3H8EA

Low ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
473
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGIMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 156
structure length 473
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8eA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8eA02
5E3BA 4P10A 2C1CA 1EE3P 3FJUA 3K2KA 4NGRA 5FSZA 3FEDA 4UF4A 2EEEA 3K9TA 1VHOA 4YWYA 3FH4A 4P4FA 2RFHA 3RBUA 2V8HA 1F57A 4EWTA 3SJEA 3PB8X 4PXBA 5J1QA 3B3CA 4X3RA 4R7MA 2QYVA 3PFOA 2BFQA 1CG2A 2X47A 1LCPA 4ABLA 3SIIA 2POKA 2FVGA 3V7ZA 3Q6ZA 3EJFA 3WC6A 2ZEOA 4J4ZA 3D7HA 8CPAA 3B3VA 2ZEEA 2PE3A 4P6YA 1UWYA 4DYOA 3NA6A 1SPVA 3VARA 4MHPA 3KHZA 1JQGA 1HDUA 4OC4A 3MRUA 1R3NA 4MCRA 2J9AA 2OR4A 3IEHA 2PIZA 3WT4A 2XEGA 4OP4A 3TX8A 1BPNA 1H8LA 3IO1A 4NGSA 4GVWA 3KASA 3H8EA 4KYBA 4IHMA 2V8DA 3PBEA 4UEZA 3GQEA 1YD9A 2FXKA 3T8WA 3PBBA 4OKOA 4FAIA 2PJBA 4P4JA 3VFQA 1VIXA 4AXVA 2GU2A 4JYWA 1CPSA 1LANA 1CP7A 1TY8A 4Q7AA 4NFRA 4FBEA 1ZLIA 3NFZA 2WZNA 1AMPA 4H2KA 3SJFA 4MRIA 3KQXA 3GPOA 3EWRA 1CPXA 4ONWA 2JEWA 3EWQA 2DEAA 1ELLP 3IIFA 4MHYA 1HDQA 2JBKA 2NSMA 2PJ5A 2AFCA 2Q4ZA 3EJGA 2GREA 4W9YA 1VHUA 4BD9A 3FMCA 7CPAA 1GYTA 4CPAA 5F09A 3B2YA 2CTBA 4ZX8A 3D4UA 4NGQA 4ZI6A 3B7IA 2ZEPA 5LYIA 1TF9A 4X8IA 5I4MA 4OIWA 4JGKA 3DLJA 1ZR5A 4MCPA 1TKFA 2RB7A 2G9DA 2ZELA 3S9MA 2CF4A 4EMEA 1CP6A 1XBUA 1TF8A 3KHXA 3KI9A 4J5SA 2XEJA 3CDXA 1VHEA 1YW6A 1CBXA 3V45A 3EWOA 4MHZA 4P45A 1Y0RA 3EW5A 3SIHA 3CPAA 4X2TA 3B3TA 3EKEA 1Y7EA 2VRIA 2XEFA 1LAPA 1Z2LA 3JZTA 5FSUA 2DX6A 2HC9A 2ZEFA 3SJXA 2C6GA 3IIBA 4UIBA 5AILA 3D7FA 3LMSA 4KSIA 4R8FA 5K8PA 3PB9X 4DJLA 5ELYA 4NGTA 2NYQA 3PB4X 3H8GA 5DUSA 2O53A 3RAMA 4LQGA 1F2OA 2CIJA 4GVVA 4ZY0A 2GLFA 2V8GA 4JLLA 4MCQA 4NJQA 1YW4A 5HVHA 1IGBA 3PEIA 2XEIA 3IFEA 4P4IA 3WABA 5THWA 4F8ZA 2ZEMA 2EK9A 3NH5A 3FEEA 1NJRA 2PCUA 3DGVA 3BI0A 2PRQA 1ZLHA 1ZG9A 4FUUA 3FECA 3BHXA 3GUXA 4UMLA 1IY7A 1QMUA 3NH8A 4DUKA 1QQ9A 4F9VA 2PJCA 1F2PA 2LGRA 4NGNA 2BCOA 3PFEA 4GM5A 6CPAA 3GQOA 2PJ7A 2FG1A 3PB6X 4OC5A 5K8OA 4B6ZA 3KR4A 4MCSA 3IC1A 5FSXA 4UEFA 4R6TA 5FSVA 5LYLA 3SI2A 2V77A 4P4BA 5D8NA 1ARMA 4IQYA 2AFSA 2BFRA 3KR5A 3KQZA 4ESSA 1YLOA 3PB7X 3S9LA 3IIDA 4IK2A 5HXDA 4P4EA 5HIHA 3TC8A 3HLPA 3D68A 3GPQA 1ARLA 3B35A 1LOKA 3VATA 3L2NA 1FT7A 2PJ6A 2C6CA 5K8MA 3SI1A 3IJ3A 1RTQA 1XJOA 1ZG8A 1TKHA 3SI0A 4MMOA 1XFOA 2Q43A 3SJGA 3N5FA 2F7VA 2QVPA 1PCAA 2IJZA 3ISXA 2ZEGA 3KZWA 2PJ2A 4NGPA 2WYRA 4JCAA 4ABKA 2XD7A 4PXEA 4J5QA 3D66A 4ZYQA 1AYEA 2PJAA 4YU9A 4A37A 5CMSA 5DS0A 4PPZA 3FF3A 1ZR3A 4GUAA 2QJ8A 1R43A 5JH9A 2ZEHA 3D7GA 4OC1A 2AFMA 2ABZA 4TWEA 3WC7A 3CPXA 3RZAA 5CB3A 1ELMP 2PJ1A 4TNUA 5FSYA 1BPMA 4ETJA 5IB9A 2EWBA 4WJBA 3S9NA 3GLJA 3CT9A 4OIDA 5CB5A 1BLLE 4OC3A 4JZ0A 3SIGA 2ANPA 4MHNA 5CBMA 1Y0YA 2PJ0A 4A94A 5K8NA 4UEEA 2PVVA 2ZOFA 3PRTA 4WWVA 3V2BA 3MN8A 2ZEDA 3SIJA 3BI1A 4ZY1A 2CTCA 1YMEA 3D7DA 2EK8A 4EFDA 5JGFA 5JM6A 4PQAA 4RUHA 2PVWA 3KGQA 1CX8A 2V8VA 2AFWA 3B3WA 5LRGA 3ETIA 3GPGA 1OBRA 4R76A 2JBJA 1LFWA 1Q7LA 3KL9A 4JVVA 1FNOA 2ZENA 5HVFA 3HUVA 1Z8LA 3QNVA 3ISZA 5LRKA 3JRUA 4NJRA 3B3SA 5LRJA 2AFXA 4MXUA 1LAMA 2ACFA 2AFOA 4A39A 4F9UA 1PYTB 4OMEA 4O23A 4K3NA 4ZX9A 4ZY2A 3H8FA 2HB6A 1NSAA 2AFUA 1KWMA 4D86A 1HEEA 1TXZA 1XMBA 2I3CA 1YSJA 2ZOGA 2BOAA 3BXMA 4K0CA 5LYFA 4OC2A 2VL1A 2PJ3A 2PJ9A 3V38A 4Z65A 1TXRA 1DE4C 3FX6A 4NGMA 5HVGA 4OC0A 4P4DA 2FAVA 1ZG7A 3EWPA 3VH9A 2PJ4A 4G1PA 3FVLA 4IAVA 4FWUA 2O4HA 3WC5A 2BO9A 2GLJA 3GB0A 2L8RA 5LYDA 2PJ8A 5HOLA 3IWWA 1Z5RA 2Q51A 1BAVA 1XRYA 1VGYA 2OOTA 4A38A 4P44A 5D29A 3NH4A 4UIAA 3Q71A 1DTDA 3I1UA 2PIYA 5CPAA 1TKJA 4TU0A 2C6PA 4ETKA 4PXDA 2IMOA 3LWUA 3D67A 2F8HA 4J5RA 2IQ6A 1M4LA 1HJZA 2AFZA 4PXCA
chains in the Genus database with same CATH superfamily
