GUXA 3JUWA 3SJGA 5J8FA 3SIHA 1KUYA 5K8OA 4MCPA 5AGEA 4GUAA 1CX8A 3WT4A 4JJXA 1VHUA 2QECA 4NGRA 4ABLA 2C6GA 4O23A 4CS0B 1LOKA 2DF5A 4MHPA 4PXEA 4M3SA 4P4EA 1TKFA 3W6SA 4XNHC 4LQGA 2VEZA 2XEFA 2Y0MA 1Q2CA 3H4QA 3PRTA 4X5KA 3R9EA 2ODFA 4Z65A 1QSMA 2ZELA 4U5YA 2ZEGA 4KOWA 2F8HA 2J9AA 2C6CA 4Y49C 4CYPA 3IIFA 4MCSA 5LYFA 3IU2A 1QQ9A 1Z5RA 3LACA 3D66A 4R8FA 4PPZA 1S7FA 4TWEA 5ELYA 1R43A 2BFRA 3GQOA 3R95A 3BJ8A 4AVCA 3BI1A 3JTKA 2PCUA 2HC9A 4IQYA 5AG7A 4Q38A 3OWCA 1XMTA 3CXPA 1YLEA 4A33A 4C7HA 2P6FA 3PB8X 3KR4A 3V45A 3TX8A 5FSUA 3R9GA 4KVOE 2AFXA 1YVOA 4PV6A 2CTCA 2EVNA 4JVVA 3Q71A 4GVVA 1QSRA 2P6GA 4UEEA 3TO6A 4E0AA 1ARLA 5K8PA 5K8MA 1F57A 2PJ4A 2PJ8A 3D67A 4KOYA 4MFZA 4NGTA 2G9DA 1Q2YA 2Z3KA 4ZY1A 2GREA 4OC3A 1NE9A 2B4DA 3TO9A 2JBKA 4IF5A 4JZ0A 4B5OA 4CGOA 3CXQA 3IEHA 2AFZA 3H5ZA 2VL1A 2ZW6A 4MCRA 4A31A 4NEXA 2V8GA 4I49A 3ISXA 1HEEA 4FWUA 3B3SA 4BD9A 3D2PA 4GXHA 4R6TA 2XEGA 3WC7A 3S9LA 5G22A 3TOBA 1FY7A 3EC4A 4XPDC 3C26A 2JDDA 4CAXA 4R3LA 1CJWA 1YK3A 5JQ4A 4PXDA 1IOFA 1BAVA 1TF8A 2Z3PA 3B2YA 2OZUA 3DR8A 4MY0A 3CT9A 2ZEEA 3QNVA 4B12A 5A27A 3KHZA 4DNCA 3WABA 3Q6ZA 6CPAA 5KTCA 2L8RA 4OC1A 1IGBA 4MFLA 3GPOA 5EMIA 3N7ZA 3QB8A 1S7NA 4PXBA 2Z11A 3SHPA 4AVAA 1PYTB 4UMLA 3B8GA 5CNPA 1YW6A 2V8DA 3TCVA 1KZFA 1UFHA 4E2AA 4KOTA 4J4ZA 4R7MA 3S9NA 2Q43A 3P2FA 4M85A 3GB0A 4P4BA 4HPSA 4GM5A 4ZYQA 4P4DA 3ISZA 1PU9A 1XMBA 2PR8A 3V38A 4X8IA 2CNTA 4C68A 2FS5A 1VIXA 3IWWA 2F5IA 3G8WA 4K3NA 4L8AA 1KUVA 4KORA 4M6IA 2Q7BA 3VWDA 3MN8A 4RI1A 2IL4A 3KGQA 1YVKA 4B14A 2ZEOA 1VHOA 4NF1A 2Q4YA 1M1DA 4JWPA 2B5GB 2WYRA 4B5PA 4RS2A 2NSMA 4OC0A 2BEIA 3RNZA 4LQ6A 1MJ9A 4Q36A 4E8OA 4Y49B 4CYOA 4AG7A 5I4MA 2YGWA 4P10A 2LGRA 4FAIA 1Y0RA 4NXYA 2J8NA 3EKEA 3B3TA 4KOXA 4R76A 4CYQA 1S3ZA 1ZG8A 2O4HA 3NH5A 2FT0A 1IY7A 2HB6A 4PK3A 4CGMA 1QSTA 2FIWA 1YREA 5C82A 2XEJA 2AE6A 2GLFA 4R87A 1QSOA 5G21A 1BO4A 5JM6A 2PJ0A 4H6ZA 2HQYA 3D7DA 4PXCA 1TKHA 2PJ6A 1ZG7A 2YNCA 2BCOA 4UBRA 4IAVA 3SI1A 4NGMA 4UCPA 4R3KA 1OBRA 3S9MA 3SI0A 2OZHA 4MJ8A 1BPNA 2OH1A 4OIDA 4U9ZA 3GKRA 4MY3A 2FG1A 2YNDA 1IYKA 3PFEA 4NJQA 4F8ZA 3EJGA 1IB1E 4BMHA 3KHXA 3KQXA 1M4DA 4NGNA 3VARA 5E96A 3FECA 5CMSA 5FSZA 1Z2LA 2ZENA 4JLYA 4MHDA 2PSWA 1KUXA 3TTHA 4NGPA 1I1DA 4F0XA 3I3GA 4H2KA 3JVNA 4U9YA 4HNYB 3KKWA 4FBEA 4OC4A 1IYLA 4D86A 1VGYA 1Y9WA 2FAVA 1CP6A 4UFXA 5LRKA 3E0KA 4ORFA 3FXTA 2EUIA 4F0YA 4ZGYB 4A94A 1Q2DA 2FE7A 4B10A 2R8VA 1JQGA 4R9MA 2ZOGA 2R7HA 2CY2A 1ON0A 2REFA 4ZY2A 3FVLA 3FX6A 2H5MA 1OZPA 5EC4A 1UWYA 1XFOA 3SIIA 2IMOA 2BFQA 3S6GA 2PJ5A 4LX9A 2QYVA 1IOIA 3PB9X 2JDCA 1I12A 5DWMA 1N71A 2FSRA 2I79A 4FD6A 3N5FA 4PQAA 5CB3A 4MFPA 5D8NA 4KUBA 3TO7A 1YSJA 2PVVA 4ZBGA 5HOLA 3R9FA 4UWJA 1XOVA 1YR0A 3RBUA 4AVBA 4UIBA 5HXDA 3TT2A 2JZDA 3FRMA 1GHEA 3VH9A 1VHEA 2X7BA 4AG9A 4C2YA 2YNCC 4P4JA 2JZFA 2ZEPA 2WSAA 2JEWA 3CPXA 3IFEA 4HNXB 3UY5A 3CZXA 2G3TA 4UCMA 3ETIA 5D29A 1XE4A 2F7VA 2Q0YA 3WC5A 4CYNA 4UF4A 3JRUA 1CM0A 1RXTA 2ZEDA 3CXSA 3I9SA 4ABKA 3PB4X 2OR4A 3EY5A 4NJRA 2PE3A 5H86A 3K2KA 4ONUA 1BLLE 1CP7A 2FXFA 3DDDA 2Z0ZA 2FL4A 4A2ZA 3PB7X 3IJ3A 2KCWA 1S7LA 1S7KA 2HUZA 4UA3A 3KZWA 3BXMA 4FD4A 3B3VA 3RO0A 4AB7A 1GYTA 1J4JA 2VQYA 4K30A 4MMOA 3EXNA 3FH4A 3W6XA 5DS0A 2DPSA 4UEFA 5F09A 1Z9UA 1AMPA 5F49A 4F9VA 4RUHA 1U6MA 1XJOA 3D2MA 4IUSA 4QBJA 3TFYA 3KQZA 4DJLA 2BL1A 4F6AA 4MRIA 4A38A 4X2TA 1LCPA 1YLOA 2GE3A 4NCZA 4KSFA 2P6EA 2O53A 5HVFA 4CAVA 4YRHA 1S60A 3KR5A 4PK2A 5LYLA 2VZZA 2AFSA 1WWZA 1YGHA 2BUEA 2P0WA 3BJ7A 1V0CA 3GIUA 4JXRA 4KOUA 1YMEA 5DWNA 3S6FA 5DUSA 3PZJA 3QAYA 3EWPA 3SXNA 4BBHA 4YGOA 1B6BA 2JLMA 1Y9KA 5CPAA 4CAEA 1YW4A 1JWQA 5LYIA 3WR7A 2BSWA 2D4PA 1X12A 2PR1A 5HMNA 5G1ZA 3B7IA 2WPWA 3IC1A 3LODA 4EMEA 1LANA 4II9A 4UWIA 4JD6A 3EFAA 4HNWB 4KSIA 1IIDA 3DNSA 3KL9A 4CPAA 1WK4A 4MBUA 4MI4A 4MHYA 