3H8EA

Low ph native structure of leucine aminopeptidase from pseudomonas putida
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
497
structure length
473
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGIMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 156
structure length 473
sequence length 497
chains with identical sequence B
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8eA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8eA02
2ZEMA 2DX6A 1ZG9A 4MHNA 2XEIA 3H8FA 3IWWA 3PB7X 2C6PA 1ZG8A 2ZEEA 4GVWA 5FSZA 5LYDA 3Q71A 4ZX8A 3PB4X 3D66A 5HXDA 2PCUA 1M4LA 4OC4A 4TU0A 4OC1A 3SJGA 8CPAA 1UWYA 2PJ0A 3N5FA 5LYIA 4A37A 4P45A 4OKOA 5FSUA 1Y0YA 1CX8A 2OOTA 3EKEA 1ZLIA 3SI2A 4GUAA 3SIIA 2PE3A 2RFHA 4O23A 4PXEA 1XFOA 4OC5A 1F2OA 2PJ3A 4IQYA 3LMSA 3FECA 4JZ0A 3SJEA 4F8ZA 1RTQA 2IQ6A 4JCAA 2AFZA 3B3CA 3NH4A 3D68A 3K9TA 4OP4A 4J4ZA 2VRIA 3CPAA 4A94A 4WJBA 3KHZA 3DGVA 2XEFA 1EE3P 2AFWA 5DS0A 2BFQA 5CB5A 4TNUA 3SIHA 4IHMA 3IIBA 3PBEA 2V77A 5LRJA 5CBMA 3B35A 1VHEA 3KQXA 4D86A 4ABLA 4WWVA 5E3BA 3PEIA 2JBJA 3BXMA 3V45A 3RZAA 4UEEA 4OC0A 3I1UA 4JLLA 2ZEHA 4NGMA 1HDQA 4P4FA 3PB8X 3FEEA 3PFEA 4ETJA 4PPZA 3PRTA 2XEGA 4EFDA 5J1QA 5CB3A 4R7MA 2QYVA 2Q4ZA 1AMPA 2AFSA 4ZY1A 3PB6X 3IFEA 3NH8A 3FJUA 3B7IA 2PVWA 3JZTA 2PJ4A 1TKFA 1GYTA 2ZOGA 4J5QA 2DEAA 1BPMA 2GU2A 2I3CA 3B2YA 1XJOA 3SI0A 4P4IA 1TKJA 1ELLP 2IMOA 2BFRA 3RBUA 2NSMA 3FX6A 2ANPA 2LGRA 4DJLA 1CG2A 2JEWA 3TX8A 1ELMP 2XEJA 1CP6A 2Q43A 4PXDA 5D8NA 4IK2A 5HVHA 4FAIA 4TWEA 3BHXA 2BOAA 4ZY2A 2ZEGA 2ZEDA 4ESSA 5I4MA 3GUXA 1YSJA 3SIJA 5HVGA 2V8HA 3CPXA 2ZEOA 2QJ8A 4ZYQA 3FEDA 2AFOA 4X3RA 2EWBA 3SJXA 1LAMA 3VATA 2V8DA 5K8PA 5DUSA 5HOLA 1HJZA 1Z5RA 4P4JA 4F9VA 5FSYA 3JRUA 4GM5A 3NA6A 4EMEA 1FT7A 4FWUA 2PJAA 4NGSA 4NFRA 4UIAA 4CPAA 2PJ5A 1OBRA 1HEEA 1LCPA 4MCRA 4Z65A 5FSVA 5K8MA 3EWRA 2CF4A 2AFMA 2WZNA 4F9UA 5LYLA 3V2BA 3B3VA 1TF8A 3CDXA 2C1CA 1PCAA 2VL1A 4R8FA 3S9LA 5K8NA 1F57A 4K3NA 3PBBA 1CP7A 1Y7EA 4MCSA 4P44A 3KHXA 1R43A 3BI1A 4MHPA 2ABZA 4MCQA 2IJZA 5LYFA 4JYWA 4P10A 4J5SA 2XD7A 2Q51A 3KR4A 4P4DA 2ACFA 3GB0A 2HC9A 2O53A 1ZG7A 4B6ZA 2GLJA 2PVVA 5CPAA 1LOKA 2C6CA 2CTCA 1CPXA 4NGNA 3H8EA 2JBKA 3WT4A 4EWTA 4DUKA 3KZWA 4FUUA 3GPGA 1PYTB 3KGQA 5JH9A 2RB7A 4UEZA 1YMEA 5CMSA 1IGBA 3GPOA 2PJBA 5FSXA 1YLOA 3B3WA 1CBXA 2C6GA 3FH4A 1LAPA 3NH5A 3Q6ZA 5F09A 4OC3A 3FMCA 2AFCA 3S9NA 2ZENA 4MXUA 2L8RA 2PRQA 1VIXA 2ZOFA 3V38A 1H8LA 3PB9X 3KQZA 4NGQA 4J5RA 3EW5A 1BPNA 2GREA 3D7GA 3GQEA 3EJFA 4ZY0A 1FNOA 4R6TA 1QQ9A 4RUHA 1BLLE 3SI1A 4OMEA 1QMUA 2J9AA 4JGKA 4AXVA 3ISXA 3WABA 3D7FA 3MRUA 5JGFA 3MN8A 4ETKA 4KSIA 2FG1A 3GLJA 2PJ8A 3S9MA 4JVVA 1XRYA 4OIDA 3VH9A 3QNVA 2PJ6A 1TKHA 4P4BA 3GQOA 4ZI6A 2V8VA 4UIBA 4A39A 3EJGA 3K2KA 2NYQA 5HVFA 1XMBA 2CTBA 4X8IA 3WC5A 2G9DA 3D7DA 3BI0A 1F2PA 3CT9A 2O4HA 1Y0RA 3DLJA 6CPAA 4R76A 1YW6A 1R3NA 3D7HA 1AYEA 3D67A 3EWOA 3WC7A 3FF3A 3IJ3A 5K8OA 1TXZA 4NGRA 2CIJA 1KWMA 2X47A 2V8GA 4H2KA 2PIZA 3D4UA 3IC1A 4KYBA 3L2NA 3GPQA 1VGYA 5ELYA 5D29A 3B3SA 1VHOA 4PXCA 3IIFA 3NFZA 5THWA 4OIWA 4ONWA 7CPAA 2PJ1A 2QVPA 4MHYA 5JM6A 3KL9A 3H8GA 1BAVA 1Z2LA 3KASA 1ZR3A 4MCPA 4PQAA 2BCOA 2HB6A 2F7VA 3TC8A 2ZEFA 4P6YA 2PJ9A 1TXRA 3HUVA 3RAMA 4DYOA 2PJ2A 1DTDA 1LFWA 1ZLHA 2BO9A 4NGPA 2ZELA 4PXBA 4NGTA 3B3TA 1NJRA 3IO1A 4UMLA 2EEEA 4Q7AA 1ARLA 3EWPA 4YU9A 1HDUA 3IEHA 1JQGA 4P4EA 4K0CA 3HLPA 1TF9A 1XBUA 1Q7LA 2WYRA 3KR5A 2PJCA 4MMOA 4X2TA 4ABKA 2ZEPA 1LANA 3FVLA 2FAVA 1DE4C 2PJ7A 3T8WA 3ISZA 2GLFA 4OC2A 5LRKA 1Z8LA 2POKA 4ZX9A 2F8HA 4W9YA 2AFXA 4G1PA 2OR4A 1ZR5A 3KI9A 2EK8A 1ARMA 4NJRA 1VHUA 5LRGA 4A38A 4YWYA 4BD9A 2AFUA 4LQGA 5AILA 4MHZA 2FVGA 4MRIA 3IIDA 2EK9A 3LWUA 1TY8A 1IY7A 3ETIA 3VARA 3VFQA 2FXKA 4IAVA 4NJQA 3SIGA 3EWQA 5IB9A 4GVVA 1NSAA 1YD9A 3WC6A 4UF4A 4FBEA 1CPSA 3PFOA 2PIYA 4UEFA 3V7ZA 1SPVA 3SJFA 1YW4A 5HIHA
chains in the Genus database with same CATH superfamily