2RNKA 5E3BA 2VEZA 4P10A 4A2ZA 3FIXA 2C1CA 1EE3P 1I12A 3FJUA 3K2KA 3QB8A 3RNZA 1QSTA 4NGRA 5FSZA 2JZEA 3FEDA 4UF4A 2EEEA 2X7BA 3K9TA 1VHOA 4PK2A 2AE6A 4LQ6A 4YWYA 3FH4A 4P4FA 4R3LA 4UA3A 2RFHA 4KZTA 5AG7A 3FRMA 3S6HA 2R8VA 4KOUA 3R96A 3FXTA 1XE4A 3RBUA 4RI1A 2V8HA 4ZGYB 5G1ZA 1F57A 4EWTA 3SJEA 1YREA 3PB8X 4PXBA 5J1QA 3B3CA 4UFXA 4X3RA 4KVME 4R7MA 4KOVA 3RO0A 2QYVA 3PFOA 2BFQA 1CG2A 2X47A 1RO5A 2YNEA 1LCPA 5AG6A 4ABLA 3SIIA 2FVGA 2POKA 3V7ZA 3Q6ZA 3EJFA 3WC6A 4J3GA 2ZEOA 4J4ZA 3D7HA 2HQYA 8CPAA 4PK3A 4C2YA 5IV0A 1AUGA 4ORFA 3T90A 3B3VA 1IIDA 2PE3A 2ZEEA 4P6YA 4YRHA 3W6SA 3IU2A 4ZBGA 1UWYA 4DYOA 3NA6A 4XPDC 1SPVA 2BEIA 3VARA 4E0AA 4MHPA 3KHZA 1JQGA 3TO7A 4ONUA 4AG9A 1HDUA 4OC4A 4U9ZA 3MRUA 1ON0A 1R3NA 4MCRA 2J9AA 2OR4A 3CXSA 2PIZA 3IEHA 3WT4A 1MJ9A 2XEGA 4KOSA 4OP4A 3TX8A 4CGNA 2REFA 2FCKA 2BSWA 1BPNA 3VWDA 4BBHA 1H8LA 4L8AA 1KUXA 3TFYA 3SXOA 2OZHA 3IO1A 3JVNA 2Q0YA 2C27A 2HV2A 4NGSA 4GVWA 3F8KA 3KASA 3TOBA 3H8EA 4KYBA 2Z3NA 3MGDA 1NE9A 3QAYA 4IHMA 4M6IA 4Y49C 1WK4A 2WCTA 1N71A 5EMIA 5HMNA 2J8NA 2V8DA 2DF5A 3PBEA 4UEZA 3B8GA 3GQEA 4QBJA 4UWJA 1YD9A 2FXKA 3T8WA 1M1DA 2ZW4A 3PBBA 4OKOA 4CGLA 4FAIA 2PJBA 4X5KA 4P4JA 4L89A 3VFQA 3H4QA 1VIXA 1X10A 4UWIA 4AXVA 2D4PA 4UBRA 5AGEA 2GU2A 3IWGA 4JYWA 1XF8A 1R57A 4A32A 1CPSA 3GY9A 2VI7A 1LANA 1CP7A 2YNCA 1TY8A 2J8RA 4E8OA 4C7HA 2QIRA 4Q7AA 3G8WA 1Z4EA 1TIQA 4U5YA 2I00A 4NFRA 4FBEA 1ZLIA 3NFZA 3PP9A 5E96A 2WZNA 4H6UA 1AMPA 4H2KA 3SJFA 4KVOE 5KTAA 1Z8XA 1XMTA 2B4DB 4MRIA 3TOAA 1ZO0A 3KQXA 3GPOA 4R57A 4KSAA 3EWRA 3GYAA 1CPXA 4CAVA 4CYPA 3WR7A 2AJ6A 4ONWA 2JEWA 2OH1A 3EWQA 2DEAA 1ELLP 2JLMA 1M4GA 3IIFA 4KSFA 4MHYA 1HDQA 2JBKA 4XNHC 2NSMA 2PJ5A 4I49A 2AFCA 4LX9A 4A30A 2Q4ZA 3EJGA 2GREA 2B3UA 4W9YA 1VHUA 5IX3A 4BD9A 1L0CA 3FMCA 7CPAA 1GYTA 3EO4A 1X12A 4YGOA 5H86A 2DPTA 4CPAA 5F09A 4H89A 2VZZA 1YVOA 4ZX8A 1QSMA 1RXTA 2CTBA 3B2YA 3D4UA 2ZW7A 4NGQA 5FVJA 4ZI6A 3B7IA 4CAEA 1MJBA 2ZEPA 2G3AA 5LYIA 1TF9A 4X8IA 3V8IA 5DWNA 5I4MA 4OIWA 4JGKA 3DLJA 1ZR5A 4MCPA 1TKFA 1B87A 2RB7A 2G9DA 2ZELA 3S9MA 3N7ZA 2CF4A 4EVYA 4EMEA 3E0KA 3P2FA 1CP6A 4Q38A 1XBUA 2CNMA 2IL4A 3H5ZA 1TF8A 3KHXA 4MJ8A 3KI9A 4J5SA 2XEJA 3CDXA 1VHEA 1YW6A 1CBXA 3NE7A 3UY5A 4DNCA 3V45A 1QSRA 2G3TA 2ODFA 3I3GA 3EWOA 1Q2DA 3GKRA 4CAFA 2QMLA 4MHZA 4P45A 4PSWA 1Y0RA 4C68A 2BL1A 4IUSA 3EW5A 3SIHA 3CPAA 4F0YA 4KOWA 4X2TA 3B3TA 4C2XA 3EKEA 3NE8A 1Y7EA 4II9A 3CXQA 4RN7A 1V0CA 4MY3A 4R3KA 2VRIA 2XEFA 3BJ7A 4BINA 1LAPA 1Z2LA 3JZTA 5FSUA 2YNCC 2DX6A 2HC9A 2ZEFA 1CJWA 3SJXA 2C6GA 3D8PA 1BOBA 1IYKA 3GIUA 3IIBA 4UIBA 4A33A 2KQVA 1S7FA 3SXNA 5AILA 1LRZA 1S3ZA 2B4DA 3D7FA 2YNDA 2CNSA 3LMSA 5F47A 3IWEA 4B13A 4JWPA 4KSIA 3DR8A 4R8FA 2OZGA 3PB9X 3QAHA 5K8PA 4DJLA 3EY5A 3W6XA 4CAWA 2JEVA 3R95A 1IICA 1XIXA 5ELYA 2D4OA 2J8MA 4NGTA 2NYQA 2Q7BA 3PB4X 3H8GA 5DUSA 2O53A 3RAMA 4LQGA 3G3SA 1F2OA 4AB7A 2CIJA 4GVVA 4ZY0A 2GLFA 2P6EA 2V8GA 4JLLA 4NEXA 5G20A 4FD7A 3EFAA 4KS9A 2H5MA 4MCQA 4NJQA 1YW4A 2ARHA 1VHSA 5HVHA 1IGBA 3PEIA 1Q2YA 2XEIA 3IFEA 4KOYA 4P4IA 5THWA 3WABA 4F8ZA 2RC4A 4KOTA 1FY7A 4UCNA 2ZEMA 2NMTA 4UFWA 2FSRA 2EK9A 1A2ZA 1J4JA 3NH5A 3FEEA 4MFKA 1NJRA 2VZYA 4MFPA 1Z9UA 5IB0A 2PCUA 3DGVA 2Z3OA 3BI0A 2PRQA 3R9GA 3S6FA 4JLYA 1ZLHA 1ZG9A 4MFZA 4FUUA 2FIWA 3FECA 3PGPA 1Y9KA 5I0CA 3BHXA 3GUXA 4UMLA 1Z8WA 1QSNA 3JUWA 1IY7A 2Z11A 2PDOA 4CRZB 1QMUA 3NH8A 1S60A 4DUKA 3ZZIA 1QQ9A 4BMHA 4F9VA 2Q44A 3OWCA 2PJCA 4M3SA 1F2PA 4B11A 4MFLA 2LGRA 4A31A 4NGNA 4KUBA 1KZFA 2BCOA 3CZXA 3PFEA 4GM5A 4NSQA 3S6GA 3FYNA 3GQOA 4M6GA 2PJ7A 6CPAA 2FG1A 3DSBA 3FNCA 3PB6X 4OC5A 5K8OA 4B6ZA 3KR4A 1M44A 1I21A 4KORA 1YGHA 2W2GA 4MCSA 3IC1A 5FSXA 4MY0A 1MK4A 3F5BA 4R6TA 2EUIA 5FSVA 4UEFA 3F0AA 4CAXA 4F0XA 5LYLA 4C7IA 2FIAA 1IU8A 1P0HA 3SI2A 2V77A 2YGWA 3FB3A 4P4BA 2DXQA 5D8NA 1ARMA 2PSWA 4IQYA 2AFSA 4XPKA 5JPHA 2BFRA 4U9YA 3KR5A 4JXQA 1IOFA 3KQZA 2PQ8A 1S5KA 4ESSA 4R87A 3PZJA 4K30A 5AG5A 1YLOA 3PB7X 3S9LA 1K4JA 3IIDA 2KCWA 4IK2A 2EVNA 1XOVA 5HXDA 1PU9A 4JJXA 3KKWA 4P4EA 3D3SA 5HIHA 3TC8A 1QSOA 2PRBA 2FS5A 3HLPA 3D68A 3GPQA 1ARLA 3SHPA 2O28A 3D2PA 4CYNA 3B35A 1KUVA 4QC6A 1LOKA 3DDDA 3R1KA 4H6ZA 3VATA 2CY2A 1UFHA 3L2NA 1FT7A 1XEBA 1MJAA 2PJ6A 2C6CA 4UCPA 5K8MA 3SI1A 4KLVA 3IJ3A 4Q36A 4F6AA 1RTQA 3DR6A 1XJOA 2B4BA 4E2AA 2OU2A 3RYOA 4C2ZA 4HPSA 4CS0B 1ZG8A 1TKHA 2OZUA 3K9UA 3DNSA 3SI0A 4MMOA 2FXFA 1XFOA 3R9FA 5KTCA 1M4IA 4CYQA 2DPSA 4LUAA 4UCMA 2VXKA 2Q43A 3SJGA 3LD2A 3N5FA 3T9YA 2F7VA 4B5PA 3CXPA 2QVPA 2ZW5A 1PCAA 2GANA 4CRYB 4NCZA 2IJZA 3ISXA 2ZEGA 1WWZA 3KZWA 3LODA 1OZPA 3LACA 1NMTA 2PJ2A 4GS4A 4M85A 4NGPA 2JZDA 2WUUA 2P6GA 2WYRA 4JCAA 2Z0ZA 4ABKA 3TCVA 2XD7A 2Z10A 4HNWB 4PXEA 4J5QA 2FL4A 3D66A 4ZYQA 1AYEA 2CXAA 2PJAA 4YU9A 5CMSA 2VBQA 4QUSA 2EBJA 4A37A 2CNTA 5DS0A 1U6MA 3EC4A 4PPZA 2P6FA 1YVKA 4CGMA 3FF3A 4XPLA 1ZR3A 4GUAA 2QJ8A 4B10A 5G21A 1R43A 5JH9A 3P2HA 2ZEHA 3D7GA 1B6BA 4OC1A 3ZJ0A 4AVCA 4QVTA 4HKFA 3TO9A 2AFMA 2ABZA 4TWEA 3WC7A 5CNPA 3EXNA 3R9EA 3CPXA 4MFQA 3RZAA 5CB3A 5A27A 1ELMP 2PJ1A 4TNUA 