4JVVA

Crystal structure of the evolved variant of the computationally designed serine hydrolase, osh55.4_h1, covalently bound with diisopropyl fluorophosphate (dfp), northeast structural genomics consortium (nesg) target or273
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
157
Chain Sequence
ARIRHVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTSWGAWVGGLPAEAVHRVMGEEIKKAPDTLEVTGVHGTEKAEAYRRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords evolved variant of the computationally designed serine hydro
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
source organism Synthetic construct
total genus 50
structure length 157
sequence length 158
ec nomenclature
pdb deposition date 2013-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4jvvA00
1ZR5A 5CB3A 1LAPA 4ZY1A 3JRUA 4ETKA 4ZX8A 3KR4A 3KZWA 5D8NA 3EJGA 5CMSA 4R7MA 5FSUA 4ZY0A 5HIHA 1VHUA 3Q6ZA 4GVVA 4TU0A 3PEIA 3GPQA 1BPMA 1LANA 2ACFA 4GUAA 1ZR3A 2BFRA 2J9AA 3EJFA 3SIJA 4JVVA 3SIIA 2DX6A 3SIGA 2EEEA 4JCAA 5FSVA 3VFQA 2EWBA 4ZX9A 3EWPA 3V2BA 3H8EA 3T8WA 3EWQA 3IIFA 4GVWA 5E3BA 3JZTA 3EWOA 4UMLA 1GYTA 3ETIA 3KQZA 4ETJA 4J4ZA 4JGKA 4JLLA 3V45A 2VRIA 4ABKA 1LCPA 3KR5A 3GQEA 3H8GA 1LAMA 5CB5A 5CBMA 5FSXA 5FSZA 3SIHA 1NJRA 1SPVA 2FAVA 3EKEA 2BFQA 2FG1A 3GPOA 4D86A 4KYBA 4J5QA 1BLLE 2XD7A 2AFCA 3H8FA 2L8RA 4J5RA 4KSIA 4J5SA 1TXZA 4X2TA 3GPGA 3KQXA 4ZYQA 4K0CA 1HJZA 1TY8A 4R76A 4ZI6A 3Q71A 3EW5A 3GQOA 5DUSA 3EWRA 4ZY2A 4ABLA 4R6TA 5AILA 5HOLA 2FXKA 2X47A 1BPNA 4ESSA 1YD9A 4K3NA 3IIDA 4IQYA 3IJ3A 5FSYA 2LGRA
chains in the Genus database with same CATH superfamily
1ZR5A 5CB3A 1LAPA 4ZY1A 3JRUA 4ETKA 4ZX8A 3KR4A 3KZWA 5D8NA 3EJGA 5CMSA 4R7MA 5FSUA 4ZY0A 5HIHA 1VHUA 3Q6ZA 4GVVA 4TU0A 3PEIA 3GPQA 1BPMA 1LANA 2ACFA 4GUAA 1ZR3A 2WCTA 2BFRA 2J9AA 3EJFA 3SIJA 4JVVA 3SIIA 2DX6A 3SIGA 2EEEA 4JCAA 5FSVA 3VFQA 2EWBA 4ZX9A 3EWPA 3V2BA 3H8EA 3T8WA 3EWQA 3IIFA 4GVWA 5E3BA 3JZTA 3EWOA 4UMLA 1GYTA 3ETIA 3KQZA 4ETJA 4J4ZA 4JGKA 4JLLA 3V45A 2VRIA 4ABKA 2KQVA 1LCPA 3KR5A 3GQEA 3H8GA 1LAMA 5CB5A 5CBMA 5FSXA 5FSZA 3SIHA 1NJRA 2JZEA 1SPVA 2FAVA 3EKEA 2BFQA 2FG1A 2JZDA 3GPOA 4D86A 4KYBA 4J5QA 1BLLE 2XD7A 2AFCA 3H8FA 2JZFA 2L8RA 4J5RA 4KSIA 4J5SA 1TXZA 4X2TA 3GPGA 3KQXA 4ZYQA 4K0CA 1HJZA 1TY8A 4R76A 4ZI6A 3Q71A 3EW5A 2W2GA 3GQOA 5DUSA 3EWRA 4ZY2A 4ABLA 4R6TA 5AILA 5HOLA 2RNKA 2FXKA 2X47A 1BPNA 4ESSA 1YD9A 4IQYA 3IIDA 4K3NA 3IJ3A 5FSYA 2LGRA