4OKOA 2RFHA 4CRZB 4CGNA 5ISVA 2G0BA 2Q7SA 4QVTA 2I00A 1QMUA 2PDOA 4JCAA 2GANA 3NH4A 2ANPA 1I21A 1IICA 4GS4A 4XNHB 3NFZA 2RC4A 1M4IA 2ZW7A 3D3SA 4JYWA 3QAHA 5KTDA 3LMSA 5I0CA 4LUAA 2B3VA 2B58A 2B3UA 2V8HA 3PBBA 3T9YA 3KI9A 1QSNA 2CTBA 4TNUA 2AFMA 2Q44A 4Q7AA 1Q7LA 3D68A 3DR6A 4P6YA 4QUSA 4A32A 1LRZA 3H8FA 3BI0A 2VXKA 4CAFA 1ARMA 1MJAA 4ESSA 4WWVA 7CPAA 4KOVA 5LRJA 2EBJA 1LFWA 5LRGA 4L89A 1NJRA 2ZPAA 4ONWA 4IK2A 3FEDA 3GYAA 3CPAA 5JH9A 5K8NA 1R57A 5FSVA 2B4BA 2VZYA 3TOAA 3GQEA 2ZEMA 4ZY0A 3R1KA 5IX3A 2B5GA 1RTQA 5FSXA 2OU2A 1R3NA 4P4FA 4ZI6A 3B35A 5F48A 2RB7A 4YU9A 3LD2A 3WC6A 3EWQA 3T8WA 1CG2A 5J1QA 4CAWA 3BHXA 4OAEA 3W91A 2POKA 3A9LA 1TXRA 2GIVA 5HVGA 4HKFA 1MK4A 4KOSA 2AFCA 4KS9A 4NFRA 1SPVA 4UFVA 5FVJA 1NSLA 4DUKA 5EBVA 2ARHA 1TY8A 4MCQA 4NGQA 2HV2A 4QC6A 1FNOA 2AFUA 2PJ1A 3NH8A 1M4GA 4A30A 1Y7RA 2JEVA 2D4OA 2ZOFA 2CF4A 2FVGA 4XPDB 2CXAA 2PRBA 4C2XA 3V7ZA 2NMTA 1Y0YA 2Z10A 4OLLA 4W9YA 1CPSA 3KASA 4B6ZA 2VRIA 1Z8TA 3NE7A 4F9UA 2YNEA 3D7GA 4PSWA 4PSXA 2ABZA 3G3SA 4C7IA 5BWAB 4KVME 3FBUA 2FXKA 1K4JA 4KZTA 3D7HA 4KLVA 2NYQA 1ZLIA 4A37A 2BOAA 4NGSA 4FUUA 4MFJA 4EFDA 4EWTA 1VHSA 2R1IA 5GCNA 4CRYB 1F2OA 5AG5A 3EWOA 1PCAA 2Q04A 1LAMA 2J8RA 3SXOA 3V8IA 1F2PA 1S5KA 3F0AA 3NA6A 1HDQA 4MFQA 2JBJA 4NSQA 4P45A 4WJBA 2GU2A 3V2BA 3DLJA 2ATRA 4CGPA 2PJ7A 2DPTA 3PFOA 4J3GA 1X10A 2PJAA 5AG6A 2VI7A 4JLLA 2I3CA 1CPXA 2QVPA 2PJ3A 2PRQA 1Z8XA 4JXQA 3FMCA 2O28A 3F5BA 5JPHA 2QIRA 5J8CA 1IU8A 4A39A 4OC5A 2ZW5A 3K9TA 2EK9A 2B4DB 1RO5A 2QJ8A 2GFQA 3FF3A 4OC2A 3IO1A 3IU1A 3SJFA 3LWUA 3SIGA 1XRYA 1XBUA 4IHMA 8CPAA 4J5QA 4B13A 2DEAA 1PUAA 2XD7A 3P2HA 1XIXA 2DX6A 3B3CA 2RNKA 2CNSA 4ETJA 2Q51A 2R98A 2ZXVA 4GVWA 1ELMP 3BLNA 4QB9A 2Z3NA 3PP9A 4J5RA 3S6HA 1DE4C 4TU0A 1TXZA 2X47A 1AUGA 1Z4RA 1M44A 2PJ9A 1YQEA 4H89A 1TF9A 3FB3A 2AFWA 3SIJA 3PGPA 2FIAA 2EO8A 2V77A 4KSAA 4UIAA 2VBQA 2K5TA 3GLJA 3MRUA 1Z8LA 2ZW4A 2GLJA 4BINA 2Q4ZA 4KVXA 4ZX8A 2PIYA 2AFOA 1ZO0A 1L0CA 3FJUA 1BOBA 1NSAA 2DXQA 2WZNA 2W2GA 3ZJ0A 3B3WA 3RAMA 2OZGA 4OMEA 1P0HA 5KTAA 4P4IA 1BPMA 2PIZA 5THWA 2PJ2A 3VWEA 1FT7A 2QMLA 3RYOA 4B5PB 5CBMA 2IQ6A 3IIBA 3ZZIA 5IB0A 4ETKA 3H8EA 4MHZA 4UEZA 4FD7A 5JGFA 2A4NA 1LAPA 5IB9A 3RZAA 5C88A
chains in the Genus database with same CATH topology
1TKJA 1EE3P 3HUVA 5LYDA 3L2NA 2C1CA 2PJBA 2IJZA 4K0CA 3HLPA 3FEEA 1CBXA 1HDUA 3DGVA 2ACFA 1ZLHA 5AILA 3D4UA 3PBEA 4NGPA 3WABA 3GPQA 2EEEA 2EWBA 1HJZA 2EK8A 5E3BA 2PVWA 3GPGA 3D7FA 1ZR5A 4MHNA 1ZG9A 1ZR3A 3EW5A 3SJEA 2ZEHA 3I1UA 4P44A 4AXVA 1ELLP 3H8GA 2XEIA 4OP4A 3VFQA 3VATA 3EJFA 3EWRA 1H8LA 4X3RA 3CDXA 1M4LA 2C6PA 3SJXA 1Y7EA 2CIJA 4JGKA 4KYBA 4MXUA 1AYEA 2PJCA 3PB6X 1YD9A 4OIWA 3PEIA 3JZTA 1DTDA 4J5SA 4ZX9A 3SI2A 5HVHA 3TC8A 5FSYA 5CB5A 3IIDA 2BO9A 4YWYA 4G1PA 4DYOA 2ZEFA 2V8VA 1KWMA 3GUXA 5HIHA 3SJGA 3SIHA 5K8OA 4MCPA 4GUAA 1CX8A 3WT4A 1VHUA 4NGRA 4ABLA 2C6GA 4O23A 1LOKA 4MHPA 4PXEA 4P4EA 1TKFA 4LQGA 2XEFA 3PRTA 4Z65A 2ZELA 2ZEGA 2F8HA 2J9AA 2C6CA 3IIFA 4MCSA 5LYFA 1QQ9A 1Z5RA 3D66A 4R8FA 4PPZA 4TWEA 5ELYA 1R43A 2BFRA 3GQOA 3BI1A 2PCUA 2HC9A 4IQYA 3PB8X 3KR4A 3V45A 3TX8A 5FSUA 2AFXA 2CTCA 4JVVA 3Q71A 4GVVA 4UEEA 1ARLA 5K8PA 5K8MA 1F57A 2PJ4A 2PJ8A 3D67A 4NGTA 2G9DA 4ZY1A 2GREA 4OC3A 2JBKA 4JZ0A 3IEHA 2AFZA 2VL1A 4MCRA 2V8GA 3ISXA 1HEEA 4FWUA 3B3SA 4BD9A 3WC7A 4R6TA 2XEGA 3S9LA 4PXDA 1TF8A 1BAVA 3B2YA 3CT9A 2ZEEA 3QNVA 3KHZA 6CPAA 3Q6ZA 2L8RA 4OC1A 1IGBA 3GPOA 4PXBA 1PYTB 4UMLA 1YW6A 2V8DA 3S9NA 4J4ZA 4R7MA 2Q43A 3GB0A 4P4BA 4GM5A 4ZYQA 4P4DA 3ISZA 1XMBA 3V38A 4X8IA 3IWWA 1VIXA 4K3NA 3MN8A 3KGQA 2ZEOA 1VHOA 2WYRA 2NSMA 4OC0A 5I4MA 4P10A 2LGRA 4FAIA 1Y0RA 3B3TA 3EKEA 4R76A 1ZG8A 2O4HA 3NH5A 1IY7A 2HB6A 2XEJA 2GLFA 5JM6A 2PJ0A 3D7DA 4PXCA 1TKHA 2PJ6A 1ZG7A 2BCOA 4IAVA 3SI1A 4NGMA 3S9MA 1OBRA 