2Q7SA 5FSYA 1BPMA 2REEA 4ETJA 4RS2A 5IB9A 2EO8A 2EWBA 4WJBA 3S9NA 1NSLA 4QB9A 4B14A 3GLJA 2GFQA 1Z8TA 3CT9A 4OIDA 2B5GB 3TT2A 5CB5A 1BLLE 1Y7RA 2Q4YA 4OC3A 5A28A 5KTDA 1IOIA 4JZ0A 3SIGA 2ANPA 2PR8A 5AG4A 4MHNA 5CBMA 1Y0YA 4R9MA 5J8CA 2PJ0A 4A94A 5K8NA 1YLEA 2WPWA 4MFJA 4UEEA 4GXHA 4CGPA 2PVVA 2ZOFA 3PRTA 4WWVA 5HH1A 3V2BA 3MN8A 2ZEDA 4XPDB 3SIJA 4AG7A 2WPXA 3BI1A 4ZY1A 2CTCA 3TO6A 1YMEA 2F5IA 3D7DA 2EK8A 4EFDA 5JGFA 5JM6A 4PQAA 1S7KA 4MHDA 4RUHA 2PVWA 5C82A 1CM0A 1CX8A 3KGQA 4OAEA 5F49A 5F46A 1I1DA 2Q4VA 2QECA 4FD5A 2V8VA 5GCNA 2AFWA 3B3WA 5G22A 5LRGA 3ETIA 4B5PB 4FD6A 3GPGA 1OBRA 2I79A 1Z4RA 4R76A 4NXYA 2JBJA 1LFWA 1IB1E 2R98A 2Z3PA 1Q7LA 3KL9A 4JVVA 1FNOA 2ZENA 4JD6A 5HVFA 4PSXA 2R7HA 1Z8LA 1PUAA 2PC1A 3HUVA 3QNVA 1S7NA 4Y49B 3BLNA 3ISZA 5LRKA 3JRUA 2JDDA 4NJRA 3B3SA 5LRJA 2P0WA 2AFXA 4AVAA 4MXUA 1LAMA 2ACFA 5ISVA 3I9SA 2AFOA 4JXRA 3A9LA 4A39A 4F9UA 2ZXVA 3TTHA 1PYTB 2HUZA 4OMEA 2K5TA 4K3NA 4ZX9A 4ZY2A 3IGRA 1GHEA 4O23A 1VKCA 2WSAA 3H8FA 2HB6A 1NSAA 2AFUA 2Z3LA 3C26A 1KWMA 4D86A 1HEEA 4CYOA 4YFJA 4AVBA 1YQEA 1YR0A 1TXZA 1XMBA 2I3CA 2FE7A 4MI4A 4KLWA 1YSJA 1BO4A 2ZOGA 1IYLA 2BOAA 3BXMA 4IF5A 4K0CA 5LYFA 2B3VA 4OC2A 1S7LA 4HNYB 4CGOA 2A4NA 2VL1A 2PJ3A 3VWEA 3D2MA 2Z3KA 2PJ9A 3TE4A 3V38A 2B58A 3W91A 4Z65A 1TXRA 5JQ4A 1DE4C 2Y0MA 3FX6A 4NF1A 4NGMA 4A95A 4OC0A 5HVGA 4XNHB 2B5GA 4P4DA 5EBVA 2FAVA 1ZG7A 3EWPA 3VH9A 2PJ4A 4G1PA 1M4DA 4UFVA 3S6KA 2G0BA 4M6HA 3FVLA 4IAVA 4PV6A 4FWUA 2O4HA 3WC5A 2BUEA 2BO9A 2GLJA 3GB0A 2L8RA 5LYDA 2JDCA 2PJ8A 5F48A 5HOLA 2ATRA 1YK3A 1YX0A 3IWWA 1Z5RA 2Q51A 1BAVA 3BJ8A 4HNXB 1XRYA 1JWQA 1VGYA 3FBUA 4FD4A 2OOTA 2GE3A 4P44A 5D29A 4A38A 3NH4A 2Q04A 5BWAB 4UIAA 4OADA 3Q71A 2ZW6A 1DTDA 3I1UA 4OLLA 2PR1A 5J8FA 1SQHA 2VQYA 1Q2CA 2GIVA 2PIYA 5CPAA 1P4NA 4KOXA 1TKJA 2JZFA 4B12A 4TU0A 2C6PA 5C88A 1KUYA 4ETKA 2R1IA 4PXDA 2IMOA 3JTKA 3LWUA 4MBUA 5DWMA 4KVXA 2ZPAA 3D67A 5H84A 2F8HA 4KUAA 5EC4A 4B5OA 4J5RA 1Y9WA 2IQ6A 1M4LA 2OB0A 2Z3MA 1HJZA 3IU1A 2FT0A 2AFZA 4PXCA
chains in the Genus database with same CATH topology
5E3BA 4P10A 2C1CA 1EE3P 3FJUA 3K2KA 4NGRA 5FSZA 3FEDA 4UF4A 2EEEA 3K9TA 1VHOA 4YWYA 3FH4A 4P4FA 2RFHA 3RBUA 2V8HA 1F57A 4EWTA 3SJEA 3PB8X 4PXBA 5J1QA 3B3CA 4X3RA 4R7MA 2QYVA 3PFOA 2BFQA 1CG2A 2X47A 1LCPA 4ABLA 3SIIA 2POKA 2FVGA 3V7ZA 3Q6ZA 3EJFA 3WC6A 2ZEOA 4J4ZA 3D7HA 8CPAA 3B3VA 2ZEEA 2PE3A 4P6YA 1UWYA 4DYOA 3NA6A 1SPVA 3VARA 4MHPA 3KHZA 1JQGA 1HDUA 4OC4A 3MRUA 1R3NA 4MCRA 2J9AA 2OR4A 3IEHA 2PIZA 3WT4A 2XEGA 4OP4A 3TX8A 1BPNA 1H8LA 3IO1A 4NGSA 4GVWA 3KASA 3H8EA 4KYBA 4IHMA 2V8DA 3PBEA 4UEZA 3GQEA 1YD9A 2FXKA 3T8WA 3PBBA 4OKOA 4FAIA 2PJBA 4P4JA 3VFQA 1VIXA 4AXVA 2GU2A 4JYWA 1CPSA 1LANA 1CP7A 1TY8A 4Q7AA 4NFRA 4FBEA 1ZLIA 3NFZA 2WZNA 1AMPA 4H2KA 3SJFA 4MRIA 3KQXA 3GPOA 3EWRA 1CPXA 4ONWA 2JEWA 3EWQA 2DEAA 1ELLP 3IIFA 4MHYA 1HDQA 2JBKA 2NSMA 2PJ5A 2AFCA 2Q4ZA 3EJGA 2GREA 4W9YA 1VHUA 4BD9A 3FMCA 7CPAA 1GYTA 4CPAA 5F09A 3B2YA 2CTBA 4ZX8A 3D4UA 4NGQA 4ZI6A 3B7IA 2ZEPA 5LYIA 1TF9A 4X8IA 5I4MA 4OIWA 4JGKA 3DLJA 1ZR5A 4MCPA 1TKFA 2RB7A 2G9DA 2ZELA 3S9MA 2CF4A 4EMEA 1CP6A 1XBUA 1TF8A 3KHXA 3KI9A 4J5SA 2XEJA 3CDXA 1VHEA 1YW6A 1CBXA 3V45A 3EWOA 4MHZA 4P45A 1Y0RA 3EW5A 3SIHA 3CPAA 4X2TA 3B3TA 3EKEA 1Y7EA 2VRIA 2XEFA 1LAPA 1Z2LA 3JZTA 5FSUA 2DX6A 2HC9A 2ZEFA 3SJXA 2C6GA 3IIBA 4UIBA 5AILA 3D7FA 3LMSA 4KSIA 4R8FA 5K8PA 3PB9X 4DJLA 5ELYA 4NGTA 2NYQA 3PB4X 3H8GA 5DUSA 2O53A 3RAMA 4LQGA 1F2OA 2CIJA 4GVVA 4ZY0A 2GLFA 2V8GA 4JLLA 4MCQA 4NJQA 1YW4A 5HVHA 1IGBA 3PEIA 2XEIA 3IFEA 4P4IA 3WABA 5THWA 4F8ZA 2ZEMA 2EK9A 3NH5A 3FEEA 1NJRA 2PCUA 3DGVA 3BI0A 2PRQA 1ZLHA 1ZG9A 4FUUA 3FECA 3BHXA 3GUXA 4UMLA 1IY7A 1QMUA 3NH8A 4DUKA 1QQ9A 4F9VA 2PJCA 1F2PA 2LGRA 4NGNA 2BCOA 3PFEA 4GM5A 6CPAA 3GQOA 2PJ7A 2FG1A 3PB6X 4OC5A 5K8OA 4B6ZA 3KR4A 4MCSA 3IC1A 5FSXA 4UEFA 4R6TA 5FSVA 5LYLA 3SI2A 2V77A 4P4BA 5D8NA 1ARMA 4IQYA 2AFSA 2BFRA 3KR5A 3KQZA 4ESSA 1YLOA 3PB7X 3S9LA 3IIDA 4IK2A 5HXDA 4P4EA 5HIHA 3TC8A 3HLPA 3D68A 3GPQA 1ARLA 3B35A 1LOKA 3VATA 3L2NA 1FT7A 2PJ6A 2C6CA 5K8MA 3SI1A 3IJ3A 1RTQA 1XJOA 1ZG8A 1TKHA 3SI0A 4MMOA 1XFOA 2Q43A 3SJGA 3N5FA 2F7VA 2QVPA 1PCAA 2IJZA 3ISXA 2ZEGA 3KZWA 2PJ2A 4NGPA 2WYRA 4JCAA 4ABKA 2XD7A 4PXEA 4J5QA 3D66A 4ZYQA 1AYEA 2PJAA 4YU9A 4A37A 5CMSA 5DS0A 4PPZA 3FF3A 1ZR3A 4GUAA 2QJ8A 1R43A 5JH9A 2ZEHA 3D7GA 4OC1A 2AFMA 2ABZA 4TWEA 3WC7A 3CPXA 