chains in the Genus database with same CATH topology
1ZR5A 5CB3A 1LAPA 4ZY1A 3JRUA 4ETKA 4ZX8A 3KR4A 3KZWA 5D8NA 3EJGA 5CMSA 4R7MA 5FSUA 4ZY0A 5HIHA 1VHUA 3Q6ZA 4GVVA 4TU0A 3PEIA 3GPQA 1BPMA 1LANA 2ACFA 4GUAA 1ZR3A 2BFRA 2J9AA 3EJFA 3SIJA 4JVVA 3SIIA 2DX6A 3SIGA 2EEEA 4JCAA 5FSVA 3VFQA 2EWBA 4ZX9A 3EWPA 3V2BA 3H8EA 3T8WA 3EWQA 3IIFA 4GVWA 5E3BA 3JZTA 3EWOA 4UMLA 1GYTA 3ETIA 3KQZA 4ETJA 4J4ZA 4JGKA 4JLLA 3V45A 2VRIA 4ABKA 1LCPA 3KR5A 3GQEA 3H8GA 1LAMA 5CB5A 5CBMA 5FSXA 5FSZA 3SIHA 1NJRA 1SPVA 2FAVA 3EKEA 2BFQA 2FG1A 3GPOA 4D86A 4KYBA 4J5QA 1BLLE 2XD7A 2AFCA 3H8FA 2L8RA 4J5RA 4KSIA 4J5SA 1TXZA 4X2TA 3GPGA 3KQXA 4ZYQA 4K0CA 1HJZA 1TY8A 4R76A 4ZI6A 3Q71A 3EW5A 3GQOA 5DUSA 3EWRA 4ZY2A 4ABLA 4R6TA 5AILA 5HOLA 2FXKA 2X47A 1BPNA 4ESSA 1YD9A 4K3NA 3IIDA 4IQYA 3IJ3A 5FSYA 2LGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR5 A;  5CB3 A;  1LAP A;  4ZY1 A;  3JRU A;  4ETK A;  4ZX8 A;  3KR4 A;  3KZW A;  5D8N A;  3EJG A;  5CMS A;  4R7M A;  5FSU A;  4ZY0 A;  5HIH A;  1VHU A;  3Q6Z A;  4GVV A;  4TU0 A;  3PEI A;  3GPQ A;  1BPM A;  1LAN A;  2ACF A;  4GUA A;  1ZR3 A;  2BFR A;  2J9A A;  3EJF A;  3SIJ A;  4JVV A;  3SII A;  2DX6 A;  3SIG A;  2EEE A;  4JCA A;  5FSV A;  3VFQ A;  2EWB A;  4ZX9 A;  3EWP A;  3V2B A;  3H8E A;  3T8W A;  3EWQ A;  3IIF A;  4GVW A;  5E3B A;  3JZT A;  3EWO A;  4UML A;  1GYT A;  3ETI A;  3KQZ A;  4ETJ A;  4J4Z A;  4JGK A;  4JLL A;  3V45 A;  2VRI A;  4ABK A;  1LCP A;  3KR5 A;  3GQE A;  3H8G A;  1LAM A;  5CB5 A;  5CBM A;  5FSX A;  5FSZ A;  3SIH A;  1NJR A;  1SPV A;  2FAV A;  3EKE A;  2BFQ A;  2FG1 A;  3GPO A;  4D86 A;  4KYB A;  4J5Q A;  1BLL E;  2XD7 A;  2AFC A;  3H8F A;  2L8R A;  4J5R A;  4KSI A;  4J5S A;  1TXZ A;  4X2T A;  3GPG A;  3KQX A;  4ZYQ A;  4K0C A;  1HJZ A;  1TY8 A;  4R76 A;  4ZI6 A;  3Q71 A;  3EW5 A;  3GQO A;  5DUS A;  3EWR A;  4ZY2 A;  4ABL A;  4R6T A;  5AIL A;  5HOL A;  2FXK A;  2X47 A;  1BPN A;  4ESS A;  1YD9 A;  4K3N A;  3IID A;  4IQY A;  3IJ3 A;  5FSY A;  2LGR A; 
#chains in the Genus database with same CATH topology