3SI0A 1BPNA 4OIDA 2FG1A 3PFEA 4NJQA 4F8ZA 3EJGA 3KHXA 3KQXA 4NGNA 3VARA 3FECA 5CMSA 5FSZA 1Z2LA 2ZENA 4H2KA 4FBEA 4OC4A 4D86A 1VGYA 5LRKA 2FAVA 1CP6A 4A94A 1JQGA 2ZOGA 4ZY2A 3FVLA 3FX6A 1UWYA 1XFOA 3SIIA 2IMOA 2BFQA 2PJ5A 2QYVA 3PB9X 3N5FA 4PQAA 5CB3A 5D8NA 1YSJA 2PVVA 5HOLA 3RBUA 4UIBA 5HXDA 3VH9A 1VHEA 4P4JA 2ZEPA 2JEWA 3CPXA 3IFEA 3ETIA 5D29A 2F7VA 3WC5A 4UF4A 3JRUA 2ZEDA 4ABKA 3PB4X 2OR4A 4NJRA 2PE3A 3K2KA 1BLLE 1CP7A 3PB7X 3IJ3A 3KZWA 3BXMA 3B3VA 1GYTA 4MMOA 3FH4A 5DS0A 4UEFA 5F09A 1AMPA 4F9VA 4RUHA 1XJOA 3KQZA 4DJLA 4MRIA 4A38A 4X2TA 1LCPA 1YLOA 2O53A 5HVFA 3KR5A 5LYLA 2AFSA 1YMEA 5DUSA 3EWPA 5CPAA 1YW4A 5LYIA 3B7IA 3IC1A 4EMEA 1LANA 4KSIA 4CPAA 3KL9A 4MHYA 4OKOA 2RFHA 1QMUA 4JCAA 3NH4A 2ANPA 3NFZA 4JYWA 3LMSA 3PBBA 2V8HA 3KI9A 2CTBA 4TNUA 2AFMA 4Q7AA 1Q7LA 3D68A 4P6YA 3H8FA 3BI0A 1ARMA 4ESSA 4WWVA 7CPAA 5LRJA 1LFWA 5LRGA 1NJRA 4ONWA 4IK2A 3FEDA 3CPAA 5JH9A 5K8NA 5FSVA 3GQEA 2ZEMA 4ZY0A 1RTQA 5FSXA 1R3NA 4P4FA 4ZI6A 3B35A 2RB7A 4YU9A 3WC6A 3EWQA 3T8WA 1CG2A 5J1QA 3BHXA 2POKA 1TXRA 5HVGA 2AFCA 4NFRA 1SPVA 4DUKA 4MCQA 1TY8A 4NGQA 1FNOA 2AFUA 2PJ1A 3NH8A 2ZOFA 2CF4A 2FVGA 3V7ZA 1Y0YA 4W9YA 1CPSA 3KASA 4B6ZA 2VRIA 4F9UA 3D7GA 2ABZA 2FXKA 3D7HA 2NYQA 1ZLIA 4A37A 2BOAA 4NGSA 4FUUA 4EFDA 4EWTA 1F2OA 3EWOA 1PCAA 1LAMA 1F2PA 3NA6A 1HDQA 2OOTA 2JBJA 4P45A 4WJBA 2GU2A 3V2BA 3DLJA 2PJ7A 3PFOA 2PJAA 4JLLA 2I3CA 1CPXA 2QVPA 2PJ3A 2PRQA 3FMCA 4A39A 4OC5A 3K9TA 2EK9A 3FF3A 2QJ8A 4OC2A 3IO1A 3SJFA 3LWUA 3SIGA 1XRYA 1XBUA 4IHMA 8CPAA 4J5QA 2DEAA 2XD7A 2DX6A 3B3CA 4ETJA 2Q51A 4GVWA 1ELMP 4J5RA 1DE4C 4TU0A 1TXZA 2X47A 2PJ9A 1TF9A 2AFWA 3SIJA 2V77A 4UIAA 3GLJA 3MRUA 1Z8LA 2GLJA 2Q4ZA 4ZX8A 2PIYA 2AFOA 3FJUA 1NSAA 2WZNA 3B3WA 3RAMA 4OMEA 4P4IA 1BPMA 2PIZA 5THWA 2PJ2A 1FT7A 5CBMA 2IQ6A 3IIBA 4ETKA 3H8EA 4MHZA 4UEZA 5JGFA 1LAPA 5IB9A 3RZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKJ A;  1EE3 P;  3HUV A;  5LYD A;  3L2N A;  2C1C A;  2PJB A;  2IJZ A;  4K0C A;  3HLP A;  3FEE A;  1CBX A;  1HDU A;  3DGV A;  2ACF A;  1ZLH A;  5AIL A;  3D4U A;  3PBE A;  4NGP A;  3WAB A;  3GPQ A;  2EEE A;  2EWB A;  1HJZ A;  2EK8 A;  5E3B A;  2PVW A;  3GPG A;  3D7F A;  1ZR5 A;  4MHN A;  1ZG9 A;  1ZR3 A;  3EW5 A;  3SJE A;  2ZEH A;  3I1U A;  4P44 A;  4AXV A;  1ELL P;  3H8G A;  2XEI A;  4OP4 A;  3VFQ A;  3VAT A;  3EJF A;  3EWR A;  1H8L A;  4X3R A;  3CDX A;  1M4L A;  2C6P A;  3SJX A;  1Y7E A;  2CIJ A;  4JGK A;  4KYB A;  4MXU A;  1AYE A;  2PJC A;  3PB6 X;  1YD9 A;  4OIW A;  3PEI A;  3JZT A;  1DTD A;  4J5S A;  4ZX9 A;  3SI2 A;  5HVH A;  3TC8 A;  5FSY A;  5CB5 A;  3IID A;  2BO9 A;  4YWY A;  4G1P A;  4DYO A;  2ZEF A;  2V8V A;  1KWM A;  3GUX A;  5HIH A;  3SJG A;  3SIH A;  5K8O A;  4MCP A;  4GUA A;  1CX8 A;  3WT4 A;  1VHU A;  4NGR A;  4ABL A;  2C6G A;  4O23 A;  1LOK A;  4MHP A;  4PXE A;  4P4E A;  1TKF A;  4LQG A;  2XEF A;  3PRT A;  4Z65 A;  2ZEL A;  2ZEG A;  2F8H A;  2J9A A;  2C6C A;  3IIF A;  4MCS A;  5LYF A;  1QQ9 A;  1Z5R A;  3D66 A;  4R8F A;  4PPZ A;  4TWE A;  5ELY A;  1R43 A;  2BFR A;  3GQO A;  3BI1 A;  2PCU A;  2HC9 A;  4IQY A;  3PB8 X;  3KR4 A;  3V45 A;  3TX8 A;  5FSU A;  2AFX A;  2CTC A;  4JVV A;  3Q71 A;  4GVV A;  4UEE A;  1ARL A;  5K8P A;  5K8M A;  1F57 A;  2PJ4 A;  2PJ8 A;  3D67 A;  4NGT A;  2G9D A;  4ZY1 A;  2GRE A;  4OC3 A;  2JBK A;  4JZ0 A;  3IEH A;  2AFZ A;  2VL1 A;  4MCR A;  2V8G A;  3ISX A;  1HEE A;  4FWU A;  3B3S A;  4BD9 A;  3WC7 A;  4R6T A;  2XEG A;  3S9L A;  4PXD A;  1TF8 A;  1BAV A;  3B2Y A;  3CT9 A;  2ZEE A;  3QNV A;  3KHZ A;  6CPA A;  3Q6Z A;  2L8R A;  4OC1 A;  1IGB A;  3GPO A;  4PXB A;  1PYT B;  4UML A;  1YW6 A;  2V8D A;  3S9N A;  4J4Z A;  4R7M A;  2Q43 A;  3GB0 A;  4P4B A;  4GM5 A;  4ZYQ A;  4P4D A;  3ISZ A;  1XMB A;  3V38 