4ZYQA

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10s
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
519
structure length
517
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 172
structure length 517
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zyqA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zyqA02
3GQEA 4WJBA 2C6GA 3HLPA 3KQXA 3HUVA 2ZEHA 1TF8A 4OIWA 3H8GA 1AMPA 1CP6A 1DE4C 2IQ6A 3V2BA 2QVPA 4IK2A 3L2NA 3D7FA 3GPQA 1VHUA 2AFCA 4FBEA 1ZLIA 4ONWA 3SJFA 3MRUA 3IIBA 1M4LA 1CP7A 3FX6A 3IC1A 1VGYA 3EWQA 5E3BA 2PJ9A 3H8EA 2PJ5A 4IHMA 3KR5A 1TY8A 1FNOA 2PJ8A 2VL1A 1YD9A 3SI2A 4X2TA 3GUXA 2V8GA 4UEEA 3RBUA 4A94A 2AFUA 1YMEA 1ARLA 4UEFA 4YWYA 1QQ9A 2PVWA 2PVVA 1XMBA 1CG2A 1YW6A 3D66A 4GM5A 4UF4A 4ZY0A 5FSVA 3K9TA 6CPAA 1HDQA 2PIZA 2WZNA 4OC1A 1F57A 1SPVA 3LWUA 4MCQA 1Y0YA 2PJ7A 4P45A 3WT4A 4JLLA 2AFOA 4EFDA 2XEIA 3S9NA 4NGQA 1CX8A 1TXZA 4JCAA 3VFQA 1Q7LA 2PJ3A 1LANA 3VATA 2ZEDA 4ESSA 3EWPA 4W9YA 3SI0A 3V38A 2PRQA 3PFOA 3S9LA 1NJRA 4P4IA 2AFXA 1QMUA 3ISZA 3B3SA 1CBXA 4ETKA 2I3CA 1XJOA 2CTCA 4MHNA 2PJ2A 3BI1A 3GB0A 3PB9X 4P44A 3GQOA 4UIAA 4EMEA 1TKFA 4A38A 1BPMA 2GREA 5DS0A 5D8NA 2JBJA 2ZEFA 4PXEA 5I4MA 2C6PA 3FMCA 4OC2A 2RB7A 3TC8A 7CPAA 3NH4A 3ISXA 5JM6A 3CT9A 1H8LA 3KZWA 4PXBA 3KASA 1BAVA 2C1CA 2NSMA 2HB6A 2ZEOA 2CIJA 5AILA 3PB6X 5LRJA 3SIIA 5ELYA 3PFEA 4A37A 2AFZA 2IMOA 4MHYA 3CDXA 2PE3A 5D29A 1TF9A 1RTQA 1ELMP 5IB9A 4PQAA 4X8IA 2XD7A 5F09A 1ARMA 1PCAA 2CTBA 3IO1A 4NGPA 3N5FA 3V7ZA 1Z8LA 2BFRA 2AFSA 2C6CA 5CPAA 1YW4A 2JEWA 3BI0A 4P10A 2CF4A 1VHEA 4F9VA 4F8ZA 2O53A 3B2YA 4R6TA 5CB3A 3FH4A 4J4ZA 3SIJA 3SJEA 1HDUA 4DUKA 1FT7A 4ABLA 1LAPA 3VH9A 5JGFA 2ZOGA 4NGTA 3D7DA 4TU0A 3MN8A 2AFWA 4KYBA 3IIDA 2GLJA 2XEGA 2EEEA 4H2KA 1TXRA 4ZX8A 1HJZA 4ZY2A 4AXVA 1LAMA 4PXDA 3NA6A 4FWUA 1XBUA 3I1UA 4MMOA 4NGNA 1XRYA 3NFZA 2ACFA 4TWEA 5LRGA 5LYDA 3PBEA 5HVGA 4JYWA 3LMSA 2EK8A 2X47A 3NH5A 4PXCA 4KSIA 5K8NA 3EJGA 2ABZA 1CPXA 4NGSA 3JRUA 2FG1A 3QNVA 5K8PA 3KL9A 2EK9A 3IWWA 4WWVA 4ZY1A 1EE3P 3WC6A 4P4JA 3WC7A 2O4HA 3S9MA 5LYLA 3T8WA 1IY7A 2DX6A 2BO9A 5CBMA 4MCSA 4BD9A 8CPAA 4J5RA 4UIBA 4ETJA 2GU2A 5K8MA 4FAIA 4IAVA 3SJXA 3KR4A 3PRTA 2POKA 2V77A 3FVLA 4P4DA 2L8RA 1Z2LA 4A39A 1IGBA 4GVVA 2PJ1A 4G1PA 