3RZAA 5CB3A 1ELMP 2PJ1A 4TNUA 5FSYA 1BPMA 4ETJA 5IB9A 2EWBA 4WJBA 3S9NA 3GLJA 3CT9A 4OIDA 5CB5A 1BLLE 4OC3A 4JZ0A 3SIGA 2ANPA 4MHNA 5CBMA 1Y0YA 2PJ0A 4A94A 5K8NA 4UEEA 2PVVA 2ZOFA 3PRTA 4WWVA 3V2BA 3MN8A 2ZEDA 3SIJA 3BI1A 4ZY1A 2CTCA 1YMEA 3D7DA 2EK8A 4EFDA 5JGFA 5JM6A 4PQAA 4RUHA 2PVWA 3KGQA 1CX8A 2V8VA 2AFWA 3B3WA 5LRGA 3ETIA 3GPGA 1OBRA 4R76A 2JBJA 1LFWA 1Q7LA 3KL9A 4JVVA 1FNOA 2ZENA 5HVFA 3HUVA 1Z8LA 3QNVA 3ISZA 5LRKA 3JRUA 4NJRA 3B3SA 5LRJA 2AFXA 4MXUA 1LAMA 2ACFA 2AFOA 4A39A 4F9UA 1PYTB 4OMEA 4O23A 4K3NA 4ZX9A 4ZY2A 3H8FA 2HB6A 1NSAA 2AFUA 1KWMA 4D86A 1HEEA 1TXZA 1XMBA 2I3CA 1YSJA 2ZOGA 2BOAA 3BXMA 4K0CA 5LYFA 4OC2A 2VL1A 2PJ3A 2PJ9A 3V38A 4Z65A 1TXRA 1DE4C 3FX6A 4NGMA 5HVGA 4OC0A 4P4DA 2FAVA 1ZG7A 3EWPA 3VH9A 2PJ4A 4G1PA 3FVLA 4IAVA 4FWUA 2O4HA 3WC5A 2BO9A 2GLJA 3GB0A 2L8RA 5LYDA 2PJ8A 5HOLA 3IWWA 1Z5RA 2Q51A 1BAVA 1XRYA 1VGYA 2OOTA 4A38A 4P44A 5D29A 3NH4A 4UIAA 3Q71A 1DTDA 3I1UA 2PIYA 5CPAA 1TKJA 4TU0A 2C6PA 4ETKA 4PXDA 2IMOA 3LWUA 3D67A 2F8HA 4J5RA 2IQ6A 1M4LA 1HJZA 2AFZA 4PXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3B A;  4P10 A;  2C1C A;  1EE3 P;  3FJU A;  3K2K A;  4NGR A;  5FSZ A;  3FED A;  4UF4 A;  2EEE A;  3K9T A;  1VHO A;  4YWY A;  3FH4 A;  4P4F A;  2RFH A;  3RBU A;  2V8H A;  1F57 A;  4EWT A;  3SJE A;  3PB8 X;  4PXB A;  5J1Q A;  3B3C A;  4X3R A;  4R7M A;  2QYV A;  3PFO A;  2BFQ A;  1CG2 A;  2X47 A;  1LCP A;  4ABL A;  3SII A;  2POK A;  2FVG A;  3V7Z A;  3Q6Z A;  3EJF A;  3WC6 A;  2ZEO A;  4J4Z A;  3D7H A;  8CPA A;  3B3V A;  2ZEE A;  2PE3 A;  4P6Y A;  1UWY A;  4DYO A;  3NA6 A;  1SPV A;  3VAR A;  4MHP A;  3KHZ A;  1JQG A;  1HDU A;  4OC4 A;  3MRU A;  1R3N A;  4MCR A;  2J9A A;  2OR4 A;  3IEH A;  2PIZ A;  3WT4 A;  2XEG A;  4OP4 A;  3TX8 A;  1BPN A;  1H8L A;  3IO1 A;  4NGS A;  4GVW A;  3KAS A;  3H8E A;  4KYB A;  4IHM A;  2V8D A;  3PBE A;  4UEZ A;  3GQE A;  1YD9 A;  2FXK A;  3T8W A;  3PBB A;  4OKO A;  4FAI A;  2PJB A;  4P4J A;  3VFQ A;  1VIX A;  4AXV A;  2GU2 A;  4JYW A;  1CPS A;  1LAN A;  1CP7 A;  1TY8 A;  4Q7A A;  4NFR A;  4FBE A;  1ZLI A;  3NFZ A;  2WZN A;  1AMP A;  4H2K A;  3SJF A;  4MRI A;  3KQX A;  3GPO A;  3EWR A;  1CPX A;  4ONW A;  2JEW A;  3EWQ A;  2DEA A;  1ELL P;  3IIF A;  4MHY A;  1HDQ A;  2JBK A;  2NSM A;  2PJ5 A;  2AFC A;  2Q4Z A;  3EJG A;  2GRE A;  4W9Y A;  1VHU A;  4BD9 A;  3FMC A;  7CPA A;  1GYT A;  4CPA A;  5F09 A;  3B2Y A;  2CTB A;  4ZX8 A;  3D4U A;  4NGQ A;  4ZI6 A;  3B7I A;  2ZEP A;  5LYI A;  1TF9 A;  4X8I A;  5I4M A;  4OIW A;  4JGK A;  3DLJ A;  1ZR5 A;  4MCP A;  1TKF A;  2RB7 A;  2G9D A;  2ZEL A;  3S9M A;  2CF4 A;  4EME A;  1CP6 A;  1XBU A;  1TF8 A;  3KHX A;  3KI9 A;  4J5S A;  2XEJ A;  3CDX A;  1VHE A;  1YW6 A;  1CBX A;  3V45 A;  3EWO A;  4MHZ A;  4P45 A;  1Y0R A;  3EW5 A;  3SIH A;  3CPA A;  4X2T A;  3B3T A;  3EKE A;  1Y7E A;  2VRI A;  2XEF A;  1LAP A;  1Z2L A;  3JZT A;  5FSU A;  2DX6 A;  2HC9 A;  2ZEF A;  3SJX A;  2C6G A;  3IIB A;  4UIB A;  5AIL A;  3D7F A;  3LMS A;  4KSI A;  4R8F A;  5K8P A;  3PB9 X;  4DJL A;  5ELY A;  4NGT A;  2NYQ A;  3PB4 X;  3H8G A;  5DUS A;  2O53 A;  3RAM A;  4LQG A;  1F2O A;  2CIJ A;  4GVV A;  4ZY0 A;  2GLF A;  2V8G A;  4JLL A;  4MCQ A;  4NJQ A;  1YW4 A;  5HVH A;  1IGB A;  3PEI A;  2XEI A;  3IFE A;  4P4I A;  3WAB A;  5THW A;  4F8Z A;  2ZEM A;  2EK9 A;  3NH5 A;  3FEE A;  1NJR A;  2PCU A;  3DGV A;  3BI0 A;  2PRQ A;  1ZLH A;  1ZG9 A;  4FUU A;  3FEC A;  3BHX A;  3GUX A;  4UML A;  1IY7 A;  1QMU A;  3NH8 A;  4DUK A;  1QQ9 A;  4F9V A;  2PJC A;  1F2P A;  2LGR A;  4NGN A;  2BCO A;  3PFE A;  4GM5 A;  6CPA A;  3GQO A;  2PJ7 A;  2FG1 A;  3PB6 X;  4OC5 A;  5K8O A;  4B6Z A;  3KR4 A;  4MCS A;  3IC1 A;  5FSX A;  4UEF A;  4R6T A;  5FSV A;  5LYL A;  3SI2 A;  2V77 A;  4P4B A;  5D8N A;  1ARM A;  4IQY A;  2AFS A;  2BFR A;  3KR5 A;  3KQZ A;  4ESS A;  1YLO A;  3PB7 X;  3S9L A;  3IID A;  4IK2 A;  5HXD A;  4P4E A;  5HIH A;  3TC8 A;  3HLP A;  3D68 A;  3GPQ A;  1ARL A;  3B35 A;  1LOK A;  3VAT A;  3L2N A;  1FT7 A;  2PJ6 A;  2C6C A;  5K8M A;  3SI1 A;  3IJ3 A;  1RTQ A;  1XJO A;  1ZG8 A;  1TKH A;  3SI0 A;  4MMO A;  1XFO A;  2Q43 A;  3SJG A;  3N5F A;  2F7V A;  2QVP A;  1PCA A;  2IJZ A;  3ISX A;  2ZEG A;  3KZW A;  2PJ2 A;  4NGP A;  2WYR A;  4JCA A;  4ABK A;  2XD7 A;  4PXE A;  4J5Q A;  3D66 A;  4ZYQ A;  1AYE A;  2PJA A;  4YU9 