2ZEMA 2ZXVA 4YFJA 2YNCC 2DX6A 2BUEA 2OU2A 1ZG9A 3OWCA 4MHNA 2XEIA 3H8FA 3IWWA 3PB7X 1BOBA 5F47A 2C6PA 1VHSA 5E96A 1ZG8A 3CXPA 1Z8XA 1S7KA 3GKRA 4QUSA 2ZEEA 4LX9A 4A31A 4KUBA 4QC6A 4GVWA 2JDDA 3IWGA 4I49A 5F49A 5FSZA 4A32A 3QAYA 5LYDA 3Q71A 3R9GA 4ZX8A 1P0HA 3PB4X 4OAEA 2Q7BA 1I12A 2Z3LA 3D66A 5HXDA 4CRYB 1OZPA 3QAHA 4UFWA 2PCUA 5BWAB 5KTDA 1KZFA 1YREA 1MJ9A 3LD2A 2WCTA 1M4LA 4OC4A 4TU0A 4OC1A 1M4GA 3SJGA 3T9YA 8CPAA 1RXTA 4H6UA 1UWYA 2PJ0A 3TOAA 3CXQA 3N5FA 4Q38A 5LYIA 4A37A 4JXRA 3PGPA 4P45A 4OKOA 5FSUA 1Y0YA 1CX8A 2OOTA 3ZJ0A 3EKEA 1ZLIA 2GIVA 3SI2A 4GUAA 3SIIA 2PE3A 2RFHA 3K9UA 4NF1A 4O23A 1XFOA 4PXEA 4OC5A 1F2OA 2PJ3A 4IQYA 3LMSA 4CYQA 1Z9UA 3FECA 4JZ0A 3SJEA 4F8ZA 1RTQA 3SXOA 5EBVA 2IQ6A 5KTCA 1IU8A 4JCAA 2AFZA 1S60A 3B3CA 3JUWA 3NH4A 3D68A 1N71A 1IOIA 3K9TA 4OP4A 4PK2A 3T90A 4J4ZA 2FS5A 2FIWA 3F0AA 4KOWA 4CAVA 4M3SA 2VRIA 3CPAA 3E0KA 4Q36A 3G3SA 3R96A 4A94A 4WJBA 4CYNA 3KHZA 4XPKA 2J8RA 3DGVA 4KLVA 5J8FA 2XEFA 1EE3P 2AFWA 2QMLA 4CGPA 5DS0A 2BFQA 3R9EA 1V0CA 5CB5A 4TNUA 3SIHA 3DSBA 4IHMA 4CYOA 3TE4A 3IIBA 3D2MA 3JTKA 3PBEA 2R98A 3TO7A 3N7ZA 2V77A 5LRJA 5CBMA 3B35A 4MI4A 1VHEA 2DPSA 3KQXA 5G22A 4MHDA 4D86A 4ABLA 3BJ8A 4B5PB 4PV6A 2OB0A 4WWVA 5FVJA 4CAEA 5E3BA 3PEIA 2JBJA 1IYKA 1ON0A 4PSXA 4UWIA 4YRHA 2JLMA 5EMIA 4B11A 4F6AA 5F46A 3BXMA 3V45A 3RZAA 3F5BA 4UEEA 4OC0A 5AG7A 3I1UA 4GS4A 4JLLA 4MFPA 1S7LA 2ZEHA 2JZFA 4NGMA 2Q0YA 1HDQA 1XIXA 3PB8X 3FEEA 3PFEA 4P4FA 4QBJA 4ETJA 2D4OA 4PPZA 3EO4A 3PRTA 4JWPA 2HV2A 2XEGA 4EFDA 5J1QA 1U6MA 5CB3A 2CNTA 4R7MA 2QYVA 2Q4ZA 1AMPA 2AFSA 3LACA 4ZY1A 3PB6X 2FT0A 3IFEA 2ARHA 3TFYA 2ZPAA 3NH8A 1QSMA 5G20A 3RNZA 4FD7A 3BLNA 3VWEA 3FJUA 3B7IA 2Q4YA 2PVWA 2B58A 3D3SA 4F0XA 3JZTA 1LRZA 1TKFA 1GYTA 4J5QA 1MJBA 2DEAA 2PJ4A 1BPMA 1J4JA 1M4IA 2GU2A 2I3CA 2VBQA 4LQ6A 3B2YA 3GIUA 4RN7A 1XJOA 1NMTA 3TTHA 3SI0A 4P4IA 4B12A 1TKJA 1ELLP 4QB9A 2IMOA 4ZBGA 4NXYA 2BFRA 1KUXA 4MBUA 2NSMA 3EY5A 3FX6A 3RBUA 2Q4VA 2ANPA 2Q04A 2FXFA 4A30A 1IOFA 1R57A 5DWNA 2Q44A 2LGRA 4DJLA 4MFQA 2JZEA 3C26A 1CG2A 1Z8WA 2JEWA 1WWZA 2JDCA 3TX8A 4CRZB 1ELMP 2XEJA 1CP6A 4E0AA 4BBHA 2Q43A 4PXDA 5D8NA 3BJ7A 2HUZA 2P6GA 2PC1A 4IK2A 5HVHA 2PQ8A 4FAIA 4TWEA 1B6BA 3BHXA 4MY0A 2BOAA 4ZY2A 2VEZA 2ZEGA 2VQYA 2ZEDA 4M6GA 4ESSA 4XNHC 5I4MA 2QIRA 3GUXA 1YSJA 3SIJA 4KOUA 4MFLA 4UCMA 2ZW5A 5HVGA 1Y9KA 2V8HA 3CPXA 2ZEOA 3P2HA 2Z3OA 2QJ8A 4ZYQA 3FEDA 1AUGA 4M6IA 2AFOA 3A9LA 3W6SA 4CAWA 2ZW7A 2EWBA 4X3RA 4CAFA 4B14A 3SJXA 1LAMA 1XF8A 4UFVA 1M44A 3VATA 4R3KA 3FXTA 1JWQA 2V8DA 2EO8A 2FIAA 2D4PA 2Z10A 2VXKA 5K8PA 5DUSA 4HKFA 5HOLA 2VZYA 4NSQA 1HJZA 3IU2A 1Z5RA 1YK3A 4P4JA 4F9VA 5ISVA 5FSYA 3JRUA 2PR8A 3NA6A 1Y9WA 4GM5A 3FIXA 1B87A 3FBUA 4EMEA 1FT7A 4FWUA 2B5GB 4NEXA 2PJAA 3V8IA 4NGSA 1MJAA 3NE7A 4HNYB 4NFRA 4R3LA 1QSTA 3KKWA 3FNCA 4UIAA 4KVXA 1GHEA 4CPAA 2PJ5A 2CNSA 3DDDA 4H89A 2EVNA 1OBRA 1KUVA 1HEEA 2B3UA 1LCPA 4MCRA 2ZW4A 4Z65A 5FSVA 3D8PA 3WR7A 5K8MA 1YQEA 4BINA 4CS0B 3EWRA 2CF4A 2AFMA 2CXAA 2VZZA 2OZUA 2WZNA 3IWEA 4L89A 3F8KA 4F9UA 2X7BA 4UWJA 5LYLA 4ORFA 4UCNA 2KCWA 3V2BA 3B3VA 2JZDA 5A28A 1TF8A 3CDXA 2W2GA 2C1CA 1MK4A 3SXNA 1PCAA 2C27A 2VL1A 1I1DA 1K4JA 4R8FA 4CGLA 3S9LA 5K8NA 1F57A 4K3NA 4C7IA 3PBBA 3CZXA 2G3AA 2RC4A 1CP7A 1Y7EA 4MCSA 4J3GA 4P44A 2GE3A 3KHXA 2WPWA 4XPLA 3W6XA 4K30A 2NMTA 1R43A 3BI1A 1S3ZA 2G3TA 4MHPA 2ABZA 5IV0A 2WUUA 2K5TA 1QSNA 2Z0ZA 1S7FA 1YX0A 1PU9A 2IJZA 2J8NA 2PDOA 4MCQA 4QVTA 4JYWA 5LYFA 4P10A 4J5SA 3PZJA 2XD7A 4C2ZA 2Q51A 3KR4A 3JVNA 4P4DA 4OADA 4XNHB 2ACFA 3GB0A 2HC9A 3RYOA 4II9A 4BMHA 4JJXA 2O53A 1Z8TA 1ZG7A 2REEA 2Z3KA 3QB8A 2GLJA 2PVVA 5CPAA 1LOKA 4B6ZA 1IB1E 2C6CA 3FYNA 2CTCA 1CPXA 4NGNA 3H8EA 1S5KA 2JBKA 2AJ6A 3WT4A 4C7HA 4KSAA 4JLYA 4CGNA 2Q7SA 2ODFA 4EWTA 2Z11A 4DUKA 3KZWA 4MFZA 4KLWA 4MFJA 3TO9A 4FUUA 4C2XA 2B3VA 3GPGA 2OZHA 3R9FA 2YNEA 1PYTB 3GYAA 3KGQA 5JH9A 2RB7A 3PP9A 4UEZA 2KQVA 1YMEA 5CMSA 1IGBA 4U9ZA 4DNCA 2I79A 3GPOA 2PJBA 5FSXA 1YLOA 2BEIA 1WK4A 2P0WA 3B3WA 4R87A 5H84A 1CBXA 4HNXB 2C6GA 3FH4A 1LAPA 5G1ZA 4A95A 3NH5A 3Q6ZA 4KS9A 4OC3A 5F09A 1YVOA 3EC4A 5AG5A 4GXHA 3FMCA 2AFCA 3S9NA 2ZENA 2Z3NA 4MXUA 2L8RA 2PRQA 4F0YA 1VIXA 2ZOFA 4UFXA 4UCPA 3V38A 1H8LA 1VKCA 3PB9X 5G21A 4B10A 3KQZA 4NGQA 4RI1A 4J5RA 2A4NA 3EW5A 4HPSA 1BPNA 1QSOA 2GREA 3D7GA 2QECA 3GQEA 3EJFA 2F5IA 4ZY0A 1FNOA 1IYLA 2P6FA 4R6TA 5EC4A 2B4DB 3DNSA 4FD4A 4B5OA 3R95A 2BL1A 1QQ9A 4RUHA 1BLLE 4KUAA 2ZOGA 1RO5A 4CGOA 4E8OA 3SI1A 3TO6A 1X10A 4XPDC 5JPHA 2EBJA 4OMEA 4CGMA 3EFAA 1IICA 2J9AA 1QMUA 1ZO0A 4IUSA 2WSAA 4JGKA 4ONUA 1NE9A 4AXVA 5IX3A 3MGDA 3ISXA 2EUIA 5I0CA 3IU1A 3D7FA 4M85A 3WABA 3MRUA 5IB0A 1BO4A 2PSWA 5JGFA 3UY5A 3MN8A 4ETKA 1CM0A 4KSIA 2AE6A 2FG1A 3GLJA 2RNKA 2PJ8A 3S9MA 4JVVA 1XRYA 3FRMA 4OIDA 1TIQA 3QNVA 3VH9A 2PJ6A 1TKHA 4P4BA 3GQOA 1X12A 4ZI6A 2V8VA 2Z3PA 2OZGA 3NE8A 4UIBA 5F48A 1L0CA 1YLEA 3EJGA 1P4NA 1XE4A 2NYQA 3K2KA 1NSLA 