4JVVA

Crystal structure of the evolved variant of the computationally designed serine hydrolase, osh55.4_h1, covalently bound with diisopropyl fluorophosphate (dfp), northeast structural genomics consortium (nesg) target or273
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
157
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMGEEIKKAPDTLEVTGVHGTEKAEAYRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords evolved variant of the computationally designed serine hydro
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2013-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4jvvA00
2EEEA 1TY8A 3KQXA 2FAVA 1LANA 4ZY2A 3EWOA 3EJGA 1ZR5A 2VRIA 4R7MA 5HOLA 4ESSA 2FXKA 3JZTA 1BPMA 4GUAA 4ETKA 5CB3A 4ABKA 2J9AA 3KR4A 5CB5A 4UMLA 2L8RA 4GVWA 3SIHA 2DX6A 1NJRA 4JVVA 1SPVA 3SIGA 3V45A 4GVVA 2ACFA 3VFQA 5FSUA 1LAPA 3IJ3A 4JCAA 5FSVA 3IIFA 4K0CA 3KQZA 4ZX8A 3KR5A 3EJFA 4R6TA 3SIJA 5D8NA 3V2BA 4IQYA 1VHUA 1YD9A 1TXZA 2FG1A 5FSYA 3EKEA 4ZYQA 3EWPA 3H8GA 4D86A 4ETJA 4J5SA 3GPGA 3Q6ZA 4K3NA 4JGKA 3GQOA 4ZI6A 3Q71A 4KSIA 5E3BA 3KZWA 3SIIA 3EW5A 4ABLA 4ZY0A 1GYTA 3EWRA 4JLLA 5AILA 1LAMA 2BFQA 3H8FA 3T8WA 3ETIA 2BFRA 4R76A 4ZX9A 4ZY1A 1BLLE 2EWBA 2XD7A 5FSZA 3EWQA 1ZR3A 3IIDA 3GQEA 1BPNA 3PEIA 4J5QA 4KYBA 5HIHA 1HJZA 3JRUA 5FSXA 3H8EA 5CBMA 2LGRA 5DUSA 3GPQA 3GPOA 4J5RA 2AFCA 2X47A 1LCPA 4TU0A 4X2TA 5CMSA 4J4ZA
chains in the Genus database with same CATH superfamily
2EEEA 1TY8A 3KQXA 2FAVA 1LANA 4ZY2A 3EWOA 3EJGA 1ZR5A 2VRIA 4R7MA 5HOLA 4ESSA 2FXKA 3JZTA 1BPMA 4GUAA 4ETKA 5CB3A 4ABKA 2J9AA 3KR4A 5CB5A 4UMLA 2L8RA 4GVWA 3SIHA 2DX6A 1NJRA 4JVVA 1SPVA 3SIGA 3V45A 4GVVA 2ACFA 3VFQA 5FSUA 1LAPA 3IJ3A 4JCAA 5FSVA 3IIFA 4K0CA 3KQZA 4ZX8A 2JZEA 3KR5A 3EJFA 4R6TA 3SIJA 5D8NA 3V2BA 4IQYA 1VHUA 1YD9A 2JZDA 1TXZA 2FG1A 5FSYA 3EKEA 4ZYQA 3EWPA 3H8GA 4D86A 4ETJA 4J5SA 3GPGA 3Q6ZA 4K3NA 4JGKA 2RNKA 3GQOA 4ZI6A 3Q71A 4KSIA 5E3BA 3KZWA 3SIIA 3EW5A 4ABLA 4ZY0A 1GYTA 3EWRA 2KQVA 4JLLA 5AILA 1LAMA 2BFQA 3H8FA 3T8WA 3ETIA 2BFRA 2W2GA 4R76A 2WCTA 4ZX9A 4ZY1A 1BLLE 2EWBA 2XD7A 5FSZA 3EWQA 1ZR3A 3IIDA 2JZFA 3GQEA 1BPNA 3PEIA 4J5QA 4KYBA 5HIHA 1HJZA 3JRUA 5FSXA 3H8EA 5CBMA 2LGRA 5DUSA 3GPQA 3GPOA 4J5RA 2AFCA 2X47A 1LCPA 4TU0A 4X2TA 5CMSA 4J4ZA