A;  4A37 A;  5CMS A;  5DS0 A;  4PPZ A;  3FF3 A;  1ZR3 A;  4GUA A;  2QJ8 A;  1R43 A;  5JH9 A;  2ZEH A;  3D7G A;  4OC1 A;  2AFM A;  2ABZ A;  4TWE A;  3WC7 A;  3CPX A;  3RZA A;  5CB3 A;  1ELM P;  2PJ1 A;  4TNU A;  5FSY A;  1BPM A;  4ETJ A;  5IB9 A;  2EWB A;  4WJB A;  3S9N A;  3GLJ A;  3CT9 A;  4OID A;  5CB5 A;  1BLL E;  4OC3 A;  4JZ0 A;  3SIG A;  2ANP A;  4MHN A;  5CBM A;  1Y0Y A;  2PJ0 A;  4A94 A;  5K8N A;  4UEE A;  2PVV A;  2ZOF A;  3PRT A;  4WWV A;  3V2B A;  3MN8 A;  2ZED A;  3SIJ A;  3BI1 A;  4ZY1 A;  2CTC A;  1YME A;  3D7D A;  2EK8 A;  4EFD A;  5JGF A;  5JM6 A;  4PQA A;  4RUH A;  2PVW A;  3KGQ A;  1CX8 A;  2V8V A;  2AFW A;  3B3W A;  5LRG A;  3ETI A;  3GPG A;  1OBR A;  4R76 A;  2JBJ A;  1LFW A;  1Q7L A;  3KL9 A;  4JVV A;  1FNO A;  2ZEN A;  5HVF A;  3HUV A;  1Z8L A;  3QNV A;  3ISZ A;  5LRK A;  3JRU A;  4NJR A;  3B3S A;  5LRJ A;  2AFX A;  4MXU A;  1LAM A;  2ACF A;  2AFO A;  4A39 A;  4F9U A;  1PYT B;  4OME A;  4O23 A;  4K3N A;  4ZX9 A;  4ZY2 A;  3H8F A;  2HB6 A;  1NSA A;  2AFU A;  1KWM A;  4D86 A;  1HEE A;  1TXZ A;  1XMB A;  2I3C A;  1YSJ A;  2ZOG A;  2BOA A;  3BXM A;  4K0C A;  5LYF A;  4OC2 A;  2VL1 A;  2PJ3 A;  2PJ9 A;  3V38 A;  4Z65 A;  1TXR A;  1DE4 C;  3FX6 A;  4NGM A;  5HVG A;  4OC0 A;  4P4D A;  2FAV A;  1ZG7 A;  3EWP A;  3VH9 A;  2PJ4 A;  4G1P A;  3FVL A;  4IAV A;  4FWU A;  2O4H A;  3WC5 A;  2BO9 A;  2GLJ A;  3GB0 A;  2L8R A;  5LYD A;  2PJ8 A;  5HOL A;  3IWW A;  1Z5R A;  2Q51 A;  1BAV A;  1XRY A;  1VGY A;  2OOT A;  4A38 A;  4P44 A;  5D29 A;  3NH4 A;  4UIA A;  3Q71 A;  1DTD A;  3I1U A;  2PIY A;  5CPA A;  1TKJ A;  4TU0 A;  2C6P A;  4ETK A;  4PXD A;  2IMO A;  3LWU A;  3D67 A;  2F8H A;  4J5R A;  2IQ6 A;  1M4L A;  1HJZ A;  2AFZ A;  4PXC A; 
#chains in the Genus database with same CATH topology
 2RNK A;  5E3B A;  2VEZ A;  4P10 A;  4A2Z A;  3FIX A;  2C1C A;  1EE3 P;  1I12 A;  3FJU A;  3K2K A;  3QB8 A;  3RNZ A;  1QST A;  4NGR A;  5FSZ A;  2JZE A;  3FED A;  4UF4 A;  2EEE A;  2X7B A;  3K9T A;  1VHO A;  4PK2 A;  2AE6 A;  4LQ6 A;  4YWY A;  3FH4 A;  4P4F A;  4R3L A;  4UA3 A;  2RFH A;  4KZT A;  5AG7 A;  3FRM A;  3S6H A;  2R8V A;  4KOU A;  3R96 A;  3FXT A;  1XE4 A;  3RBU A;  4RI1 A;  2V8H A;  4ZGY B;  5G1Z A;  1F57 A;  4EWT A;  3SJE A;  1YRE A;  3PB8 X;  4PXB A;  5J1Q A;  3B3C A;  4UFX A;  4X3R A;  4KVM E;  4R7M A;  4KOV A;  3RO0 A;  2QYV A;  3PFO A;  2BFQ A;  1CG2 A;  2X47 A;  1RO5 A;  2YNE A;  1LCP A;  5AG6 A;  4ABL A;  3SII A;  2FVG A;  2POK A;  3V7Z A;  3Q6Z A;  3EJF A;  3WC6 A;  4J3G A;  2ZEO A;  4J4Z A;  3D7H A;  2HQY A;  8CPA A;  4PK3 A;  4C2Y A;  5IV0 A;  1AUG A;  4ORF A;  3T90 A;  3B3V A;  1IID A;  2PE3 A;  2ZEE A;  4P6Y A;  4YRH A;  3W6S A;  3IU2 A;  4ZBG A;  1UWY A;  4DYO A;  3NA6 A;  4XPD C;  1SPV A;  2BEI A;  3VAR A;  4E0A A;  4MHP A;  3KHZ A;  1JQG A;  3TO7 A;  4ONU A;  4AG9 A;  1HDU A;  4OC4 A;  4U9Z A;  3MRU A;  1ON0 A;  1R3N A;  4MCR A;  2J9A A;  2OR4 A;  3CXS A;  2PIZ A;  3IEH A;  3WT4 A;  1MJ9 A;  2XEG A;  4KOS A;  4OP4 A;  3TX8 A;  4CGN A;  2REF A;  2FCK A;  2BSW A;  1BPN A;  3VWD A;  4BBH A;  1H8L A;  4L8A A;  1KUX A;  3TFY A;  3SXO A;  2OZH A;  3IO1 A;  3JVN A;  2Q0Y A;  2C27 A;  2HV2 A;  4NGS A;  4GVW A;  3F8K A;  3KAS A;  3TOB A;  3H8E A;  4KYB A;  2Z3N A;  3MGD A;  1NE9 A;  3QAY A;  4IHM A;  4M6I A;  4Y49 C;  1WK4 A;  2WCT A;  1N71 A;  5EMI A;  5HMN A;  2J8N A;  2V8D A;  2DF5 A;  3PBE A;  4UEZ A;  3B8G A;  3GQE A;  4QBJ A;  4UWJ A;  1YD9 A;  2FXK A;  3T8W A;  1M1D A;  2ZW4 A;  3PBB A;  4OKO A;  4CGL A;  4FAI A;  2PJB A;  4X5K A;  4P4J A;  4L89 A;  3VFQ A;  3H4Q A;  1VIX A;  1X10 A;  4UWI A;  4AXV A;  2D4P A;  4UBR A;  5AGE A;  2GU2 A;  3IWG A;  4JYW A;  1XF8 A;  1R57 A;  4A32 A;  1CPS A;  3GY9 A;  2VI7 A;  1LAN A;  1CP7 A;  2YNC A;  1TY8 A;  2J8R A;  4E8O A;  4C7H A;  2QIR A;  4Q7A A;  3G8W A;  1Z4E A;  1TIQ A;  4U5Y A;  2I00 A;  4NFR A;  4FBE A;  1ZLI A;  3NFZ A;  3PP9 A;  5E96 A;  2WZN A;  4H6U A;  1AMP A;  4H2K A;  3SJF A;  4KVO E;  5KTA A;  1Z8X A;  1XMT A;  2B4D B;  4MRI A;  3TOA A;  1ZO0 A;  3KQX A;  3GPO A;  4R57 A;  4KSA A;  3EWR A;  3GYA A;  1CPX A;  4CAV A;  4CYP A;  3WR7 A;  2AJ6 A;  4ONW A;  2JEW A;  2OH1 A;  3EWQ A;  2DEA A;  1ELL P;  2JLM A;  1M4G A;  3IIF A;  4KSF A;  4MHY A;  1HDQ A;  2JBK A;  4XNH C;  2NSM A;  2PJ5 A;  