A;  4X8I A;  3IWW A;  1VIX A;  4K3N A;  3MN8 A;  3KGQ A;  2ZEO A;  1VHO A;  2WYR A;  2NSM A;  4OC0 A;  5I4M A;  4P10 A;  2LGR A;  4FAI A;  1Y0R A;  3B3T A;  3EKE A;  4R76 A;  1ZG8 A;  2O4H A;  3NH5 A;  1IY7 A;  2HB6 A;  2XEJ A;  2GLF A;  5JM6 A;  2PJ0 A;  3D7D A;  4PXC A;  1TKH A;  2PJ6 A;  1ZG7 A;  2BCO A;  4IAV A;  3SI1 A;  4NGM A;  3S9M A;  1OBR A;  3SI0 A;  1BPN A;  4OID A;  2FG1 A;  3PFE A;  4NJQ A;  4F8Z A;  3EJG A;  3KHX A;  3KQX A;  4NGN A;  3VAR A;  3FEC A;  5CMS A;  5FSZ A;  1Z2L A;  2ZEN A;  4H2K A;  4FBE A;  4OC4 A;  4D86 A;  1VGY A;  5LRK A;  2FAV A;  1CP6 A;  4A94 A;  1JQG A;  2ZOG A;  4ZY2 A;  3FVL A;  3FX6 A;  1UWY A;  1XFO A;  3SII A;  2IMO A;  2BFQ A;  2PJ5 A;  2QYV A;  3PB9 X;  3N5F A;  4PQA A;  5CB3 A;  5D8N A;  1YSJ A;  2PVV A;  5HOL A;  3RBU A;  4UIB A;  5HXD A;  3VH9 A;  1VHE A;  4P4J A;  2ZEP A;  2JEW A;  3CPX A;  3IFE A;  3ETI A;  5D29 A;  2F7V A;  3WC5 A;  4UF4 A;  3JRU A;  2ZED A;  4ABK A;  3PB4 X;  2OR4 A;  4NJR A;  2PE3 A;  3K2K A;  1BLL E;  1CP7 A;  3PB7 X;  3IJ3 A;  3KZW A;  3BXM A;  3B3V A;  1GYT A;  4MMO A;  3FH4 A;  5DS0 A;  4UEF A;  5F09 A;  1AMP A;  4F9V A;  4RUH A;  1XJO A;  3KQZ A;  4DJL A;  4MRI A;  4A38 A;  4X2T A;  1LCP A;  1YLO A;  2O53 A;  5HVF A;  3KR5 A;  5LYL A;  2AFS A;  1YME A;  5DUS A;  3EWP A;  5CPA A;  1YW4 A;  5LYI A;  3B7I A;  3IC1 A;  4EME A;  1LAN A;  4KSI A;  4CPA A;  3KL9 A;  4MHY A;  4OKO A;  2RFH A;  1QMU A;  4JCA A;  3NH4 A;  2ANP A;  3NFZ A;  4JYW A;  3LMS A;  3PBB A;  2V8H A;  3KI9 A;  2CTB A;  4TNU A;  2AFM A;  4Q7A A;  1Q7L A;  3D68 A;  4P6Y A;  3H8F A;  3BI0 A;  1ARM A;  4ESS A;  4WWV A;  7CPA A;  5LRJ A;  1LFW A;  5LRG A;  1NJR A;  4ONW A;  4IK2 A;  3FED A;  3CPA A;  5JH9 A;  5K8N A;  5FSV A;  3GQE A;  2ZEM A;  4ZY0 A;  1RTQ A;  5FSX A;  1R3N A;  4P4F A;  4ZI6 A;  3B35 A;  2RB7 A;  4YU9 A;  3WC6 A;  3EWQ A;  3T8W A;  1CG2 A;  5J1Q A;  3BHX A;  2POK A;  1TXR A;  5HVG A;  2AFC A;  4NFR A;  1SPV A;  4DUK A;  4MCQ A;  1TY8 A;  4NGQ A;  1FNO A;  2AFU A;  2PJ1 A;  3NH8 A;  2ZOF A;  2CF4 A;  2FVG A;  3V7Z A;  1Y0Y A;  4W9Y A;  1CPS A;  3KAS A;  4B6Z A;  2VRI A;  4F9U A;  3D7G A;  2ABZ A;  2FXK A;  3D7H A;  2NYQ A;  1ZLI A;  4A37 A;  2BOA A;  4NGS A;  4FUU A;  4EFD A;  4EWT A;  1F2O A;  3EWO A;  1PCA A;  1LAM A;  1F2P A;  3NA6 A;  1HDQ A;  2OOT A;  2JBJ A;  4P45 A;  4WJB A;  2GU2 A;  3V2B A;  3DLJ A;  2PJ7 A;  3PFO A;  2PJA A;  4JLL A;  2I3C A;  1CPX A;  2QVP A;  2PJ3 A;  2PRQ A;  3FMC A;  4A39 A;  4OC5 A;  3K9T A;  2EK9 A;  3FF3 A;  2QJ8 A;  4OC2 A;  3IO1 A;  3SJF A;  3LWU A;  3SIG A;  1XRY A;  1XBU A;  4IHM A;  8CPA A;  4J5Q A;  2DEA A;  2XD7 A;  2DX6 A;  3B3C A;  4ETJ A;  2Q51 A;  4GVW A;  1ELM P;  4J5R A;  1DE4 C;  4TU0 A;  1TXZ A;  2X47 A;  2PJ9 A;  1TF9 A;  2AFW A;  3SIJ A;  2V77 A;  4UIA A;  3GLJ A;  3MRU A;  1Z8L A;  2GLJ A;  2Q4Z A;  4ZX8 A;  2PIY A;  2AFO A;  3FJU A;  1NSA A;  2WZN A;  3B3W A;  3RAM A;  4OME A;  4P4I A;  1BPM A;  2PIZ A;  5THW A;  2PJ2 A;  1FT7 A;  5CBM A;  2IQ6 A;  3IIB A;  4ETK A;  3H8E A;  4MHZ A;  4UEZ A;  5JGF A;  1LAP A;  5IB9 A;  3RZA A; 
#chains in the Genus database with same CATH topology