chains in the Genus database with same CATH topology
2EEEA 1TY8A 3KQXA 2FAVA 1LANA 4ZY2A 3EWOA 3EJGA 1ZR5A 2VRIA 4R7MA 5HOLA 4ESSA 2FXKA 3JZTA 1BPMA 4GUAA 4ETKA 5CB3A 4ABKA 2J9AA 3KR4A 5CB5A 4UMLA 2L8RA 4GVWA 3SIHA 2DX6A 1NJRA 4JVVA 1SPVA 3SIGA 3V45A 4GVVA 2ACFA 3VFQA 5FSUA 1LAPA 3IJ3A 4JCAA 5FSVA 3IIFA 4K0CA 3KQZA 4ZX8A 3KR5A 3EJFA 4R6TA 3SIJA 5D8NA 3V2BA 4IQYA 1VHUA 1YD9A 1TXZA 2FG1A 5FSYA 3EKEA 4ZYQA 3EWPA 3H8GA 4D86A 4ETJA 4J5SA 3GPGA 3Q6ZA 4K3NA 4JGKA 3GQOA 4ZI6A 3Q71A 4KSIA 5E3BA 3KZWA 3SIIA 3EW5A 4ABLA 4ZY0A 1GYTA 3EWRA 4JLLA 5AILA 1LAMA 2BFQA 3H8FA 3T8WA 3ETIA 2BFRA 4R76A 4ZX9A 4ZY1A 1BLLE 2EWBA 2XD7A 5FSZA 3EWQA 1ZR3A 3IIDA 3GQEA 1BPNA 3PEIA 4J5QA 4KYBA 5HIHA 1HJZA 3JRUA 5FSXA 3H8EA 5CBMA 2LGRA 5DUSA 3GPQA 3GPOA 4J5RA 2AFCA 2X47A 1LCPA 4TU0A 4X2TA 5CMSA 4J4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEE A;  1TY8 A;  3KQX A;  2FAV A;  1LAN A;  4ZY2 A;  3EWO A;  3EJG A;  1ZR5 A;  2VRI A;  4R7M A;  5HOL A;  4ESS A;  2FXK A;  3JZT A;  1BPM A;  4GUA A;  4ETK A;  5CB3 A;  4ABK A;  2J9A A;  3KR4 A;  5CB5 A;  4UML A;  2L8R A;  4GVW A;  3SIH A;  2DX6 A;  1NJR A;  4JVV A;  1SPV A;  3SIG A;  3V45 A;  4GVV A;  2ACF A;  3VFQ A;  5FSU A;  1LAP A;  3IJ3 A;  4JCA A;  5FSV A;  3IIF A;  4K0C A;  3KQZ A;  4ZX8 A;  3KR5 A;  3EJF A;  4R6T A;  3SIJ A;  5D8N A;  3V2B A;  4IQY A;  1VHU A;  1YD9 A;  1TXZ A;  2FG1 A;  5FSY A;  3EKE A;  4ZYQ A;  3EWP A;  3H8G A;  4D86 A;  4ETJ A;  4J5S A;  3GPG A;  3Q6Z A;  4K3N A;  4JGK A;  3GQO A;  4ZI6 A;  3Q71 A;  4KSI A;  5E3B A;  3KZW A;  3SII A;  3EW5 A;  4ABL A;  4ZY0 A;  1GYT A;  3EWR A;  4JLL A;  5AIL A;  1LAM A;  2BFQ A;  3H8F A;  3T8W A;  3ETI A;  2BFR A;  4R76 A;  4ZX9 A;  4ZY1 A;  1BLL E;  2EWB A;  2XD7 A;  5FSZ A;  3EWQ A;  1ZR3 A;  3IID A;  3GQE A;  1BPN A;  3PEI A;  4J5Q A;  4KYB A;  5HIH A;  1HJZ A;  3JRU A;  5FSX A;  3H8E A;  5CBM A;  2LGR A;  5DUS A;  3GPQ A;  3GPO A;  4J5R A;  2AFC A;  2X47 A;  1LCP A;  4TU0 A;  4X2T A;  5CMS A;  4J4Z A; 
#chains in the Genus database with same CATH topology