4I49 A;  2AFC A;  4LX9 A;  4A30 A;  2Q4Z A;  3EJG A;  2GRE A;  2B3U A;  4W9Y A;  1VHU A;  5IX3 A;  4BD9 A;  1L0C A;  3FMC A;  7CPA A;  1GYT A;  3EO4 A;  1X12 A;  4YGO A;  5H86 A;  2DPT A;  4CPA A;  5F09 A;  4H89 A;  2VZZ A;  1YVO A;  4ZX8 A;  1QSM A;  1RXT A;  2CTB A;  3B2Y A;  3D4U A;  2ZW7 A;  4NGQ A;  5FVJ A;  4ZI6 A;  3B7I A;  4CAE A;  1MJB A;  2ZEP A;  2G3A A;  5LYI A;  1TF9 A;  4X8I A;  3V8I A;  5DWN A;  5I4M A;  4OIW A;  4JGK A;  3DLJ A;  1ZR5 A;  4MCP A;  1TKF A;  1B87 A;  2RB7 A;  2G9D A;  2ZEL A;  3S9M A;  3N7Z A;  2CF4 A;  4EVY A;  4EME A;  3E0K A;  3P2F A;  1CP6 A;  4Q38 A;  1XBU A;  2CNM A;  2IL4 A;  3H5Z A;  1TF8 A;  3KHX A;  4MJ8 A;  3KI9 A;  4J5S A;  2XEJ A;  3CDX A;  1VHE A;  1YW6 A;  1CBX A;  3NE7 A;  3UY5 A;  4DNC A;  3V45 A;  1QSR A;  2G3T A;  2ODF A;  3I3G A;  3EWO A;  1Q2D A;  3GKR A;  4CAF A;  2QML A;  4MHZ A;  4P45 A;  4PSW A;  1Y0R A;  4C68 A;  2BL1 A;  4IUS A;  3EW5 A;  3SIH A;  3CPA A;  4F0Y A;  4KOW A;  4X2T A;  3B3T A;  4C2X A;  3EKE A;  3NE8 A;  1Y7E A;  4II9 A;  3CXQ A;  4RN7 A;  1V0C A;  4MY3 A;  4R3K A;  2VRI A;  2XEF A;  3BJ7 A;  4BIN A;  1LAP A;  1Z2L A;  3JZT A;  5FSU A;  2YNC C;  2DX6 A;  2HC9 A;  2ZEF A;  1CJW A;  3SJX A;  2C6G A;  3D8P A;  1BOB A;  1IYK A;  3GIU A;  3IIB A;  4UIB A;  4A33 A;  2KQV A;  1S7F A;  3SXN A;  5AIL A;  1LRZ A;  1S3Z A;  2B4D A;  3D7F A;  2YND A;  2CNS A;  3LMS A;  5F47 A;  3IWE A;  4B13 A;  4JWP A;  4KSI A;  3DR8 A;  4R8F A;  2OZG A;  3PB9 X;  3QAH A;  5K8P A;  4DJL A;  3EY5 A;  3W6X A;  4CAW A;  2JEV A;  3R95 A;  1IIC A;  1XIX A;  5ELY A;  2D4O A;  2J8M A;  4NGT A;  2NYQ A;  2Q7B A;  3PB4 X;  3H8G A;  5DUS A;  2O53 A;  3RAM A;  4LQG A;  3G3S A;  1F2O A;  4AB7 A;  2CIJ A;  4GVV A;  4ZY0 A;  2GLF A;  2P6E A;  2V8G A;  4JLL A;  4NEX A;  5G20 A;  4FD7 A;  3EFA A;  4KS9 A;  2H5M A;  4MCQ A;  4NJQ A;  1YW4 A;  2ARH A;  1VHS A;  5HVH A;  1IGB A;  3PEI A;  1Q2Y A;  2XEI A;  3IFE A;  4KOY A;  4P4I A;  5THW A;  3WAB A;  4F8Z A;  2RC4 A;  4KOT A;  1FY7 A;  4UCN A;  2ZEM A;  2NMT A;  4UFW A;  2FSR A;  2EK9 A;  1A2Z A;  1J4J A;  3NH5 A;  3FEE A;  4MFK A;  1NJR A;  2VZY A;  4MFP A;  1Z9U A;  5IB0 A;  2PCU A;  3DGV A;  2Z3O A;  3BI0 A;  2PRQ A;  3R9G A;  3S6F A;  4JLY A;  1ZLH A;  1ZG9 A;  4MFZ A;  4FUU A;  2FIW A;  3FEC A;  3PGP A;  1Y9K A;  5I0C A;  3BHX A;  3GUX A;  4UML A;  1Z8W A;  1QSN A;  3JUW A;  1IY7 A;  2Z11 A;  2PDO A;  4CRZ B;  1QMU A;  3NH8 A;  1S60 A;  4DUK A;  3ZZI A;  1QQ9 A;  4BMH A;  4F9V A;  2Q44 A;  3OWC A;  2PJC A;  4M3S A;  1F2P A;  4B11 A;  4MFL A;  2LGR A;  4A31 A;  4NGN A;  4KUB A;  1KZF A;  2BCO A;  3CZX A;  3PFE A;  4GM5 A;  4NSQ A;  3S6G A;  3FYN A;  3GQO A;  4M6G A;  2PJ7 A;  6CPA A;  2FG1 A;  3DSB A;  3FNC A;  3PB6 X;  4OC5 A;  5K8O A;  4B6Z A;  3KR4 A;  1M44 A;  1I21 A;  4KOR A;  1YGH A;  2W2G A;  4MCS A;  3IC1 A;  5FSX A;  4MY0 A;  1MK4 A;  3F5B A;  4R6T A;  2EUI A;  5FSV A;  4UEF A;  3F0A A;  4CAX A;  4F0X A;  5LYL A;  4C7I A;  2FIA A;  1IU8 A;  1P0H A;  3SI2 A;  2V77 A;  2YGW A;  3FB3 A;  4P4B A;  2DXQ A;  5D8N A;  1ARM A;  2PSW A;  4IQY A;  2AFS A;  4XPK A;  5JPH A;  2BFR A;  4U9Y A;  3KR5 A;  4JXQ A;  1IOF A;  3KQZ A;  2PQ8 A;  1S5K A;  4ESS A;  4R87 A;  3PZJ A;  4K30 A;  5AG5 A;  1YLO A;  3PB7 X;  3S9L A;  1K4J A;  3IID A;  2KCW A;  4IK2 A;  2EVN A;  1XOV A;  5HXD A;  1PU9 A;  4JJX A;  3KKW A;  4P4E A;  3D3S A;  5HIH A;  3TC8 A;  1QSO A;  2PRB A;  2FS5 A;  3HLP A;  3D68 A;  3GPQ A;  1ARL A;  3SHP A;  2O28 A;  3D2P A;  4CYN A;  3B35 A;  1KUV A;  4QC6 A;  1LOK A;  3DDD A;  3R1K A;  4H6Z A;  3VAT A;  2CY2 A;  1UFH A;  3L2N A;  1FT7 A;  1XEB A;  1MJA A;  2PJ6 A;  2C6C A;  4UCP A;  5K8M A;  3SI1 A;  4KLV A;  3IJ3 A;  4Q36 A;  4F6A A;  1RTQ A;  3DR6 A;  1XJO A;  2B4B A;  4E2A A;  2OU2 A;  3RYO A;  4C2Z A;  4HPS A;  4CS0 B;  1ZG8 A;  1TKH A;  2OZU A;  3K9U A;  3DNS A;  3SI0 A;  4MMO A;  2FXF A;  1XFO A;  3R9F A;  5KTC A;  1M4I A;  4CYQ A;  2DPS A;  4LUA A;  4UCM A;  2VXK A;  2Q43 A;  3SJG A;  3LD2 A;  3N5F A;  3T9Y A;  2F7V A;  4B5P A;  3CXP A;  2QVP A;  2ZW5 A;  1PCA A;  2GAN A;  4CRY B;  4NCZ A;  2IJZ A;  3ISX A;  2ZEG A;  1WWZ A;  3KZW A;  3LOD A;  1OZP A;  3LAC A;  1NMT A;  2PJ2 A;  4GS4 A;  4M85 A;  4NGP A;  2JZD A;  2WUU A;  2P6G A;  2WYR A;  4JCA A;  2Z0Z A;  4ABK A;  