 4XPL A;  1TKJ A;  1Z8W A;  3R96 A;  1EE3 P;  3HUV A;  4RN7 A;  5LYD A;  3FIX A;  3NE8 A;  2G3A A;  1MJB A;  2C1C A;  3L2N A;  4H6U A;  4M6G A;  4C2Z A;  2FCK A;  2PJB A;  2IJZ A;  4EVY A;  5AG4 A;  4K0C A;  3HLP A;  2AJ6 A;  3FNC A;  3FEE A;  3FYN A;  1CBX A;  5F46 A;  1HDU A;  3DGV A;  4UCN A;  1SQH A;  2ACF A;  1ZLH A;  5AIL A;  2WPX A;  3D4U A;  3GY9 A;  3PBE A;  2Z3L A;  4KUA A;  3GPQ A;  2EEE A;  2EWB A;  3MGD A;  5G20 A;  1HJZ A;  2REE A;  2EK8 A;  5E3B A;  2WCT A;  2PVW A;  3GPG A;  2KQV A;  4B11 A;  5A28 A;  2PQ8 A;  1ZR5 A;  3D7F A;  3IGR A;  4MHN A;  2Z3M A;  4UFW A;  1ZG9 A;  3TE4 A;  1ZR3 A;  3EW5 A;  4A95 A;  3SJE A;  3T90 A;  2Q4V A;  2ZEH A;  2OOT A;  3F8K A;  2PC1 A;  3I1U A;  1XEB A;  4MFK A;  5IV0 A;  4P44 A;  3D8P A;  4AXV A;  4M6H A;  1ELL P;  3H8G A;  2XEI A;  2C27 A;  4FD5 A;  1Z4E A;  3IWE A;  3VFQ A;  4OP4 A;  3VAT A;  3EJF A;  4YFJ A;  3EWR A;  4XPK A;  1H8L A;  4X3R A;  4R57 A;  3CDX A;  2WUU A;  1M4L A;  1XF8 A;  5H84 A;  2C6P A;  3SJX A;  1Y7E A;  2CIJ A;  4JGK A;  4KYB A;  2J8M A;  2JZE A;  3K9U A;  4MXU A;  3IWG A;  1AYE A;  1B87 A;  2CNM A;  1YD9 A;  2PJC A;  3PB6 X;  1A2Z A;  4OIW A;  4OAD A;  3PEI A;  1P4N A;  3EO4 A;  5F47 A;  3JZT A;  3S6K A;  4KLW A;  1DTD A;  1YX0 A;  1NMT A;  5HH1 A;  4CGL A;  4J5S A;  4ZX9 A;  3SI2 A;  5HVH A;  2OB0 A;  3TC8 A;  5FSY A;  5CB5 A;  3IID A;  1TIQ A;  2BO9 A;  3DSB A;  4YWY A;  4G1P A;  4DYO A;  2ZEF A;  1VKC A;  2V8V A;  1KWM A;  2Z3O A;  5HIH A;  3GUX A;  3JUW A;  3SJG A;  5J8F A;  3SIH A;  1KUY A;  5K8O A;  4MCP A;  5AGE A;  4GUA A;  1CX8 A;  3WT4 A;  4JJX A;  1VHU A;  2QEC A;  4NGR A;  4ABL A;  2C6G A;  4O23 A;  4CS0 B;  1LOK A;  2DF5 A;  4MHP A;  4PXE A;  4M3S A;  4P4E A;  1TKF A;  3W6S A;  4XNH C;  4LQG A;  2VEZ A;  2XEF A;  2Y0M A;  1Q2C A;  3H4Q A;  3PRT A;  4X5K A;  3R9E A;  2ODF A;  4Z65 A;  1QSM A;  2ZEL A;  4U5Y A;  2ZEG A;  4KOW A;  2F8H A;  2J9A A;  2C6C A;  4Y49 C;  4CYP A;  3IIF A;  4MCS A;  5LYF A;  3IU2 A;  1QQ9 A;  1Z5R A;  3LAC A;  3D66 A;  4R8F A;  4PPZ A;  1S7F A;  4TWE A;  5ELY A;  1R43 A;  2BFR A;  3GQO A;  3R95 A;  3BJ8 A;  4AVC A;  3BI1 A;  3JTK A;  2PCU A;  2HC9 A;  4IQY A;  5AG7 A;  4Q38 A;  3OWC A;  1XMT A;  3CXP A;  1YLE A;  4A33 A;  4C7H A;  2P6F A;  3PB8 X;  3KR4 A;  3V45 A;  3TX8 A;  5FSU A;  3R9G A;  4KVO E;  2AFX A;  1YVO A;  4PV6 A;  2CTC A;  2EVN A;  4JVV A;  3Q71 A;  4GVV A;  1QSR A;  2P6G A;  4UEE A;  3TO6 A;  4E0A A;  1ARL A;  5K8P A;  5K8M A;  1F57 A;  2PJ4 A;  2PJ8 A;  3D67 A;  4KOY A;  4MFZ A;  4NGT A;  2G9D A;  1Q2Y A;  2Z3K A;  4ZY1 A;  2GRE A;  4OC3 A;  1NE9 A;  2B4D A;  3TO9 A;  2JBK A;  4IF5 A;  4JZ0 A;  4B5O A;  4CGO A;  3CXQ A;  3IEH A;  2AFZ A;  3H5Z A;  2VL1 A;  2ZW6 A;  4MCR A;  4A31 A;  4NEX A;  2V8G A;  4I49 A;  3ISX A;  1HEE A;  4FWU A;  3B3S A;  4BD9 A;  3D2P A;  4GXH A;  4R6T A;  2XEG A;  3WC7 A;  3S9L A;  5G22 A;  3TOB A;  1FY7 A;  3EC4 A;  4XPD C;  3C26 A;  2JDD A;  4CAX A;  4R3L A;  1CJW A;  1YK3 A;  5JQ4 A;  4PXD A;  1IOF A;  1BAV A;  1TF8 A;  2Z3P A;  3B2Y A;  2OZU A;  3DR8 A;  4MY0 A;  3CT9 A;  2ZEE A;  3QNV A;  4B12 A;  5A27 A;  3KHZ A;  4DNC A;  3WAB A;  3Q6Z A;  6CPA A;  5KTC A;  2L8R A;  4OC1 A;  1IGB A;  4MFL A;  3GPO A;  5EMI A;  3N7Z A;  3QB8 A;  1S7N A;  4PXB A;  2Z11 A;  3SHP A;  4AVA A;  1PYT B;  4UML A;  3B8G A;  5CNP A;  1YW6 A;  2V8D A;  3TCV A;  1KZF A;  1UFH A;  4E2A A;  4KOT A;  4J4Z A;  4R7M A;  3S9N A;  2Q43 A;  3P2F A;  4M85 A;  3GB0 A;  4P4B A;  4HPS A;  4GM5 A;  4ZYQ A;  4P4D A;  3ISZ A;  1PU9 A;  1XMB A;  2PR8 A;  3V38 A;  4X8I A;  2CNT A;  4C68 A;  2FS5 A;  1VIX A;  3IWW A;  2F5I A;  3G8W A;  4K3N A;  4L8A A;  1KUV A;  4KOR A;  4M6I A;  2Q7B A;  3VWD A;  3MN8 A;  4RI1 A;  2IL4 A;  3KGQ A;  1YVK A;  4B14 A;  2ZEO A;  1VHO A;  4NF1 A;  2Q4Y A;  1M1D A;  4JWP A;  2B5G B;  2WYR A;  4B5P A;  4RS2 A;  2NSM A;  4OC0 A;  2BEI A;  3RNZ A;  4LQ6 A;  1MJ9 A;  4Q36 A;  4E8O A;  4Y49 B;  4CYO A;  4AG7 A;  5I4M A;  2YGW A;  4P10 A;  2LGR A;  4FAI A;  1Y0R A;  4NXY A;  2J8N A;  3EKE A;  3B3T A;  4KOX A;  4R76 A;  4CYQ A;  1S3Z A;  1ZG8 A;  2O4H A;  3NH5 A;  2FT0 A;  1IY7 A;  2HB6 A;  4PK3 A;  4CGM A;  1QST A;  2FIW A;  1YRE A;  5C82 A;  2XEJ A;  2AE6 A;  2GLF A;  4R87 A;  1QSO A;  