4UBRA 5HVFA 1XMBA 2DXQA 5JQ4A 1CJWA 2CTBA 2FL4A 4X8IA 2G9DA 4KOTA 3WC5A 3D7DA 3BI0A 1F2PA 3CT9A 2O4HA 4X5KA 2BSWA 1Y0RA 3DR8A 3DLJA 3S6HA 3VWDA 4R76A 6CPAA 4MFKA 4AG9A 1YW6A 1SQHA 4MJ8A 1R3NA 3D7HA 1AYEA 3D67A 3EWOA 4B5PA 3WC7A 4C2YA 4ZGYB 3FF3A 4EVYA 3IJ3A 2P6EA 5K8OA 1TXZA 4NGRA 2CIJA 5H86A 1KWMA 5KTAA 3I3GA 1FY7A 2X47A 3ZZIA 2V8GA 4FD5A 4H2KA 4PK3A 4PSWA 5GCNA 2YNCA 2PIZA 3D4UA 3IC1A 4KZTA 4KYBA 3CXSA 4KOSA 3L2NA 1KUYA 3GPQA 1VGYA 3TT2A 3D2PA 4B13A 5ELYA 5HMNA 5D29A 3B3SA 1M4DA 1VHOA 3LODA 4KOVA 4PXCA 4MY3A 3IIFA 3NFZA 5THWA 4OIWA 4ONWA 2DPTA 3S6FA 7CPAA 2PJ1A 2QVPA 4MHYA 5JM6A 4KORA 3KL9A 1A2ZA 3H8GA 4H6ZA 1BAVA 1YGHA 1XMTA 1Z2LA 2Y0MA 4JD6A 2WPXA 3DR6A 3KASA 1ZR3A 4MCPA 4PQAA 4U9YA 5AG4A 2BCOA 4RS2A 4Y49C 3W91A 2HB6A 4U5YA 2F7VA 3TC8A 4KVME 3S6KA 1YR0A 2ZEFA 2PJ9A 4P6YA 2DF5A 2G0BA 4XPDB 1TXRA 2HQYA 3HUVA 2VI7A 2YGWA 3H5ZA 3RAMA 4DYOA 2ATRA 4E2AA 2PJ2A 1DTDA 1LFWA 2R8VA 3EXNA 1ZLHA 4AG7A 4LUAA 5AG6A 2B4DA 2BO9A 4NGPA 2ZELA 4PXBA 4NGTA 4C68A 3B3TA 4KOYA 1NJRA 1Q2CA 3IO1A 5HH1A 5CNPA 4UMLA 3B8GA 3FB3A 3RO0A 2GANA 5DWMA 1S7NA 2EEEA 4OLLA 4Q7AA 1ARLA 4AVBA 3EWPA 2FSRA 4YU9A 1HDUA 4L8AA 3IEHA 1JQGA 2GFQA 4P4EA 4A33A 4K0CA 2FCKA 2ZW6A 3TOBA 3HLPA 1TF9A 1XBUA 2FE7A 2J8MA 2R1IA 5A27A 1Q7LA 1XEBA 2WYRA 5J8CA 4M6HA 3KR5A 2PJCA 4R9MA 1Q2DA 4X2TA 4ABKA 2ZEPA 4MMOA 1LANA 3I9SA 4CAXA 4R57A 3FVLA 1XOVA 2FAVA 1DE4C 4KOXA 2PJ7A 3TCVA 3T8WA 2R7HA 1UFHA 3IGRA 3ISZA 2GLFA 4OC2A 4A2ZA 1Z8LA 2POKA 5LRKA 4ZX9A 2F8HA 4W9YA 2AFXA 2B5GA 4G1PA 1QSRA 2PRBA 2OH1A 2OR4A 2H5MA 1ZR5A 1Z4EA 4KVOE 3KI9A 2YNDA 1Y7RA 4KSFA 2I00A 2IL4A 2EK8A 1ARMA 2CY2A 3G8WA 4NJRA 1VHUA 4AB7A 2Z3MA 5LRGA 4A38A 1IIDA 4FD6A 3H4QA 4NCZA 4YWYA 5AGEA 4BD9A 2AFUA 4LQGA 3S6GA 3SHPA 4HNWB 5AILA 4MHZA 2FVGA 4MRIA 4AVCA 2REFA 5C88A 2PR1A 3IIDA 2B4BA 2EK9A 2CNMA 1TY8A 1M1DA 1YVKA 1IY7A 3LWUA 3ETIA 4CYPA 4AVAA 3VARA 3GY9A 3VFQA 2O28A 4Y49B 2FXKA 4IAVA 4NJQA 3R1KA 4YGOA 3SIGA 4UA3A 5C82A 3EWQA 5IB9A 4JXQA 3P2FA 4GVVA 1NSAA 4IF5A 2JEVA 1YD9A 3WC6A 4UF4A 4FBEA 1CPSA 1PUAA 3PFOA 2PIYA 4UEFA 4A39A 3V7ZA 1SPVA 3SJFA 1I21A 1YW4A 5HIHA 1Q2YA 1Z4RA
chains in the Genus database with same CATH topology
2ZEMA 2DX6A 1ZG9A 4MHNA 2XEIA 3H8FA 3IWWA 3PB7X 2C6PA 1ZG8A 2ZEEA 4GVWA 5FSZA 5LYDA 3Q71A 4ZX8A 3PB4X 3D66A 5HXDA 2PCUA 1M4LA 4OC4A 4TU0A 4OC1A 3SJGA 8CPAA 1UWYA 2PJ0A 3N5FA 5LYIA 4A37A 4P45A 4OKOA 5FSUA 1Y0YA 1CX8A 2OOTA 3EKEA 1ZLIA 3SI2A 4GUAA 3SIIA 2PE3A 2RFHA 4O23A 4PXEA 1XFOA 4OC5A 1F2OA 2PJ3A 4IQYA 3LMSA 3FECA 4JZ0A 3SJEA 4F8ZA 1RTQA 2IQ6A 4JCAA 2AFZA 3B3CA 3NH4A 3D68A 3K9TA 4OP4A 4J4ZA 2VRIA 3CPAA 4A94A 4WJBA 3KHZA 3DGVA 2XEFA 1EE3P 2AFWA 5DS0A 2BFQA 5CB5A 4TNUA 3SIHA 4IHMA 3IIBA 3PBEA 2V77A 5LRJA 5CBMA 3B35A 1VHEA 3KQXA 4D86A 4ABLA 4WWVA 5E3BA 3PEIA 2JBJA 3BXMA 3V45A 3RZAA 4UEEA 4OC0A 3I1UA 4JLLA 2ZEHA 4NGMA 1HDQA 4P4FA 3PB8X 3FEEA 3PFEA 4ETJA 4PPZA 3PRTA 2XEGA 4EFDA 5J1QA 5CB3A 4R7MA 2QYVA 2Q4ZA 1AMPA 2AFSA 4ZY1A 3PB6X 3IFEA 3NH8A 3FJUA 3B7IA 2PVWA 3JZTA 2PJ4A 1TKFA 1GYTA 2ZOGA 4J5QA 2DEAA 1BPMA 2GU2A 2I3CA 3B2YA 1XJOA 3SI0A 4P4IA 1TKJA 1ELLP 2IMOA 2BFRA 3RBUA 2NSMA 3FX6A 2ANPA 2LGRA 4DJLA 1CG2A 2JEWA 3TX8A 1ELMP 2XEJA 1CP6A 2Q43A 4PXDA 5D8NA 4IK2A 5HVHA 4FAIA 4TWEA 3BHXA 2BOAA 4ZY2A 2ZEGA 2ZEDA 4ESSA 5I4MA 3GUXA 1YSJA 3SIJA 5HVGA 2V8HA 3CPXA 2ZEOA 2QJ8A 4ZYQA 3FEDA 2AFOA 4X3RA 2EWBA 3SJXA 1LAMA 3VATA 2V8DA 5K8PA 5DUSA 5HOLA 1HJZA 1Z5RA 4P4JA 4F9VA 5FSYA 3JRUA 4GM5A 3NA6A 4EMEA 1FT7A 4FWUA 2PJAA 4NGSA 4NFRA 4UIAA 4CPAA 2PJ5A 1OBRA 1HEEA 1LCPA 4MCRA 4Z65A 5FSVA 5K8MA 3EWRA 2CF4A 2AFMA 2WZNA 4F9UA 5LYLA 3V2BA 3B3VA 1TF8A 3CDXA 2C1CA 1PCAA 2VL1A 4R8FA 3S9LA 5K8NA 1F57A 4K3NA 3PBBA 1CP7A 1Y7EA 4MCSA 4P44A 3KHXA 1R43A 3BI1A 4MHPA 2ABZA 4MCQA 2IJZA 5LYFA 4JYWA 4P10A 4J5SA 2XD7A 2Q51A 3KR4A 4P4DA 2ACFA 3GB0A 2HC9A 2O53A 1ZG7A 4B6ZA 2GLJA 2PVVA 5CPAA 1LOKA 2C6CA 2CTCA 1CPXA 4NGNA 3H8EA 2JBKA 3WT4A 4EWTA 4DUKA 3KZWA 4FUUA 3GPGA 1PYTB 3KGQA 5JH9A 2RB7A 4UEZA 1YMEA 5CMSA 1IGBA 3GPOA 2PJBA 5FSXA 1YLOA 3B3WA 1CBXA 2C6GA 3FH4A 1LAPA 3NH5A 3Q6ZA 5F09A 4OC3A 3FMCA 2AFCA 3S9NA 2ZENA 4MXUA 2L8RA 2PRQA 1VIXA 2ZOFA 3V38A 1H8LA 3PB9X 3KQZA 4NGQA 4J5RA 3EW5A 1BPNA 2GREA 3D7GA 3GQEA 3EJFA 4ZY0A 1FNOA 4R6TA 1QQ9A 4RUHA 1BLLE 3SI1A 4OMEA 1QMUA 2J9AA 4JGKA 4AXVA 3ISXA 3WABA 3D7FA 3MRUA 5JGFA 3MN8A 4ETKA 4KSIA 2FG1A 3GLJA 2PJ8A 3S9MA 4JVVA 1XRYA 4OIDA 3VH9A 