3TCV A;  2XD7 A;  2Z10 A;  4HNW B;  4PXE A;  4J5Q A;  2FL4 A;  3D66 A;  4ZYQ A;  1AYE A;  2CXA A;  2PJA A;  4YU9 A;  5CMS A;  2VBQ A;  4QUS A;  2EBJ A;  4A37 A;  2CNT A;  5DS0 A;  1U6M A;  3EC4 A;  4PPZ A;  2P6F A;  1YVK A;  4CGM A;  3FF3 A;  4XPL A;  1ZR3 A;  4GUA A;  2QJ8 A;  4B10 A;  5G21 A;  1R43 A;  5JH9 A;  3P2H A;  2ZEH A;  3D7G A;  1B6B A;  4OC1 A;  3ZJ0 A;  4AVC A;  4QVT A;  4HKF A;  3TO9 A;  2AFM A;  2ABZ A;  4TWE A;  3WC7 A;  5CNP A;  3EXN A;  3R9E A;  3CPX A;  4MFQ A;  3RZA A;  5CB3 A;  5A27 A;  1ELM P;  2PJ1 A;  4TNU A;  2Q7S A;  5FSY A;  1BPM A;  2REE A;  4ETJ A;  4RS2 A;  5IB9 A;  2EO8 A;  2EWB A;  4WJB A;  3S9N A;  1NSL A;  4QB9 A;  4B14 A;  3GLJ A;  2GFQ A;  1Z8T A;  3CT9 A;  4OID A;  2B5G B;  3TT2 A;  5CB5 A;  1BLL E;  1Y7R A;  2Q4Y A;  4OC3 A;  5A28 A;  5KTD A;  1IOI A;  4JZ0 A;  3SIG A;  2ANP A;  2PR8 A;  5AG4 A;  4MHN A;  5CBM A;  1Y0Y A;  4R9M A;  5J8C A;  2PJ0 A;  4A94 A;  5K8N A;  1YLE A;  2WPW A;  4MFJ A;  4UEE A;  4GXH A;  4CGP A;  2PVV A;  2ZOF A;  3PRT A;  4WWV A;  5HH1 A;  3V2B A;  3MN8 A;  2ZED A;  4XPD B;  3SIJ A;  4AG7 A;  2WPX A;  3BI1 A;  4ZY1 A;  2CTC A;  3TO6 A;  1YME A;  2F5I A;  3D7D A;  2EK8 A;  4EFD A;  5JGF A;  5JM6 A;  4PQA A;  1S7K A;  4MHD A;  4RUH A;  2PVW A;  5C82 A;  1CM0 A;  1CX8 A;  3KGQ A;  4OAE A;  5F49 A;  5F46 A;  1I1D A;  2Q4V A;  2QEC A;  4FD5 A;  2V8V A;  5GCN A;  2AFW A;  3B3W A;  5G22 A;  5LRG A;  3ETI A;  4B5P B;  4FD6 A;  3GPG A;  1OBR A;  2I79 A;  1Z4R A;  4R76 A;  4NXY A;  2JBJ A;  1LFW A;  1IB1 E;  2R98 A;  2Z3P A;  1Q7L A;  3KL9 A;  4JVV A;  1FNO A;  2ZEN A;  4JD6 A;  5HVF A;  4PSX A;  2R7H A;  1Z8L A;  1PUA A;  2PC1 A;  3HUV A;  3QNV A;  1S7N A;  4Y49 B;  3BLN A;  3ISZ A;  5LRK A;  3JRU A;  2JDD A;  4NJR A;  3B3S A;  5LRJ A;  2P0W A;  2AFX A;  4AVA A;  4MXU A;  1LAM A;  2ACF A;  5ISV A;  3I9S A;  2AFO A;  4JXR A;  3A9L A;  4A39 A;  4F9U A;  2ZXV A;  3TTH A;  1PYT B;  2HUZ A;  4OME A;  2K5T A;  4K3N A;  4ZX9 A;  4ZY2 A;  3IGR A;  1GHE A;  4O23 A;  1VKC A;  2WSA A;  3H8F A;  2HB6 A;  1NSA A;  2AFU A;  2Z3L A;  3C26 A;  1KWM A;  4D86 A;  1HEE A;  4CYO A;  4YFJ A;  4AVB A;  1YQE A;  1YR0 A;  1TXZ A;  1XMB A;  2I3C A;  2FE7 A;  4MI4 A;  4KLW A;  1YSJ A;  1BO4 A;  2ZOG A;  1IYL A;  2BOA A;  3BXM A;  4IF5 A;  4K0C A;  5LYF A;  2B3V A;  4OC2 A;  1S7L A;  4HNY B;  4CGO A;  2A4N A;  2VL1 A;  2PJ3 A;  3VWE A;  3D2M A;  2Z3K A;  2PJ9 A;  3TE4 A;  3V38 A;  2B58 A;  3W91 A;  4Z65 A;  1TXR A;  5JQ4 A;  1DE4 C;  2Y0M A;  3FX6 A;  4NF1 A;  4NGM A;  4A95 A;  4OC0 A;  5HVG A;  4XNH B;  2B5G A;  4P4D A;  5EBV A;  2FAV A;  1ZG7 A;  3EWP A;  3VH9 A;  2PJ4 A;  4G1P A;  1M4D A;  4UFV A;  3S6K A;  2G0B A;  4M6H A;  3FVL A;  4IAV A;  4PV6 A;  4FWU A;  2O4H A;  3WC5 A;  2BUE A;  2BO9 A;  2GLJ A;  3GB0 A;  2L8R A;  5LYD A;  2JDC A;  2PJ8 A;  5F48 A;  5HOL A;  2ATR A;  1YK3 A;  1YX0 A;  3IWW A;  1Z5R A;  2Q51 A;  1BAV A;  3BJ8 A;  4HNX B;  1XRY A;  1JWQ A;  1VGY A;  3FBU A;  4FD4 A;  2OOT A;  2GE3 A;  4P44 A;  5D29 A;  4A38 A;  3NH4 A;  2Q04 A;  5BWA B;  4UIA A;  4OAD A;  3Q71 A;  2ZW6 A;  1DTD A;  3I1U A;  4OLL A;  2PR1 A;  5J8F A;  1SQH A;  2VQY A;  1Q2C A;  2GIV A;  2PIY A;  5CPA A;  1P4N A;  4KOX A;  1TKJ A;  2JZF A;  4B12 A;  4TU0 A;  2C6P A;  5C88 A;  1KUY A;  4ETK A;  2R1I A;  4PXD A;  2IMO A;  3JTK A;  3LWU A;  4MBU A;  5DWM A;  4KVX A;  2ZPA A;  3D67 A;  5H84 A;  2F8H A;  4KUA A;  5EC4 A;  4B5O A;  4J5R A;  1Y9W A;  2IQ6 A;  1M4L A;  2OB0 A;  2Z3M A;  1HJZ A;  3IU1 A;  2FT0 A;  2AFZ A;  4PXC A; 
#chains in the Genus database with same CATH homology
 5E3B A;  4P10 A;  2C1C A;  1EE3 P;  3FJU A;  3K2K A;  4NGR A;  5FSZ A;  3FED A;  4UF4 A;  2EEE A;  3K9T A;  1VHO A;  4YWY A;  3FH4 A;  4P4F A;  2RFH A;  3RBU A;  2V8H A;  1F57 A;  4EWT A;  3SJE A;  3PB8 X;  4PXB A;  5J1Q A;  3B3C A;  4X3R A;  4R7M A;  2QYV A;  3PFO A;  2BFQ A;  1CG2 A;  2X47 A;  1LCP A;  4ABL A;  3SII A;  2POK A;  2FVG A;  3V7Z A;  3Q6Z A;  3EJF A;  3WC6 A;  2ZEO A;  4J4Z A;  3D7H A;  8CPA A;  3B3V A;  2ZEE A;  2PE3 A;  4P6Y A;  1UWY A;  4DYO A;  3NA6 A;  1SPV A;  3VAR A;  4MHP A;  3KHZ A;  1JQG A;  1HDU A;  4OC4 A;  3MRU A;  1R3N A;  4MCR A;  2J9A A;  2OR4 A;  3IEH A;  2PIZ A;  3WT4 A;  2XEG A;  4OP4 A;  3TX8 A;  1BPN A;  1H8L A;  3IO1 A;  4NGS