5G21 A;  1BO4 A;  5JM6 A;  2PJ0 A;  4H6Z A;  2HQY A;  3D7D A;  4PXC A;  1TKH A;  2PJ6 A;  1ZG7 A;  2YNC A;  2BCO A;  4UBR A;  4IAV A;  3SI1 A;  4NGM A;  4UCP A;  4R3K A;  1OBR A;  3S9M A;  3SI0 A;  2OZH A;  4MJ8 A;  1BPN A;  2OH1 A;  4OID A;  4U9Z A;  3GKR A;  4MY3 A;  2FG1 A;  2YND A;  1IYK A;  3PFE A;  4NJQ A;  4F8Z A;  3EJG A;  1IB1 E;  4BMH A;  3KHX A;  3KQX A;  1M4D A;  4NGN A;  3VAR A;  5E96 A;  3FEC A;  5CMS A;  5FSZ A;  1Z2L A;  2ZEN A;  4JLY A;  4MHD A;  2PSW A;  1KUX A;  3TTH A;  4NGP A;  1I1D A;  4F0X A;  3I3G A;  4H2K A;  3JVN A;  4U9Y A;  4HNY B;  3KKW A;  4FBE A;  4OC4 A;  1IYL A;  4D86 A;  1VGY A;  1Y9W A;  2FAV A;  1CP6 A;  4UFX A;  5LRK A;  3E0K A;  4ORF A;  3FXT A;  2EUI A;  4F0Y A;  4ZGY B;  4A94 A;  1Q2D A;  2FE7 A;  4B10 A;  2R8V A;  1JQG A;  4R9M A;  2ZOG A;  2R7H A;  2CY2 A;  1ON0 A;  2REF A;  4ZY2 A;  3FVL A;  3FX6 A;  2H5M A;  1OZP A;  5EC4 A;  1UWY A;  1XFO A;  3SII A;  2IMO A;  2BFQ A;  3S6G A;  2PJ5 A;  4LX9 A;  2QYV A;  1IOI A;  3PB9 X;  2JDC A;  1I12 A;  5DWM A;  1N71 A;  2FSR A;  2I79 A;  4FD6 A;  3N5F A;  4PQA A;  5CB3 A;  4MFP A;  5D8N A;  4KUB A;  3TO7 A;  1YSJ A;  2PVV A;  4ZBG A;  5HOL A;  3R9F A;  4UWJ A;  1XOV A;  1YR0 A;  3RBU A;  4AVB A;  4UIB A;  5HXD A;  3TT2 A;  2JZD A;  3FRM A;  1GHE A;  3VH9 A;  1VHE A;  2X7B A;  4AG9 A;  4C2Y A;  2YNC C;  4P4J A;  2JZF A;  2ZEP A;  2WSA A;  2JEW A;  3CPX A;  3IFE A;  4HNX B;  3UY5 A;  3CZX A;  2G3T A;  4UCM A;  3ETI A;  5D29 A;  1XE4 A;  2F7V A;  2Q0Y A;  3WC5 A;  4CYN A;  4UF4 A;  3JRU A;  1CM0 A;  1RXT A;  2ZED A;  3CXS A;  3I9S A;  4ABK A;  3PB4 X;  2OR4 A;  3EY5 A;  4NJR A;  2PE3 A;  5H86 A;  3K2K A;  4ONU A;  1BLL E;  1CP7 A;  2FXF A;  3DDD A;  2Z0Z A;  2FL4 A;  4A2Z A;  3PB7 X;  3IJ3 A;  2KCW A;  1S7L A;  1S7K A;  2HUZ A;  4UA3 A;  3KZW A;  3BXM A;  4FD4 A;  3B3V A;  3RO0 A;  4AB7 A;  1GYT A;  1J4J A;  2VQY A;  4K30 A;  4MMO A;  3EXN A;  3FH4 A;  3W6X A;  5DS0 A;  2DPS A;  4UEF A;  5F09 A;  1Z9U A;  1AMP A;  5F49 A;  4F9V A;  4RUH A;  1U6M A;  1XJO A;  3D2M A;  4IUS A;  4QBJ A;  3TFY A;  3KQZ A;  4DJL A;  2BL1 A;  4F6A A;  4MRI A;  4A38 A;  4X2T A;  1LCP A;  1YLO A;  2GE3 A;  4NCZ A;  4KSF A;  2P6E A;  2O53 A;  5HVF A;  4CAV A;  4YRH A;  1S60 A;  3KR5 A;  4PK2 A;  5LYL A;  2VZZ A;  2AFS A;  1WWZ A;  1YGH A;  2BUE A;  2P0W A;  3BJ7 A;  1V0C A;  3GIU A;  4JXR A;  4KOU A;  1YME A;  5DWN A;  3S6F A;  5DUS A;  3PZJ A;  3QAY A;  3EWP A;  3SXN A;  4BBH A;  4YGO A;  1B6B A;  2JLM A;  1Y9K A;  5CPA A;  4CAE A;  1YW4 A;  1JWQ A;  5LYI A;  3WR7 A;  2BSW A;  2D4P A;  1X12 A;  2PR1 A;  5HMN A;  5G1Z A;  3B7I A;  2WPW A;  3IC1 A;  3LOD A;  4EME A;  1LAN A;  4II9 A;  4UWI A;  4JD6 A;  3EFA A;  4HNW B;  4KSI A;  1IID A;  3DNS A;  3KL9 A;  4CPA A;  1WK4 A;  4MBU A;  4MI4 A;  4MHY A;  4OKO A;  2RFH A;  4CRZ B;  4CGN A;  5ISV A;  2G0B A;  2Q7S A;  4QVT A;  2I00 A;  1QMU A;  2PDO A;  4JCA A;  2GAN A;  3NH4 A;  2ANP A;  1I21 A;  1IIC A;  4GS4 A;  4XNH B;  3NFZ A;  2RC4 A;  1M4I A;  2ZW7 A;  3D3S A;  4JYW A;  3QAH A;  5KTD A;  3LMS A;  5I0C A;  4LUA A;  2B3V A;  2B58 A;  2B3U A;  2V8H A;  3PBB A;  3T9Y A;  3KI9 A;  1QSN A;  2CTB A;  4TNU A;  2AFM A;  2Q44 A;  4Q7A A;  1Q7L A;  3D68 A;  3DR6 A;  4P6Y A;  4QUS A;  4A32 A;  1LRZ A;  3H8F A;  3BI0 A;  2VXK A;  4CAF A;  1ARM A;  1MJA A;  4ESS A;  4WWV A;  7CPA A;  4KOV A;  5LRJ A;  2EBJ A;  1LFW A;  5LRG A;  4L89 A;  1NJR A;  2ZPA A;  4ONW A;  4IK2 A;  3FED A;  3GYA A;  3CPA A;  5JH9 A;  5K8N A;  1R57 A;  5FSV A;  2B4B A;  2VZY A;  3TOA A;  3GQE A;  2ZEM A;  4ZY0 A;  3R1K A;  5IX3 A;  2B5G A;  1RTQ A;  5FSX A;  2OU2 A;  1R3N A;  4P4F A;  4ZI6 A;  3B35 A;  5F48 A;  2RB7 A;  4YU9 A;  3LD2 A;  