 2EEE A;  1TY8 A;  3KQX A;  2FAV A;  1LAN A;  4ZY2 A;  3EWO A;  3EJG A;  1ZR5 A;  2VRI A;  4R7M A;  5HOL A;  4ESS A;  2FXK A;  3JZT A;  1BPM A;  4GUA A;  4ETK A;  5CB3 A;  4ABK A;  2J9A A;  3KR4 A;  5CB5 A;  4UML A;  2L8R A;  4GVW A;  3SIH A;  2DX6 A;  1NJR A;  4JVV A;  1SPV A;  3SIG A;  3V45 A;  4GVV A;  2ACF A;  3VFQ A;  5FSU A;  1LAP A;  3IJ3 A;  4JCA A;  5FSV A;  3IIF A;  4K0C A;  3KQZ A;  4ZX8 A;  2JZE A;  3KR5 A;  3EJF A;  4R6T A;  3SIJ A;  5D8N A;  3V2B A;  4IQY A;  1VHU A;  1YD9 A;  2JZD A;  1TXZ A;  2FG1 A;  5FSY A;  3EKE A;  4ZYQ A;  3EWP A;  3H8G A;  4D86 A;  4ETJ A;  4J5S A;  3GPG A;  3Q6Z A;  4K3N A;  4JGK A;  2RNK A;  3GQO A;  4ZI6 A;  3Q71 A;  4KSI A;  5E3B A;  3KZW A;  3SII A;  3EW5 A;  4ABL A;  4ZY0 A;  1GYT A;  3EWR A;  2KQV A;  4JLL A;  5AIL A;  1LAM A;  2BFQ A;  3H8F A;  3T8W A;  3ETI A;  2BFR A;  2W2G A;  4R76 A;  2WCT A;  4ZX9 A;  4ZY1 A;  1BLL E;  2EWB A;  2XD7 A;  5FSZ A;  3EWQ A;  1ZR3 A;  3IID A;  2JZF A;  3GQE A;  1BPN A;  3PEI A;  4J5Q A;  4KYB A;  5HIH A;  1HJZ A;  3JRU A;  5FSX A;  3H8E A;  5CBM A;  2LGR A;  5DUS A;  3GPQ A;  3GPO A;  4J5R A;  2AFC A;  2X47 A;  1LCP A;  4TU0 A;  4X2T A;  5CMS A;  4J4Z A; 
#chains in the Genus database with same CATH homology
 2EEE A;  1TY8 A;  3KQX A;  2FAV A;  1LAN A;  4ZY2 A;  3EWO A;  3EJG A;  1ZR5 A;  2VRI A;  4R7M A;  5HOL A;  4ESS A;  2FXK A;  3JZT A;  1BPM A;  4GUA A;  4ETK A;  5CB3 A;  4ABK A;  2J9A A;  3KR4 A;  5CB5 A;  4UML A;  2L8R A;  4GVW A;  3SIH A;  2DX6 A;  1NJR A;  4JVV A;  1SPV A;  3SIG A;  3V45 A;  4GVV A;  2ACF A;  3VFQ A;  5FSU A;  1LAP A;  3IJ3 A;  4JCA A;  5FSV A;  3IIF A;  4K0C A;  3KQZ A;  4ZX8 A;  3KR5 A;  3EJF A;  4R6T A;  3SIJ A;  5D8N A;  3V2B A;  4IQY A;  1VHU A;  1YD9 A;  1TXZ A;  2FG1 A;  5FSY A;  3EKE A;  4ZYQ A;  3EWP A;  3H8G A;  4D86 A;  4ETJ A;  4J5S A;  3GPG A;  3Q6Z A;  4K3N A;  4JGK A;  3GQO A;  4ZI6 A;  3Q71 A;  4KSI A;  5E3B A;  3KZW A;  3SII A;  3EW5 A;  4ABL A;  4ZY0 A;  1GYT A;  3EWR A;  4JLL A;  5AIL A;  1LAM A;  2BFQ A;  3H8F A;  3T8W A;  3ETI A;  2BFR A;  4R76 A;  4ZX9 A;  4ZY1 A;  1BLL E;  2EWB A;  2XD7 A;  5FSZ A;  3EWQ A;  1ZR3 A;  3IID A;  3GQE A;  1BPN A;  3PEI A;  4J5Q A;  4KYB A;  5HIH A;  1HJZ A;  3JRU A;  5FSX A;  3H8E A;  5CBM A;  2LGR A;  5DUS A;  3GPQ A;  3GPO A;  4J5R A;  2AFC A;  2X47 A;  1LCP A;  4TU0 A;  4X2T A;  5CMS A;  4J4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...