3QNVA 2PJ6A 1TKHA 4P4BA 3GQOA 4ZI6A 2V8VA 4UIBA 4A39A 3EJGA 3K2KA 2NYQA 5HVFA 1XMBA 2CTBA 4X8IA 3WC5A 2G9DA 3D7DA 3BI0A 1F2PA 3CT9A 2O4HA 1Y0RA 3DLJA 6CPAA 4R76A 1YW6A 1R3NA 3D7HA 1AYEA 3D67A 3EWOA 3WC7A 3FF3A 3IJ3A 5K8OA 1TXZA 4NGRA 2CIJA 1KWMA 2X47A 2V8GA 4H2KA 2PIZA 3D4UA 3IC1A 4KYBA 3L2NA 3GPQA 1VGYA 5ELYA 5D29A 3B3SA 1VHOA 4PXCA 3IIFA 3NFZA 5THWA 4OIWA 4ONWA 7CPAA 2PJ1A 2QVPA 4MHYA 5JM6A 3KL9A 3H8GA 1BAVA 1Z2LA 3KASA 1ZR3A 4MCPA 4PQAA 2BCOA 2HB6A 2F7VA 3TC8A 2ZEFA 4P6YA 2PJ9A 1TXRA 3HUVA 3RAMA 4DYOA 2PJ2A 1DTDA 1LFWA 1ZLHA 2BO9A 4NGPA 2ZELA 4PXBA 4NGTA 3B3TA 1NJRA 3IO1A 4UMLA 2EEEA 4Q7AA 1ARLA 3EWPA 4YU9A 1HDUA 3IEHA 1JQGA 4P4EA 4K0CA 3HLPA 1TF9A 1XBUA 1Q7LA 2WYRA 3KR5A 2PJCA 4MMOA 4X2TA 4ABKA 2ZEPA 1LANA 3FVLA 2FAVA 1DE4C 2PJ7A 3T8WA 3ISZA 2GLFA 4OC2A 5LRKA 1Z8LA 2POKA 4ZX9A 2F8HA 4W9YA 2AFXA 4G1PA 2OR4A 1ZR5A 3KI9A 2EK8A 1ARMA 4NJRA 1VHUA 5LRGA 4A38A 4YWYA 4BD9A 2AFUA 4LQGA 5AILA 4MHZA 2FVGA 4MRIA 3IIDA 2EK9A 3LWUA 1TY8A 1IY7A 3ETIA 3VARA 3VFQA 2FXKA 4IAVA 4NJQA 3SIGA 3EWQA 5IB9A 4GVVA 1NSAA 1YD9A 3WC6A 4UF4A 4FBEA 1CPSA 3PFOA 2PIYA 4UEFA 3V7ZA 1SPVA 3SJFA 1YW4A 5HIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEM A;  2DX6 A;  1ZG9 A;  4MHN A;  2XEI A;  3H8F A;  3IWW A;  3PB7 X;  2C6P A;  1ZG8 A;  2ZEE A;  4GVW A;  5FSZ A;  5LYD A;  3Q71 A;  4ZX8 A;  3PB4 X;  3D66 A;  5HXD A;  2PCU A;  1M4L A;  4OC4 A;  4TU0 A;  4OC1 A;  3SJG A;  8CPA A;  1UWY A;  2PJ0 A;  3N5F A;  5LYI A;  4A37 A;  4P45 A;  4OKO A;  5FSU A;  1Y0Y A;  1CX8 A;  2OOT A;  3EKE A;  1ZLI A;  3SI2 A;  4GUA A;  3SII A;  2PE3 A;  2RFH A;  4O23 A;  4PXE A;  1XFO A;  4OC5 A;  1F2O A;  2PJ3 A;  4IQY A;  3LMS A;  3FEC A;  4JZ0 A;  3SJE A;  4F8Z A;  1RTQ A;  2IQ6 A;  4JCA A;  2AFZ A;  3B3C A;  3NH4 A;  3D68 A;  3K9T A;  4OP4 A;  4J4Z A;  2VRI A;  3CPA A;  4A94 A;  4WJB A;  3KHZ A;  3DGV A;  2XEF A;  1EE3 P;  2AFW A;  5DS0 A;  2BFQ A;  5CB5 A;  4TNU A;  3SIH A;  4IHM A;  3IIB A;  3PBE A;  2V77 A;  5LRJ A;  5CBM A;  3B35 A;  1VHE A;  3KQX A;  4D86 A;  4ABL A;  4WWV A;  5E3B A;  3PEI A;  2JBJ A;  3BXM A;  3V45 A;  3RZA A;  4UEE A;  4OC0 A;  3I1U A;  4JLL A;  2ZEH A;  4NGM A;  1HDQ A;  4P4F A;  3PB8 X;  3FEE A;  3PFE A;  4ETJ A;  4PPZ A;  3PRT A;  2XEG A;  4EFD A;  5J1Q A;  5CB3 A;  4R7M A;  2QYV A;  2Q4Z A;  1AMP A;  2AFS A;  4ZY1 A;  3PB6 X;  3IFE A;  3NH8 A;  3FJU A;  3B7I A;  2PVW A;  3JZT A;  2PJ4 A;  1TKF A;  1GYT A;  2ZOG A;  4J5Q A;  2DEA A;  1BPM A;  2GU2 A;  2I3C A;  3B2Y A;  1XJO A;  3SI0 A;  4P4I A;  1TKJ A;  1ELL P;  2IMO A;  2BFR A;  3RBU A;  2NSM A;  3FX6 A;  2ANP A;  2LGR A;  4DJL A;  1CG2 A;  2JEW A;  3TX8 A;  1ELM P;  2XEJ A;  1CP6 A;  2Q43 A;  4PXD A;  5D8N A;  4IK2 A;  5HVH A;  4FAI A;  4TWE A;  3BHX A;  2BOA A;  4ZY2 A;  2ZEG A;  2ZED A;  4ESS A;  5I4M A;  3GUX A;  1YSJ A;  3SIJ A;  5HVG A;  2V8H A;  3CPX A;  2ZEO A;  2QJ8 A;  4ZYQ A;  3FED A;  2AFO A;  4X3R A;  2EWB A;  3SJX A;  1LAM A;  3VAT A;  2V8D A;  5K8P A;  5DUS A;  5HOL A;  1HJZ A;  1Z5R A;  4P4J A;  4F9V A;  5FSY A;  3JRU A;  4GM5 A;  3NA6 A;  4EME A;  1FT7 A;  4FWU A;  2PJA A;  4NGS A;  4NFR A;  4UIA A;  4CPA A;  2PJ5 A;  1OBR A;  1HEE A;  1LCP A;  4MCR A;  4Z65 A;  5FSV A;  5K8M A;  3EWR A;  2CF4 A;  2AFM A;  2WZN A;  4F9U A;  5LYL A;  3V2B A;  3B3V A;  1TF8 A;  3CDX A;  2C1C A;  1PCA A;  2VL1 A;  4R8F A;  3S9L A;  5K8N A;  1F57 A;  4K3N A;  3PBB A;  1CP7 A;  1Y7E A;  4MCS A;  4P44 A;  3KHX A;  1R43 A;  3BI1 A;  4MHP A;  2ABZ A;  4MCQ A;  2IJZ A;  5LYF A;  4JYW A;  4P10 A;  4J5S A;  2XD7 A;  2Q51 A;  3KR4 A;  4P4D A;  2ACF A;  3GB0 A;  2HC9 A;  2O53 A;  1ZG7 A;  4B6Z A;  2GLJ A;  2PVV A;  5CPA A;  1LOK A;  2C6C A;  2CTC A;  1CPX A;  4NGN A;  3H8E A;  2JBK A;  3WT4 A;  4EWT A;  4DUK A;  3KZW A;  4FUU A;  3GPG A;  1PYT B;  3KGQ A;  5JH9 A;  2RB7 A;  4UEZ A;  1YME A;  5CMS A;  1IGB A;  3GPO A;  2PJB A;  5FSX A;  1YLO A;  3B3W A;  1CBX A;  2C6G A;  3FH4 A;  1LAP A;  3NH5 A;  3Q6Z A;  5F09 A;  4OC3 A;  3FMC A;  2AFC A;  3S9N A;  2ZEN A;  4MXU A;  2L8R A;  2PRQ A;  1VIX A;  2ZOF A;  3V38 A;  1H8L A;  3PB9 X;  3KQZ A;  4NGQ A;  4J5R A;  3EW5 A;  1BPN A;  2GRE A;  3D7G A;  3GQE A;  3EJF A;  4ZY0 A;  1FNO A;  4R6T A;  1QQ9 A;  4RUH A;  1BLL E;  3SI1 A;  4OME A;  1QMU A;  2J9A A;  4JGK A;  4AXV A;  3ISX A;  3WAB A;  3D7F A;  3MRU A;  5JGF