3WC6 A;  3EWQ A;  3T8W A;  1CG2 A;  5J1Q A;  4CAW A;  3BHX A;  4OAE A;  3W91 A;  2POK A;  3A9L A;  1TXR A;  2GIV A;  5HVG A;  4HKF A;  1MK4 A;  4KOS A;  2AFC A;  4KS9 A;  4NFR A;  1SPV A;  4UFV A;  5FVJ A;  1NSL A;  4DUK A;  5EBV A;  2ARH A;  1TY8 A;  4MCQ A;  4NGQ A;  2HV2 A;  4QC6 A;  1FNO A;  2AFU A;  2PJ1 A;  3NH8 A;  1M4G A;  4A30 A;  1Y7R A;  2JEV A;  2D4O A;  2ZOF A;  2CF4 A;  2FVG A;  4XPD B;  2CXA A;  2PRB A;  4C2X A;  3V7Z A;  2NMT A;  1Y0Y A;  2Z10 A;  4OLL A;  4W9Y A;  1CPS A;  3KAS A;  4B6Z A;  2VRI A;  1Z8T A;  3NE7 A;  4F9U A;  2YNE A;  3D7G A;  4PSW A;  4PSX A;  2ABZ A;  3G3S A;  4C7I A;  5BWA B;  4KVM E;  3FBU A;  2FXK A;  1K4J A;  4KZT A;  3D7H A;  4KLV A;  2NYQ A;  1ZLI A;  4A37 A;  2BOA A;  4NGS A;  4FUU A;  4MFJ A;  4EFD A;  4EWT A;  1VHS A;  2R1I A;  5GCN A;  4CRY B;  1F2O A;  5AG5 A;  3EWO A;  1PCA A;  2Q04 A;  1LAM A;  2J8R A;  3SXO A;  3V8I A;  1F2P A;  1S5K A;  3F0A A;  3NA6 A;  1HDQ A;  4MFQ A;  2JBJ A;  4NSQ A;  4P45 A;  4WJB A;  2GU2 A;  3V2B A;  3DLJ A;  2ATR A;  4CGP A;  2PJ7 A;  2DPT A;  3PFO A;  4J3G A;  1X10 A;  2PJA A;  5AG6 A;  2VI7 A;  4JLL A;  2I3C A;  1CPX A;  2QVP A;  2PJ3 A;  2PRQ A;  1Z8X A;  4JXQ A;  3FMC A;  2O28 A;  3F5B A;  5JPH A;  2QIR A;  5J8C A;  1IU8 A;  4A39 A;  4OC5 A;  2ZW5 A;  3K9T A;  2EK9 A;  2B4D B;  1RO5 A;  2QJ8 A;  2GFQ A;  3FF3 A;  4OC2 A;  3IO1 A;  3IU1 A;  3SJF A;  3LWU A;  3SIG A;  1XRY A;  1XBU A;  4IHM A;  8CPA A;  4J5Q A;  4B13 A;  2DEA A;  1PUA A;  2XD7 A;  3P2H A;  1XIX A;  2DX6 A;  3B3C A;  2RNK A;  2CNS A;  4ETJ A;  2Q51 A;  2R98 A;  2ZXV A;  4GVW A;  1ELM P;  3BLN A;  4QB9 A;  2Z3N A;  3PP9 A;  4J5R A;  3S6H A;  1DE4 C;  4TU0 A;  1TXZ A;  2X47 A;  1AUG A;  1Z4R A;  1M44 A;  2PJ9 A;  1YQE A;  4H89 A;  1TF9 A;  3FB3 A;  2AFW A;  3SIJ A;  3PGP A;  2FIA A;  2EO8 A;  2V77 A;  4KSA A;  4UIA A;  2VBQ A;  2K5T A;  3GLJ A;  3MRU A;  1Z8L A;  2ZW4 A;  2GLJ A;  4BIN A;  2Q4Z A;  4KVX A;  4ZX8 A;  2PIY A;  2AFO A;  1ZO0 A;  1L0C A;  3FJU A;  1BOB A;  1NSA A;  2DXQ A;  2WZN A;  2W2G A;  3ZJ0 A;  3B3W A;  3RAM A;  2OZG A;  4OME A;  1P0H A;  5KTA A;  4P4I A;  1BPM A;  2PIZ A;  5THW A;  2PJ2 A;  3VWE A;  1FT7 A;  2QML A;  3RYO A;  4B5P B;  5CBM A;  2IQ6 A;  3IIB A;  3ZZI A;  5IB0 A;  4ETK A;  3H8E A;  4MHZ A;  4UEZ A;  4FD7 A;  5JGF A;  2A4N A;  1LAP A;  5IB9 A;  3RZA A;  5C88 A; 
#chains in the Genus database with same CATH homology
 1TKJ A;  1EE3 P;  3HUV A;  5LYD A;  3L2N A;  2C1C A;  2PJB A;  2IJZ A;  4K0C A;  3HLP A;  3FEE A;  1CBX A;  1HDU A;  3DGV A;  2ACF A;  1ZLH A;  5AIL A;  3D4U A;  3PBE A;  4NGP A;  3WAB A;  3GPQ A;  2EEE A;  2EWB A;  1HJZ A;  2EK8 A;  5E3B A;  2PVW A;  3GPG A;  3D7F A;  1ZR5 A;  4MHN A;  1ZG9 A;  1ZR3 A;  3EW5 A;  3SJE A;  2ZEH A;  3I1U A;  4P44 A;  4AXV A;  1ELL P;  3H8G A;  2XEI A;  4OP4 A;  3VFQ A;  3VAT A;  3EJF A;  3EWR A;  1H8L A;  4X3R A;  3CDX A;  1M4L A;  2C6P A;  3SJX A;  1Y7E A;  2CIJ A;  4JGK A;  4KYB A;  4MXU A;  1AYE A;  2PJC A;  3PB6 X;  1YD9 A;  4OIW A;  3PEI A;  3JZT A;  1DTD A;  4J5S A;  4ZX9 A;  3SI2 A;  5HVH A;  3TC8 A;  5FSY A;  5CB5 A;  3IID A;  2BO9 A;  4YWY A;  4G1P A;  4DYO A;  2ZEF A;  2V8V A;  1KWM A;  3GUX A;  5HIH A;  3SJG A;  3SIH A;  5K8O A;  4MCP A;  4GUA A;  1CX8 A;  3WT4 A;  1VHU A;  4NGR A;  4ABL A;  2C6G A;  4O23 A;  1LOK A;  4MHP A;  4PXE A;  4P4E A;  1TKF A;  4LQG A;  2XEF A;  3PRT A;  4Z65 A;  2ZEL A;  2ZEG A;  2F8H A;  2J9A A;  2C6C A;  3IIF A;  4MCS A;  5LYF A;  1QQ9 A;  1Z5R A;  3D66 A;  4R8F A;  4PPZ A;  4TWE A;  5ELY A;  1R43 A;  2BFR A;  3GQO A;  3BI1 A;  2PCU A;  2HC9 A;  4IQY A;  3PB8 X;  3KR4 A;  3V45 A;  3TX8 A;  5FSU A;  2AFX A;  2CTC A;  4JVV A;  3Q71 A;  4GVV A;  