A;  4GVW A;  3KAS A;  3H8E A;  4KYB A;  4IHM A;  2V8D A;  3PBE A;  4UEZ A;  3GQE A;  1YD9 A;  2FXK A;  3T8W A;  3PBB A;  4OKO A;  4FAI A;  2PJB A;  4P4J A;  3VFQ A;  1VIX A;  4AXV A;  2GU2 A;  4JYW A;  1CPS A;  1LAN A;  1CP7 A;  1TY8 A;  4Q7A A;  4NFR A;  4FBE A;  1ZLI A;  3NFZ A;  2WZN A;  1AMP A;  4H2K A;  3SJF A;  4MRI A;  3KQX A;  3GPO A;  3EWR A;  1CPX A;  4ONW A;  2JEW A;  3EWQ A;  2DEA A;  1ELL P;  3IIF A;  4MHY A;  1HDQ A;  2JBK A;  2NSM A;  2PJ5 A;  2AFC A;  2Q4Z A;  3EJG A;  2GRE A;  4W9Y A;  1VHU A;  4BD9 A;  3FMC A;  7CPA A;  1GYT A;  4CPA A;  5F09 A;  3B2Y A;  2CTB A;  4ZX8 A;  3D4U A;  4NGQ A;  4ZI6 A;  3B7I A;  2ZEP A;  5LYI A;  1TF9 A;  4X8I A;  5I4M A;  4OIW A;  4JGK A;  3DLJ A;  1ZR5 A;  4MCP A;  1TKF A;  2RB7 A;  2G9D A;  2ZEL A;  3S9M A;  2CF4 A;  4EME A;  1CP6 A;  1XBU A;  1TF8 A;  3KHX A;  3KI9 A;  4J5S A;  2XEJ A;  3CDX A;  1VHE A;  1YW6 A;  1CBX A;  3V45 A;  3EWO A;  4MHZ A;  4P45 A;  1Y0R A;  3EW5 A;  3SIH A;  3CPA A;  4X2T A;  3B3T A;  3EKE A;  1Y7E A;  2VRI A;  2XEF A;  1LAP A;  1Z2L A;  3JZT A;  5FSU A;  2DX6 A;  2HC9 A;  2ZEF A;  3SJX A;  2C6G A;  3IIB A;  4UIB A;  5AIL A;  3D7F A;  3LMS A;  4KSI A;  4R8F A;  5K8P A;  3PB9 X;  4DJL A;  5ELY A;  4NGT A;  2NYQ A;  3PB4 X;  3H8G A;  5DUS A;  2O53 A;  3RAM A;  4LQG A;  1F2O A;  2CIJ A;  4GVV A;  4ZY0 A;  2GLF A;  2V8G A;  4JLL A;  4MCQ A;  4NJQ A;  1YW4 A;  5HVH A;  1IGB A;  3PEI A;  2XEI A;  3IFE A;  4P4I A;  3WAB A;  5THW A;  4F8Z A;  2ZEM A;  2EK9 A;  3NH5 A;  3FEE A;  1NJR A;  2PCU A;  3DGV A;  3BI0 A;  2PRQ A;  1ZLH A;  1ZG9 A;  4FUU A;  3FEC A;  3BHX A;  3GUX A;  4UML A;  1IY7 A;  1QMU A;  3NH8 A;  4DUK A;  1QQ9 A;  4F9V A;  2PJC A;  1F2P A;  2LGR A;  4NGN A;  2BCO A;  3PFE A;  4GM5 A;  6CPA A;  3GQO A;  2PJ7 A;  2FG1 A;  3PB6 X;  4OC5 A;  5K8O A;  4B6Z A;  3KR4 A;  4MCS A;  3IC1 A;  5FSX A;  4UEF A;  4R6T A;  5FSV A;  5LYL A;  3SI2 A;  2V77 A;  4P4B A;  5D8N A;  1ARM A;  4IQY A;  2AFS A;  2BFR A;  3KR5 A;  3KQZ A;  4ESS A;  1YLO A;  3PB7 X;  3S9L A;  3IID A;  4IK2 A;  5HXD A;  4P4E A;  5HIH A;  3TC8 A;  3HLP A;  3D68 A;  3GPQ A;  1ARL A;  3B35 A;  1LOK A;  3VAT A;  3L2N A;  1FT7 A;  2PJ6 A;  2C6C A;  5K8M A;  3SI1 A;  3IJ3 A;  1RTQ A;  1XJO A;  1ZG8 A;  1TKH A;  3SI0 A;  4MMO A;  1XFO A;  2Q43 A;  3SJG A;  3N5F A;  2F7V A;  2QVP A;  1PCA A;  2IJZ A;  3ISX A;  2ZEG A;  3KZW A;  2PJ2 A;  4NGP A;  2WYR A;  4JCA A;  4ABK A;  2XD7 A;  4PXE A;  4J5Q A;  3D66 A;  4ZYQ A;  1AYE A;  2PJA A;  4YU9 A;  4A37 A;  5CMS A;  5DS0 A;  4PPZ A;  3FF3 A;  1ZR3 A;  4GUA A;  2QJ8 A;  1R43 A;  5JH9 A;  2ZEH A;  3D7G A;  4OC1 A;  2AFM A;  2ABZ A;  4TWE A;  3WC7 A;  3CPX A;  3RZA A;  5CB3 A;  1ELM P;  2PJ1 A;  4TNU A;  5FSY A;  1BPM A;  4ETJ A;  5IB9 A;  2EWB A;  4WJB A;  3S9N A;  3GLJ A;  3CT9 A;  4OID A;  5CB5 A;  1BLL E;  4OC3 A;  4JZ0 A;  3SIG A;  2ANP A;  4MHN A;  5CBM A;  1Y0Y A;  2PJ0 A;  4A94 A;  5K8N A;  4UEE A;  2PVV A;  2ZOF A;  3PRT A;  4WWV A;  3V2B A;  3MN8 A;  2ZED A;  3SIJ A;  3BI1 A;  4ZY1 A;  2CTC A;  1YME A;  3D7D A;  2EK8 A;  4EFD A;  5JGF A;  5JM6 A;  4PQA A;  4RUH A;  2PVW A;  3KGQ A;  1CX8 A;  2V8V A;  2AFW A;  3B3W A;  5LRG A;  3ETI A;  3GPG A;  1OBR A;  4R76 A;  2JBJ A;  1LFW A;  1Q7L A;  3KL9 A;  4JVV A;  1FNO A;  2ZEN A;  5HVF A;  3HUV A;  1Z8L A;  3QNV A;  3ISZ A;  5LRK A;  3JRU A;  4NJR A;  3B3S A;  5LRJ A;  2AFX A;  4MXU A;  1LAM A;  2ACF A;  2AFO A;  4A39 A;  4F9U A;  1PYT B;  4OME A;  4O23 A;  4K3N A;  4ZX9 A;  4ZY2 A;  3H8F A;  2HB6 A;  1NSA A;  2AFU A;  1KWM A;  4D86 A;  1HEE A;  1TXZ A;  1XMB A;  2I3C A;  1YSJ A;  2ZOG A;  2BOA A;  3BXM A;  4K0C A;  5LYF A;  4OC2 A;  2VL1 A;  2PJ3 A;  2PJ9 A;  3V38 A;  4Z65 A;  1TXR A;  1DE4 C;  3FX6 A;  4NGM A;  5HVG A;  4OC0 A;  4P4D A;  2FAV A;  1ZG7 A;  3EWP A;  3VH9 A;  2PJ4 A;  4G1P A;  3FVL A;  4IAV A;  4FWU A;  2O4H A;  3WC5 A;  2BO9 A;  2GLJ A;  3GB0 A;  2L8R A;  5LYD A;  2PJ8 A;  5HOL A;  3IWW A;  1Z5R A;  2Q51 A;  1BAV A;  1XRY A;  1VGY A;  2OOT A;  4A38 A;  4P44 A;  5D29 A;  3NH4 A;  4UIA A;  3Q71 A;  1DTD A;  3I1U A;  2PIY A;  5CPA A;  1TKJ A;  4TU0 A;  2C6P A;  4ETK A;  4PXD A;  2IMO A;  3LWU A;  3D67 A;  2F8H A;  4J5R A;  2IQ6 A;  1M4L A;  1HJZ A;  2AFZ A;  4PXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...