A;  3MN8 A;  4ETK A;  4KSI A;  2FG1 A;  3GLJ A;  2PJ8 A;  3S9M A;  4JVV A;  1XRY A;  4OID A;  3VH9 A;  3QNV A;  2PJ6 A;  1TKH A;  4P4B A;  3GQO A;  4ZI6 A;  2V8V A;  4UIB A;  4A39 A;  3EJG A;  3K2K A;  2NYQ A;  5HVF A;  1XMB A;  2CTB A;  4X8I A;  3WC5 A;  2G9D A;  3D7D A;  3BI0 A;  1F2P A;  3CT9 A;  2O4H A;  1Y0R A;  3DLJ A;  6CPA A;  4R76 A;  1YW6 A;  1R3N A;  3D7H A;  1AYE A;  3D67 A;  3EWO A;  3WC7 A;  3FF3 A;  3IJ3 A;  5K8O A;  1TXZ A;  4NGR A;  2CIJ A;  1KWM A;  2X47 A;  2V8G A;  4H2K A;  2PIZ A;  3D4U A;  3IC1 A;  4KYB A;  3L2N A;  3GPQ A;  1VGY A;  5ELY A;  5D29 A;  3B3S A;  1VHO A;  4PXC A;  3IIF A;  3NFZ A;  5THW A;  4OIW A;  4ONW A;  7CPA A;  2PJ1 A;  2QVP A;  4MHY A;  5JM6 A;  3KL9 A;  3H8G A;  1BAV A;  1Z2L A;  3KAS A;  1ZR3 A;  4MCP A;  4PQA A;  2BCO A;  2HB6 A;  2F7V A;  3TC8 A;  2ZEF A;  4P6Y A;  2PJ9 A;  1TXR A;  3HUV A;  3RAM A;  4DYO A;  2PJ2 A;  1DTD A;  1LFW A;  1ZLH A;  2BO9 A;  4NGP A;  2ZEL A;  4PXB A;  4NGT A;  3B3T A;  1NJR A;  3IO1 A;  4UML A;  2EEE A;  4Q7A A;  1ARL A;  3EWP A;  4YU9 A;  1HDU A;  3IEH A;  1JQG A;  4P4E A;  4K0C A;  3HLP A;  1TF9 A;  1XBU A;  1Q7L A;  2WYR A;  3KR5 A;  2PJC A;  4MMO A;  4X2T A;  4ABK A;  2ZEP A;  1LAN A;  3FVL A;  2FAV A;  1DE4 C;  2PJ7 A;  3T8W A;  3ISZ A;  2GLF A;  4OC2 A;  5LRK A;  1Z8L A;  2POK A;  4ZX9 A;  2F8H A;  4W9Y A;  2AFX A;  4G1P A;  2OR4 A;  1ZR5 A;  3KI9 A;  2EK8 A;  1ARM A;  4NJR A;  1VHU A;  5LRG A;  4A38 A;  4YWY A;  4BD9 A;  2AFU A;  4LQG A;  5AIL A;  4MHZ A;  2FVG A;  4MRI A;  3IID A;  2EK9 A;  3LWU A;  1TY8 A;  1IY7 A;  3ETI A;  3VAR A;  3VFQ A;  2FXK A;  4IAV A;  4NJQ A;  3SIG A;  3EWQ A;  5IB9 A;  4GVV A;  1NSA A;  1YD9 A;  3WC6 A;  4UF4 A;  4FBE A;  1CPS A;  3PFO A;  2PIY A;  4UEF A;  3V7Z A;  1SPV A;  3SJF A;  1YW4 A;  5HIH A; 
#chains in the Genus database with same CATH topology
 2ZEM A;  2ZXV A;  4YFJ A;  2YNC C;  2DX6 A;  2BUE A;  2OU2 A;  1ZG9 A;  3OWC A;  4MHN A;  2XEI A;  3H8F A;  3IWW A;  3PB7 X;  1BOB A;  5F47 A;  2C6P A;  1VHS A;  5E96 A;  1ZG8 A;  3CXP A;  1Z8X A;  1S7K A;  3GKR A;  4QUS A;  2ZEE A;  4LX9 A;  4A31 A;  4KUB A;  4QC6 A;  4GVW A;  2JDD A;  3IWG A;  4I49 A;  5F49 A;  5FSZ A;  4A32 A;  3QAY A;  5LYD A;  3Q71 A;  3R9G A;  4ZX8 A;  1P0H A;  3PB4 X;  4OAE A;  2Q7B A;  1I12 A;  2Z3L A;  3D66 A;  5HXD A;  4CRY B;  1OZP A;  3QAH A;  4UFW A;  2PCU A;  5BWA B;  5KTD A;  1KZF A;  1YRE A;  1MJ9 A;  3LD2 A;  2WCT A;  1M4L A;  4OC4 A;  4TU0 A;  4OC1 A;  1M4G A;  3SJG A;  3T9Y A;  8CPA A;  1RXT A;  4H6U A;  1UWY A;  2PJ0 A;  3TOA A;  3CXQ A;  3N5F A;  4Q38 A;  5LYI A;  4A37 A;  4JXR A;  3PGP A;  4P45 A;  4OKO A;  5FSU A;  1Y0Y A;  1CX8 A;  2OOT A;  3ZJ0 A;  3EKE A;  1ZLI A;  2GIV A;  3SI2 A;  4GUA A;  3SII A;  2PE3 A;  2RFH A;  3K9U A;  4NF1 A;  4O23 A;  1XFO A;  4PXE A;  4OC5 A;  1F2O A;  2PJ3 A;  4IQY A;  3LMS A;  4CYQ A;  1Z9U A;  3FEC A;  4JZ0 A;  3SJE A;  4F8Z A;  1RTQ A;  3SXO A;  5EBV A;  2IQ6 A;  5KTC A;  1IU8 A;  4JCA A;  2AFZ A;  1S60 A;  3B3C A;  3JUW A;  3NH4 A;  3D68 A;  1N71 A;  1IOI A;  3K9T A;  4OP4 A;  4PK2 A;  3T90 A;  4J4Z A;  2FS5 A;  2FIW A;  3F0A A;  4KOW A;  4CAV A;  4M3S A;  2VRI A;  3CPA A;  3E0K A;  4Q36 A;  3G3S A;  3R96 A;  4A94 A;  4WJB A;  4CYN A;  3KHZ A;  4XPK A;  2J8R A;  3DGV A;  4KLV A;  5J8F A;  2XEF A;  1EE3 P;  2AFW A;  2QML A;  4CGP A;  5DS0 A;  2BFQ A;  3R9E A;  1V0C A;  5CB5 A;  4TNU A;  3SIH A;  3DSB A;  4IHM A;  4CYO A;  3TE4 A;  3IIB A;  3D2M A;  3JTK A;  3PBE A;  2R98 A;  3TO7 A;  3N7Z A;  2V77 A;  5LRJ A;  5CBM A;  3B35 A;  4MI4 A;  1VHE A;  2DPS A;  3KQX A;  5G22 A;  4MHD A;  4D86 A;  4ABL A;  3BJ8 A;  4B5P B;  4PV6 A;  2OB0 A;  4WWV A;  5FVJ A;  4CAE A;  5E3B A;  3PEI A;  2JBJ A;  1IYK A;  1ON0 A;  4PSX A;  4UWI A;  4YRH A;  2JLM A;  5EMI A;  4B11 A;  4F6A A;  5F46 A;  3BXM A;  3V45 A;  3RZA A;  3F5B A;  4UEE A;  4OC0 A;  5AG7 A;  3I1U A;  4GS4 A;  4JLL A;  4MFP A;  1S7L A;  2ZEH A;  2JZF A;  4NGM A;  2Q0Y A;  1HDQ A;  1XIX A;  3PB8 X;  3FEE A;  3PFE A;  4P4F A;  4QBJ A;  4ETJ A;  2D4O A;  4PPZ A;  3EO4 A;  3PRT A;  4JWP A;  2HV2 A;  2XEG A;  4EFD A;  5J1Q A;  1U6M A;  5CB3 A;  2CNT A;  4R7M A;  2QYV A;  2Q4Z A;  1AMP A;  2AFS A;  3LAC A;  4ZY1 A;  3PB6 X;  2FT0 A;  3IFE A;  2ARH A;  3TFY A;  2ZPA A;  3NH8 A;  1QSM A;  5G20 A;  