4UEE A;  1ARL A;  5K8P A;  5K8M A;  1F57 A;  2PJ4 A;  2PJ8 A;  3D67 A;  4NGT A;  2G9D A;  4ZY1 A;  2GRE A;  4OC3 A;  2JBK A;  4JZ0 A;  3IEH A;  2AFZ A;  2VL1 A;  4MCR A;  2V8G A;  3ISX A;  1HEE A;  4FWU A;  3B3S A;  4BD9 A;  3WC7 A;  4R6T A;  2XEG A;  3S9L A;  4PXD A;  1TF8 A;  1BAV A;  3B2Y A;  3CT9 A;  2ZEE A;  3QNV A;  3KHZ A;  6CPA A;  3Q6Z A;  2L8R A;  4OC1 A;  1IGB A;  3GPO A;  4PXB A;  1PYT B;  4UML A;  1YW6 A;  2V8D A;  3S9N A;  4J4Z A;  4R7M A;  2Q43 A;  3GB0 A;  4P4B A;  4GM5 A;  4ZYQ A;  4P4D A;  3ISZ A;  1XMB A;  3V38 A;  4X8I A;  3IWW A;  1VIX A;  4K3N A;  3MN8 A;  3KGQ A;  2ZEO A;  1VHO A;  2WYR A;  2NSM A;  4OC0 A;  5I4M A;  4P10 A;  2LGR A;  4FAI A;  1Y0R A;  3B3T A;  3EKE A;  4R76 A;  1ZG8 A;  2O4H A;  3NH5 A;  1IY7 A;  2HB6 A;  2XEJ A;  2GLF A;  5JM6 A;  2PJ0 A;  3D7D A;  4PXC A;  1TKH A;  2PJ6 A;  1ZG7 A;  2BCO A;  4IAV A;  3SI1 A;  4NGM A;  3S9M A;  1OBR A;  3SI0 A;  1BPN A;  4OID A;  2FG1 A;  3PFE A;  4NJQ A;  4F8Z A;  3EJG A;  3KHX A;  3KQX A;  4NGN A;  3VAR A;  3FEC A;  5CMS A;  5FSZ A;  1Z2L A;  2ZEN A;  4H2K A;  4FBE A;  4OC4 A;  4D86 A;  1VGY A;  5LRK A;  2FAV A;  1CP6 A;  4A94 A;  1JQG A;  2ZOG A;  4ZY2 A;  3FVL A;  3FX6 A;  1UWY A;  1XFO A;  3SII A;  2IMO A;  2BFQ A;  2PJ5 A;  2QYV A;  3PB9 X;  3N5F A;  4PQA A;  5CB3 A;  5D8N A;  1YSJ A;  2PVV A;  5HOL A;  3RBU A;  4UIB A;  5HXD A;  3VH9 A;  1VHE A;  4P4J A;  2ZEP A;  2JEW A;  3CPX A;  3IFE A;  3ETI A;  5D29 A;  2F7V A;  3WC5 A;  4UF4 A;  3JRU A;  2ZED A;  4ABK A;  3PB4 X;  2OR4 A;  4NJR A;  2PE3 A;  3K2K A;  1BLL E;  1CP7 A;  3PB7 X;  3IJ3 A;  3KZW A;  3BXM A;  3B3V A;  1GYT A;  4MMO A;  3FH4 A;  5DS0 A;  4UEF A;  5F09 A;  1AMP A;  4F9V A;  4RUH A;  1XJO A;  3KQZ A;  4DJL A;  4MRI A;  4A38 A;  4X2T A;  1LCP A;  1YLO A;  2O53 A;  5HVF A;  3KR5 A;  5LYL A;  2AFS A;  1YME A;  5DUS A;  3EWP A;  5CPA A;  1YW4 A;  5LYI A;  3B7I A;  3IC1 A;  4EME A;  1LAN A;  4KSI A;  4CPA A;  3KL9 A;  4MHY A;  4OKO A;  2RFH A;  1QMU A;  4JCA A;  3NH4 A;  2ANP A;  3NFZ A;  4JYW A;  3LMS A;  3PBB A;  2V8H A;  3KI9 A;  2CTB A;  4TNU A;  2AFM A;  4Q7A A;  1Q7L A;  3D68 A;  4P6Y A;  3H8F A;  3BI0 A;  1ARM A;  4ESS A;  4WWV A;  7CPA A;  5LRJ A;  1LFW A;  5LRG A;  1NJR A;  4ONW A;  4IK2 A;  3FED A;  3CPA A;  5JH9 A;  5K8N A;  5FSV A;  3GQE A;  2ZEM A;  4ZY0 A;  1RTQ A;  5FSX A;  1R3N A;  4P4F A;  4ZI6 A;  3B35 A;  2RB7 A;  4YU9 A;  3WC6 A;  3EWQ A;  3T8W A;  1CG2 A;  5J1Q A;  3BHX A;  2POK A;  1TXR A;  5HVG A;  2AFC A;  4NFR A;  1SPV A;  4DUK A;  4MCQ A;  1TY8 A;  4NGQ A;  1FNO A;  2AFU A;  2PJ1 A;  3NH8 A;  2ZOF A;  2CF4 A;  2FVG A;  3V7Z A;  1Y0Y A;  4W9Y A;  1CPS A;  3KAS A;  4B6Z A;  2VRI A;  4F9U A;  3D7G A;  2ABZ A;  2FXK A;  3D7H A;  2NYQ A;  1ZLI A;  4A37 A;  2BOA A;  4NGS A;  4FUU A;  4EFD A;  4EWT A;  1F2O A;  3EWO A;  1PCA A;  1LAM A;  1F2P A;  3NA6 A;  1HDQ A;  2OOT A;  2JBJ A;  4P45 A;  4WJB A;  2GU2 A;  3V2B A;  3DLJ A;  2PJ7 A;  3PFO A;  2PJA A;  4JLL A;  2I3C A;  1CPX A;  2QVP A;  2PJ3 A;  2PRQ A;  3FMC A;  4A39 A;  4OC5 A;  3K9T A;  2EK9 A;  3FF3 A;  2QJ8 A;  4OC2 A;  3IO1 A;  3SJF A;  3LWU A;  3SIG A;  1XRY A;  1XBU A;  4IHM A;  8CPA A;  4J5Q A;  2DEA A;  2XD7 A;  2DX6 A;  3B3C A;  4ETJ A;  2Q51 A;  4GVW A;  1ELM P;  4J5R A;  1DE4 C;  4TU0 A;  1TXZ A;  2X47 A;  2PJ9 A;  1TF9 A;  2AFW A;  3SIJ A;  2V77 A;  4UIA A;  3GLJ A;  3MRU A;  1Z8L A;  2GLJ A;  2Q4Z A;  4ZX8 A;  2PIY A;  2AFO A;  3FJU A;  1NSA A;  2WZN A;  3B3W A;  3RAM A;  4OME A;  4P4I A;  1BPM A;  2PIZ A;  5THW A;  2PJ2 A;  1FT7 A;  5CBM A;  2IQ6 A;  3IIB A;  4ETK A;  3H8E A;  4MHZ A;  4UEZ A;  5JGF A;  1LAP A;  5IB9 A;  3RZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...