 1ZR5 A;  5CB3 A;  1LAP A;  4ZY1 A;  3JRU A;  4ETK A;  4ZX8 A;  3KR4 A;  3KZW A;  5D8N A;  3EJG A;  5CMS A;  4R7M A;  5FSU A;  4ZY0 A;  5HIH A;  1VHU A;  3Q6Z A;  4GVV A;  4TU0 A;  3PEI A;  3GPQ A;  1BPM A;  1LAN A;  2ACF A;  4GUA A;  1ZR3 A;  2WCT A;  2BFR A;  2J9A A;  3EJF A;  3SIJ A;  4JVV A;  3SII A;  2DX6 A;  3SIG A;  2EEE A;  4JCA A;  5FSV A;  3VFQ A;  2EWB A;  4ZX9 A;  3EWP A;  3V2B A;  3H8E A;  3T8W A;  3EWQ A;  3IIF A;  4GVW A;  5E3B A;  3JZT A;  3EWO A;  4UML A;  1GYT A;  3ETI A;  3KQZ A;  4ETJ A;  4J4Z A;  4JGK A;  4JLL A;  3V45 A;  2VRI A;  4ABK A;  2KQV A;  1LCP A;  3KR5 A;  3GQE A;  3H8G A;  1LAM A;  5CB5 A;  5CBM A;  5FSX A;  5FSZ A;  3SIH A;  1NJR A;  2JZE A;  1SPV A;  2FAV A;  3EKE A;  2BFQ A;  2FG1 A;  2JZD A;  3GPO A;  4D86 A;  4KYB A;  4J5Q A;  1BLL E;  2XD7 A;  2AFC A;  3H8F A;  2JZF A;  2L8R A;  4J5R A;  4KSI A;  4J5S A;  1TXZ A;  4X2T A;  3GPG A;  3KQX A;  4ZYQ A;  4K0C A;  1HJZ A;  1TY8 A;  4R76 A;  4ZI6 A;  3Q71 A;  3EW5 A;  2W2G A;  3GQO A;  5DUS A;  3EWR A;  4ZY2 A;  4ABL A;  4R6T A;  5AIL A;  5HOL A;  2RNK A;  2FXK A;  2X47 A;  1BPN A;  4ESS A;  1YD9 A;  4IQY A;  3IID A;  4K3N A;  3IJ3 A;  5FSY A;  2LGR A; 
#chains in the Genus database with same CATH homology
 1ZR5 A;  5CB3 A;  1LAP A;  4ZY1 A;  3JRU A;  4ETK A;  4ZX8 A;  3KR4 A;  3KZW A;  5D8N A;  3EJG A;  5CMS A;  4R7M A;  5FSU A;  4ZY0 A;  5HIH A;  1VHU A;  3Q6Z A;  4GVV A;  4TU0 A;  3PEI A;  3GPQ A;  1BPM A;  1LAN A;  2ACF A;  4GUA A;  1ZR3 A;  2BFR A;  2J9A A;  3EJF A;  3SIJ A;  4JVV A;  3SII A;  2DX6 A;  3SIG A;  2EEE A;  4JCA A;  5FSV A;  3VFQ A;  2EWB A;  4ZX9 A;  3EWP A;  3V2B A;  3H8E A;  3T8W A;  3EWQ A;  3IIF A;  4GVW A;  5E3B A;  3JZT A;  3EWO A;  4UML A;  1GYT A;  3ETI A;  3KQZ A;  4ETJ A;  4J4Z A;  4JGK A;  4JLL A;  3V45 A;  2VRI A;  4ABK A;  1LCP A;  3KR5 A;  3GQE A;  3H8G A;  1LAM A;  5CB5 A;  5CBM A;  5FSX A;  5FSZ A;  3SIH A;  1NJR A;  1SPV A;  2FAV A;  3EKE A;  2BFQ A;  2FG1 A;  3GPO A;  4D86 A;  4KYB A;  4J5Q A;  1BLL E;  2XD7 A;  2AFC A;  3H8F A;  2L8R A;  4J5R A;  4KSI A;  4J5S A;  1TXZ A;  4X2T A;  3GPG A;  3KQX A;  4ZYQ A;  4K0C A;  1HJZ A;  1TY8 A;  4R76 A;  4ZI6 A;  3Q71 A;  3EW5 A;  3GQO A;  5DUS A;  3EWR A;  4ZY2 A;  4ABL A;  4R6T A;  5AIL A;  5HOL A;  2FXK A;  2X47 A;  1BPN A;  4ESS A;  1YD9 A;  4K3N A;  3IID A;  4IQY A;  3IJ3 A;  5FSY A;  2LGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...