3RNZ A;  4FD7 A;  3BLN A;  3VWE A;  3FJU A;  3B7I A;  2Q4Y A;  2PVW A;  2B58 A;  3D3S A;  4F0X A;  3JZT A;  1LRZ A;  1TKF A;  1GYT A;  4J5Q A;  1MJB A;  2DEA A;  2PJ4 A;  1BPM A;  1J4J A;  1M4I A;  2GU2 A;  2I3C A;  2VBQ A;  4LQ6 A;  3B2Y A;  3GIU A;  4RN7 A;  1XJO A;  1NMT A;  3TTH A;  3SI0 A;  4P4I A;  4B12 A;  1TKJ A;  1ELL P;  4QB9 A;  2IMO A;  4ZBG A;  4NXY A;  2BFR A;  1KUX A;  4MBU A;  2NSM A;  3EY5 A;  3FX6 A;  3RBU A;  2Q4V A;  2ANP A;  2Q04 A;  2FXF A;  4A30 A;  1IOF A;  1R57 A;  5DWN A;  2Q44 A;  2LGR A;  4DJL A;  4MFQ A;  2JZE A;  3C26 A;  1CG2 A;  1Z8W A;  2JEW A;  1WWZ A;  2JDC A;  3TX8 A;  4CRZ B;  1ELM P;  2XEJ A;  1CP6 A;  4E0A A;  4BBH A;  2Q43 A;  4PXD A;  5D8N A;  3BJ7 A;  2HUZ A;  2P6G A;  2PC1 A;  4IK2 A;  5HVH A;  2PQ8 A;  4FAI A;  4TWE A;  1B6B A;  3BHX A;  4MY0 A;  2BOA A;  4ZY2 A;  2VEZ A;  2ZEG A;  2VQY A;  2ZED A;  4M6G A;  4ESS A;  4XNH C;  5I4M A;  2QIR A;  3GUX A;  1YSJ A;  3SIJ A;  4KOU A;  4MFL A;  4UCM A;  2ZW5 A;  5HVG A;  1Y9K A;  2V8H A;  3CPX A;  2ZEO A;  3P2H A;  2Z3O A;  2QJ8 A;  4ZYQ A;  3FED A;  1AUG A;  4M6I A;  2AFO A;  3A9L A;  3W6S A;  4CAW A;  2ZW7 A;  2EWB A;  4X3R A;  4CAF A;  4B14 A;  3SJX A;  1LAM A;  1XF8 A;  4UFV A;  1M44 A;  3VAT A;  4R3K A;  3FXT A;  1JWQ A;  2V8D A;  2EO8 A;  2FIA A;  2D4P A;  2Z10 A;  2VXK A;  5K8P A;  5DUS A;  4HKF A;  5HOL A;  2VZY A;  4NSQ A;  1HJZ A;  3IU2 A;  1Z5R A;  1YK3 A;  4P4J A;  4F9V A;  5ISV A;  5FSY A;  3JRU A;  2PR8 A;  3NA6 A;  1Y9W A;  4GM5 A;  3FIX A;  1B87 A;  3FBU A;  4EME A;  1FT7 A;  4FWU A;  2B5G B;  4NEX A;  2PJA A;  3V8I A;  4NGS A;  1MJA A;  3NE7 A;  4HNY B;  4NFR A;  4R3L A;  1QST A;  3KKW A;  3FNC A;  4UIA A;  4KVX A;  1GHE A;  4CPA A;  2PJ5 A;  2CNS A;  3DDD A;  4H89 A;  2EVN A;  1OBR A;  1KUV A;  1HEE A;  2B3U A;  1LCP A;  4MCR A;  2ZW4 A;  4Z65 A;  5FSV A;  3D8P A;  3WR7 A;  5K8M A;  1YQE A;  4BIN A;  4CS0 B;  3EWR A;  2CF4 A;  2AFM A;  2CXA A;  2VZZ A;  2OZU A;  2WZN A;  3IWE A;  4L89 A;  3F8K A;  4F9U A;  2X7B A;  4UWJ A;  5LYL A;  4ORF A;  4UCN A;  2KCW A;  3V2B A;  3B3V A;  2JZD A;  5A28 A;  1TF8 A;  3CDX A;  2W2G A;  2C1C A;  1MK4 A;  3SXN A;  1PCA A;  2C27 A;  2VL1 A;  1I1D A;  1K4J A;  4R8F A;  4CGL A;  3S9L A;  5K8N A;  1F57 A;  4K3N A;  4C7I A;  3PBB A;  3CZX A;  2G3A A;  2RC4 A;  1CP7 A;  1Y7E A;  4MCS A;  4J3G A;  4P44 A;  2GE3 A;  3KHX A;  2WPW A;  4XPL A;  3W6X A;  4K30 A;  2NMT A;  1R43 A;  3BI1 A;  1S3Z A;  2G3T A;  4MHP A;  2ABZ A;  5IV0 A;  2WUU A;  2K5T A;  1QSN A;  2Z0Z A;  1S7F A;  1YX0 A;  1PU9 A;  2IJZ A;  2J8N A;  2PDO A;  4MCQ A;  4QVT A;  4JYW A;  5LYF A;  4P10 A;  4J5S A;  3PZJ A;  2XD7 A;  4C2Z A;  2Q51 A;  3KR4 A;  3JVN A;  4P4D A;  4OAD A;  4XNH B;  2ACF A;  3GB0 A;  2HC9 A;  3RYO A;  4II9 A;  4BMH A;  4JJX A;  2O53 A;  1Z8T A;  1ZG7 A;  2REE A;  2Z3K A;  3QB8 A;  2GLJ A;  2PVV A;  5CPA A;  1LOK A;  4B6Z A;  1IB1 E;  2C6C A;  3FYN A;  2CTC A;  1CPX A;  4NGN A;  3H8E A;  1S5K A;  2JBK A;  2AJ6 A;  3WT4 A;  4C7H A;  4KSA A;  4JLY A;  4CGN A;  2Q7S A;  2ODF A;  4EWT A;  2Z11 A;  4DUK A;  3KZW A;  4MFZ A;  4KLW A;  4MFJ A;  3TO9 A;  4FUU A;  4C2X A;  2B3V A;  3GPG A;  2OZH A;  3R9F A;  2YNE A;  1PYT B;  3GYA A;  3KGQ A;  5JH9 A;  2RB7 A;  3PP9 A;  4UEZ A;  2KQV A;  1YME A;  5CMS A;  1IGB A;  4U9Z A;  4DNC A;  2I79 A;  3GPO A;  2PJB A;  5FSX A;  1YLO A;  2BEI A;  1WK4 A;  2P0W A;  3B3W A;  4R87 A;  5H84 A;  1CBX A;  4HNX B;  2C6G A;  3FH4 A;  1LAP A;  5G1Z A;  4A95 A;  3NH5 A;  3Q6Z A;  4KS9 A;  4OC3 A;  5F09 A;  1YVO A;  3EC4 A;  5AG5 A;  4GXH A;  3FMC A;  2AFC A;  3S9N A;  2ZEN A;  2Z3N A;  4MXU A;  2L8R A;  2PRQ A;  4F0Y A;  1VIX A;  2ZOF A;  4UFX A;  4UCP A;  3V38 A;  1H8L A;  1VKC A;  3PB9 X;  5G21 A;  4B10 A;  3KQZ A;  4NGQ A;  4RI1 A;  4J5R A;  2A4N A;  3EW5 A;  4HPS A;  1BPN A;  1QSO A;  2GRE A;  3D7G A;  2QEC A;  3GQE A;  3EJF A;  2F5I A;  4ZY0 A;  1FNO A;  1IYL A;  2P6F A;  4R6T A;  5EC4 A;  2B4D B;  3DNS A;  4FD4 A;  4B5O A;  3R95 A;  2BL1 A;  1QQ9 A;  4RUH A;  1BLL E;  4KUA A;  2ZOG A;  1RO5 A;  4CGO A;  4E8O A;  3SI1 A;  3TO6 A;  1X10 A;  4XPD C;  5JPH A;  2EBJ A;  4OME A;  4CGM A;  3EFA A;  1IIC A;  2J9A A;  1QMU A;  1ZO0 A;  4IUS A;  2WSA A;  4JGK A;  4ONU A;  1NE9 A;  4AXV A;  5IX3 A;  3MGD A;  3ISX A;  2EUI A;  5I0C A;  3IU1 A;  3D7F A;  4M85 A;  3WAB A;  3MRU A;  5IB0 A;  1BO4 A;  2PSW A;  5JGF A;  3UY5 A;  3MN8 A;  4ETK A;  1CM0 A;  4KSI A;  2AE6 A;  2FG1 A;  3GLJ A;  2RNK A;  2PJ8 A;  3S9M A;  4JVV A;  1XRY A;  3FRM A;  4OID A;  1TIQ A;  3QNV A;  3VH9 A;  2PJ6 A;  1TKH A;  4P4B A;  3GQO A;  1X12 A;  4ZI6 A;  2V8V A;  2Z3P A;  2OZG A;  3NE8 A;  4UIB A;  5F48 A;  1L0C A;  1YLE A;  3EJG A;  1P4N A;  1XE4 A;  2NYQ A;  3K2K A;  1NSL A;  4UBR A;  5HVF A;  1XMB A;  2DXQ A;  5JQ4 A;  1CJW A;  2CTB A;  2FL4 A;  4X8I A;  2G9D A;  4KOT A;  3WC5 A;  3D7D A;  3BI0 A;  1F2P A;  3CT9 A;  2O4H A;  4X5K A;  2BSW A;  1Y0R A;  3DR8 A;  3DLJ A;  3S6H A;  3VWD A;  4R76 A;  6CPA A;  4MFK A;  4AG9 A;  1YW6 A;  1SQH A;  4MJ8 A;  1R3N A;  3D7H A;  1AYE A;  3D67 A;  3EWO A;  4B5P A;  3WC7 A;  4C2Y A;  4ZGY B;  3FF3 A;  4EVY A;  3IJ3 A;  2P6E A;  5K8O A;  1TXZ A;  4NGR A;  2CIJ A;  5H86 A;  1KWM A;  5KTA A;  3I3G A;  1FY7 A;  2X47 A;  3ZZI A;  2V8G A;  4FD5 A;  4H2K A;  4PK3 A;  4PSW A;  5GCN A;  2YNC A;  2PIZ A;  3D4U A;  3IC1 A;  4KZT A;  4KYB A;  3CXS A;  4KOS A;  3L2N A;  1KUY A;  3GPQ A;  1VGY A;  3TT2 A;  3D2P A;  4B13 A;  5ELY A;  5HMN A;  5D29 A;  3B3S A;  1M4D A;  1VHO A;  3LOD A;  4KOV A;  4PXC A;  4MY3 A;  3IIF A;  3NFZ A;  5THW A;  4OIW A;  4ONW A;  2DPT A;  3S6F A;  7CPA A;  2PJ1 A;  2QVP A;  4MHY A;  5JM6 A;  4KOR A;  3KL9 A;  1A2Z A;  3H8G A;  4H6Z A;  1BAV A;  1YGH A;  1XMT A;  1Z2L A;  2Y0M A;  4JD6 A;  2WPX A;  3DR6 A;  3KAS A;  1ZR3 A;  4MCP A;  4PQA A;  4U9Y A;  5AG4 A;  2BCO A;  4RS2 A;  4Y49 C;  3W91 A;  2HB6 A;  4U5Y A;  2F7V A;  3TC8 A;  4KVM E;  3S6K A;  1YR0 A;  2ZEF A;  2PJ9 A;  4P6Y A;  2DF5 A;  2G0B A;  4XPD B;  1TXR A;  2HQY A;  3HUV A;  2VI7 A;  2YGW A;  3H5Z A;  3RAM A;  4DYO A;  2ATR A;  4E2A A;  2PJ2 A;  1DTD A;  1LFW A;  2R8V A;  3EXN A;  1ZLH A;  4AG7 A;  4LUA A;  5AG6 A;  2B4D A;  2BO9 A;  4NGP A;  2ZEL A;  4PXB A;  4NGT A;  4C68 A;  3B3T A;  4KOY A;  1NJR A;  1Q2C A;  3IO1 A;  5HH1 A;  5CNP A;  4UML A;  3B8G A;  3FB3 A;  3RO0 A;  2GAN A;  5DWM A;  1S7N A;  2EEE A;  4OLL A;  4Q7A A;  1ARL A;  4AVB A;  3EWP A;  2FSR A;  4YU9 A;  1HDU A;  4L8A A;  3IEH A;  1JQG A;  2GFQ A;  4P4E A;  4A33 A;  4K0C A;  2FCK A;  2ZW6 A;  3TOB A;  3HLP A;  1TF9 A;  1XBU A;  2FE7 A;  2J8M A;  2R1I A;  5A27 A;  1Q7L A;  1XEB A;  2WYR A;  5J8C A;  4M6H A;  3KR5 A;  2PJC A;  4R9M A;  1Q2D A;  4X2T A;  4ABK A;  2ZEP A;  4MMO A;  1LAN A;  3I9S A;  4CAX A;  4R57 A;  3FVL A;  1XOV A;  2FAV A;  1DE4 C;  4KOX A;  2PJ7 A;  3TCV A;  3T8W A;  2R7H A;  1UFH A;  3IGR A;  3ISZ A;  2GLF A;  4OC2 A;  4A2Z A;  1Z8L A;  2POK A;  5LRK A;  4ZX9 A;  2F8H A;  4W9Y A;  2AFX A;  2B5G A;  4G1P A;  1QSR A;  2PRB A;  2OH1 A;  2OR4 A;  2H5M A;  1ZR5 A;  1Z4E A;  4KVO E;  3KI9 A;  2YND A;  1Y7R A;  4KSF A;  2I00 A;  2IL4 A;  2EK8 A;  1ARM A;  2CY2 A;  3G8W A;  4NJR A;  1VHU A;  4AB7 A;  2Z3M A;  5LRG A;  4A38 A;  1IID A;  4FD6 A;  3H4Q A;  4NCZ A;  4YWY A;  5AGE A;  4BD9 A;  2AFU A;  4LQG A;  3S6G A;  3SHP A;  4HNW B;  5AIL A;  4MHZ A;  2FVG A;  4MRI A;  4AVC A;  2REF A;  5C88 A;  2PR1 A;  3IID A;  2B4B A;  2EK9 A;  2CNM A;  1TY8 A;  1M1D A;  1YVK A;  1IY7 A;  3LWU A;  3ETI A;  4CYP A;  4AVA A;  3VAR A;  3GY9 A;  3VFQ A;  2O28 A;  4Y49 B;  2FXK A;  4IAV A;  4NJQ A;  3R1K A;  4YGO A;  3SIG A;  4UA3 A;  5C82 A;  3EWQ A;  5IB9 A;  4JXQ A;  3P2F A;  4GVV A;  1NSA A;  4IF5 A;  2JEV A;  1YD9 A;  3WC6 A;  4UF4 A;  4FBE A;  1CPS A;  1PUA A;  3PFO A;  2PIY A;  4UEF A;  4A39 A;  3V7Z A;  1SPV A;  3SJF A;  1I21 A;  1YW4 A;  5HIH A;  1Q2Y A;  1Z4R A; 
#chains in the Genus database with same CATH homology
 2ZEM A;  2DX6 A;  1ZG9 A;  4MHN A;  2XEI A;  3H8F A;  3IWW A;  3PB7 X;  2C6P A;  1ZG8 A;  2ZEE A;  4GVW A;  5FSZ A;  5LYD A;  3Q71 A;  4ZX8 A;  3PB4 X;  3D66 A;  5HXD A;  2PCU A;  1M4L A;  4OC4 A;  4TU0 A;  4OC1 A;  3SJG A;  8CPA A;  1UWY A;  2PJ0 A;  3N5F A;  5LYI A;  4A37 A;  4P45 A;  4OKO A;  5FSU A;  1Y0Y A;  1CX8 A;  2OOT A;  3EKE A;  1ZLI A;  3SI2 A;  4GUA A;  3SII A;  2PE3 A;  2RFH A;  4O23 A;  4PXE A;  1XFO A;  4OC5 A;  1F2O A;  2PJ3 A;  4IQY A;  3LMS A;  3FEC A;  4JZ0 A;  3SJE A;  4F8Z A;  1RTQ A;  2IQ6 A;  4JCA A;  2AFZ A;  3B3C A;  3NH4 A;  3D68 A;  3K9T A;  4OP4 A;  4J4Z A;  2VRI A;  3CPA A;  4A94 A;  4WJB A;  3KHZ A;  3DGV A;  2XEF A;  1EE3 P;  2AFW A;  5DS0 A;  2BFQ A;  5CB5 A;  4TNU A;  3SIH A;  4IHM A;  3IIB A;  3PBE A;  2V77 A;  5LRJ A;  5CBM A;  3B35 A;  1VHE A;  3KQX A;  4D86 A;  4ABL A;  4WWV A;  5E3B A;  3PEI A;  2JBJ A;  3BXM A;  3V45 A;  3RZA A;  4UEE A;  4OC0 A;  3I1U A;  4JLL A;  2ZEH A;  4NGM A;  1HDQ A;  4P4F A;  3PB8 X;  3FEE A;  3PFE A;  4ETJ A;  4PPZ A;  3PRT A;  2XEG A;  4EFD A;  5J1Q A;  5CB3 A;  4R7M A;  2QYV A;  2Q4Z A;  1AMP A;  2AFS A;  4ZY1 A;  3PB6 X;  3IFE A;  3NH8 A;  3FJU A;  3B7I A;  2PVW A;  3JZT A;  2PJ4 A;  1TKF A;  1GYT A;  2ZOG A;  4J5Q A;  2DEA A;  1BPM A;  2GU2 A;  2I3C A;  3B2Y A;  1XJO A;  3SI0 A;  4P4I A;  1TKJ A;  1ELL P;  2IMO A;  2BFR A;  3RBU A;  2NSM A;  3FX6 A;  2ANP A;  2LGR A;  4DJL A;  1CG2 A;  2JEW A;  3TX8 A;  1ELM P;  2XEJ A;  1CP6 A;  2Q43 A;  4PXD A;  5D8N A;  4IK2 A;  5HVH A;  4FAI A;  4TWE A;  3BHX A;  2BOA A;  4ZY2 A;  2ZEG A;  2ZED A;  4ESS A;  5I4M A;  3GUX A;  1YSJ A;  3SIJ A;  5HVG A;  2V8H A;  3CPX A;  2ZEO A;  2QJ8 A;  4ZYQ A;  3FED A;  2AFO A;  4X3R A;  2EWB A;  3SJX A;  1LAM A;  3VAT A;  2V8D A;  5K8P A;  5DUS A;  5HOL A;  1HJZ A;  1Z5R A;  4P4J A;  4F9V A;  5FSY A;  3JRU A;  4GM5 A;  3NA6 A;  4EME A;  1FT7 A;  4FWU A;  2PJA A;  4NGS A;  4NFR A;  4UIA A;  4CPA A;  2PJ5 A;  1OBR A;  1HEE A;  1LCP A;  4MCR A;  4Z65 A;  5FSV A;  5K8M A;  3EWR A;  2CF4 A;  2AFM A;  2WZN A;  4F9U A;  5LYL A;  3V2B A;  3B3V A;  1TF8 A;  3CDX A;  2C1C A;  1PCA A;  2VL1 A;  4R8F A;  3S9L A;  5K8N A;  1F57 A;  4K3N A;  3PBB A;  1CP7 A;  1Y7E A;  4MCS A;  4P44 A;  3KHX A;  1R43 A;  3BI1 A;  4MHP A;  2ABZ A;  4MCQ A;  2IJZ A;  5LYF A;  4JYW A;  4P10 A;  4J5S A;  2XD7 A;  2Q51 A;  3KR4 A;  4P4D A;  2ACF A;  3GB0 A;  2HC9 A;  2O53 A;  1ZG7 A;  4B6Z A;  2GLJ A;  2PVV A;  5CPA A;  1LOK A;  2C6C A;  2CTC A;  1CPX A;  4NGN A;  3H8E A;  2JBK A;  3WT4 A;  4EWT A;  4DUK A;  3KZW A;  4FUU A;  3GPG A;  1PYT B;  3KGQ A;  5JH9 A;  2RB7 A;  4UEZ A;  1YME A;  5CMS A;  1IGB A;  3GPO A;  2PJB A;  5FSX A;  1YLO A;  3B3W A;  1CBX A;  2C6G A;  3FH4 A;  1LAP A;  3NH5 A;  3Q6Z A;  5F09 A;  4OC3 A;  3FMC A;  2AFC A;  3S9N A;  2ZEN A;  4MXU A;  2L8R A;  2PRQ A;  1VIX A;  2ZOF A;  3V38 A;  1H8L A;  3PB9 X;  3KQZ A;  4NGQ A;  4J5R A;  3EW5 A;  1BPN A;  2GRE A;  3D7G A;  3GQE A;  3EJF A;  4ZY0 A;  1FNO A;  4R6T A;  1QQ9 A;  4RUH A;  1BLL E;  3SI1 A;  4OME A;  1QMU A;  2J9A A;  4JGK A;  4AXV A;  3ISX A;  3WAB A;  3D7F A;  3MRU A;  5JGF A;  3MN8 A;  4ETK A;  4KSI A;  2FG1 A;  3GLJ A;  2PJ8 A;  3S9M A;  4JVV A;  1XRY A;  4OID A;  3VH9 A;  3QNV A;  2PJ6 A;  1TKH A;  4P4B A;  3GQO A;  4ZI6 A;  2V8V A;  4UIB A;  4A39 A;  3EJG A;  3K2K A;  2NYQ A;  5HVF A;  1XMB A;  2CTB A;  4X8I A;  3WC5 A;  2G9D A;  3D7D A;  3BI0 A;  1F2P A;  3CT9 A;  2O4H A;  1Y0R A;  3DLJ A;  6CPA A;  4R76 A;  1YW6 A;  1R3N A;  3D7H A;  1AYE A;  3D67 A;  3EWO A;  3WC7 A;  3FF3 A;  3IJ3 A;  5K8O A;  1TXZ A;  4NGR A;  2CIJ A;  1KWM A;  2X47 A;  2V8G A;  4H2K A;  2PIZ A;  3D4U A;  3IC1 A;  4KYB A;  3L2N A;  3GPQ A;  1VGY A;  5ELY A;  5D29 A;  3B3S A;  1VHO A;  4PXC A;  3IIF A;  3NFZ A;  5THW A;  4OIW A;  4ONW A;  7CPA A;  2PJ1 A;  2QVP A;  4MHY A;  5JM6 A;  3KL9 A;  3H8G A;  1BAV A;  1Z2L A;  3KAS A;  1ZR3 A;  4MCP A;  4PQA A;  2BCO A;  2HB6 A;  2F7V A;  3TC8 A;  2ZEF A;  4P6Y A;  2PJ9 A;  1TXR A;  3HUV A;  3RAM A;  4DYO A;  2PJ2 A;  1DTD A;  1LFW A;  1ZLH A;  2BO9 A;  4NGP A;  2ZEL A;  4PXB A;  4NGT A;  3B3T A;  1NJR A;  3IO1 A;  4UML A;  2EEE A;  4Q7A A;  1ARL A;  3EWP A;  4YU9 A;  1HDU A;  3IEH A;  1JQG A;  4P4E A;  4K0C A;  3HLP A;  1TF9 A;  1XBU A;  1Q7L A;  2WYR A;  3KR5 A;  2PJC A;  4MMO A;  4X2T A;  4ABK A;  2ZEP A;  1LAN A;  3FVL A;  2FAV A;  1DE4 C;  2PJ7 A;  3T8W A;  3ISZ A;  2GLF A;  4OC2 A;  5LRK A;  1Z8L A;  2POK A;  4ZX9 A;  2F8H A;  4W9Y A;  2AFX A;  4G1P A;  2OR4 A;  1ZR5 A;  3KI9 A;  2EK8 A;  1ARM A;  4NJR A;  1VHU A;  5LRG A;  4A38 A;  4YWY A;  4BD9 A;  2AFU A;  4LQG A;  5AIL A;  4MHZ A;  2FVG A;  4MRI A;  3IID A;  2EK9 A;  3LWU A;  1TY8 A;  1IY7 A;  3ETI A;  3VAR A;  3VFQ A;  2FXK A;  4IAV A;  4NJQ A;  3SIG A;  3EWQ A;  5IB9 A;  4GVV A;  1NSA A;  1YD9 A;  3WC6 A;  4UF4 A;  4FBE A;  1CPS A;  3PFO A;  2PIY A;  4UEF A;  3V7Z A;  1SPV A;  3SJF A;  1YW4 A;  5HIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...