2PJBA 3FJUA 2EWBA 3EWOA 1AYEA 2V8DA 4NJQA 4GUAA 4B6ZA 2QJ8A 3FEDA 4OC3A 3D4UA 2F7VA 3SIGA 3D7GA 5FSZA 1DTDA 1LFWA 2ZELA 2FAVA 4F9UA 3VARA 4X3RA 1HEEA 3PEIA 1ZG7A 4EWTA 2IJZA 4ZX9A 5HIHA 3V45A 3GLJA 5LYIA 1GYTA 4MCPA 3B3WA 2ANPA 2HC9A 2BOAA 3DLJA 3KHXA 1F2OA 4P6YA 4O23A 3CPXA 1CPSA 3JZTA 2PCUA 4P4BA 2DEAA 4NGRA 1ZG9A 2G9DA 4YU9A 3IJ3A 2JBKA 2NYQA 4JVVA 3D7HA 2ZEPA 3D67A 5HXDA 1VIXA 3IIFA 5THWA 2PJCA 3Q71A 4R8FA 2PJAA 4OMEA 2LGRA 2ZENA 1NSAA 5J1QA 2BCOA 5FSXA 5DUSA 1JQGA 2ZEEA 3FEEA 3FECA 4Z65A 3IFEA 2VRIA 1ZR5A 4K0CA 4R76A 2RFHA 4UMLA 1R43A 1OBRA 2FXKA 2PJ0A 3KGQA 4MHZA 4J5SA 4P4FA 2PJ4A 1BPNA 2GLFA 3EWRA 3B3VA 3BXMA 1LOKA 3NH8A 4RUHA 1Y0RA 3SJGA 3CPAA 4JZ0A 3Q6ZA 3FF3A 3B35A 1Y7EA 2J9AA 5FSUA 4MCRA 3D68A 3EKEA 4CPAA 1TKJA 2QYVA 4OC5A 2PJ6A 4ZI6A 1R3NA 1PYTB 3BHXA 5LYFA 4IQYA 3TX8A 4J5QA 4GVWA 2FVGA 1VHOA 2XEFA 2Q4ZA 1Z5RA 3EJFA 4D86A 3SI1A 1YSJA 4Q7AA 4UEZA 4OKOA 4R7MA 2Q43A 4FUUA 3DGVA 4P4EA 4MRIA 1XFOA 5CMSA 1TKHA 5HOLA 4NGMA 5HVFA 3SIHA 2PIYA 4OC0A 1ZLHA 4OP4A 3KHZA 5HVHA 3KI9A 4MXUA 4OC4A 3KQZA 1LCPA 3H8FA 3B3TA 5LRKA 3PB7X 2XEJA 2ZEMA 2F8HA 1ZG8A 4ZYQA 2OOTA 1UWYA 1BLLE 4ABKA 3RAMA 2ZOFA 3B7IA 3GPGA 4LQGA 5JH9A 5K8OA 3PBBA 3WABA 4K3NA 1ZR3A 2BFQA 2AFMA 3GPOA 4PPZA 5FSYA 1ELLP 1KWMA 2WYRA 2ZEGA 3ETIA 1YLOA 2Q51A 4JGKA 1F2PA 4MHPA 3K2KA 3PB8X 2V8HA 2V8VA 5CB5A 4DJLA 2OR4A 3B3CA 4TNUA 3EW5A 3RZAA 3WC5A 4NFRA 4NJRA 4OIDA 3IEHA 3PB4X 4DYOA
chains in the Genus database with same CATH superfamily
3K9UA 4C2YA 3GQEA 4WJBA 3G8WA 1X10A 2C6GA 4MHDA 3HLPA 4QC6A 3T9YA 3KQXA 3HUVA 2ZEHA 2G3TA 1TF8A 4OIWA 2P0WA 3R9FA 2CNSA 3H8GA 1AMPA 1CP6A 1DE4C 5EBVA 2IQ6A 5FVJA 3RNZA 4ORFA 3V2BA 2QVPA 4IK2A 3GYAA 3L2NA 2ARHA 4RI1A 1P4NA 3D7FA 3GPQA 3D2MA 1K4JA 1X12A 1VHUA 2AFCA 3H5ZA 4M6IA 1PUAA 5H84A 2PSWA 2G3AA 1ZLIA 4ONWA 4FBEA 5AG4A 2Z3LA 3SJFA 2KCWA 2B58A 1M4LA 1CP7A 3EY5A 3IIBA 2HUZA 3MRUA 4L89A 4E8OA 4KSFA 5EC4A 3FX6A 2B3VA 3IC1A 1VGYA 3EWQA 3DR6A 5E3BA 2O28A 2PJ9A 4BMHA 5HMNA 2QECA 3TO6A 1PU9A 2GE3A 4MJ8A 2VXKA 3H8EA 4UBRA 3S6FA 2PJ5A 4IHMA 4UWJA 4NCZA 1Z8XA 3KR5A 4A2ZA 1TY8A 1Q2CA 2AE6A 1QSTA 1FNOA 2PJ8A 2R8VA 2BSWA 2VL1A 2PC1A 2IL4A 1XOVA 1YD9A 3SI2A 4X2TA 3GUXA 2V8GA 4UEEA 2JZFA 2I79A 2I00A 4I49A 2W2GA 3RBUA 4A94A 1QSNA 2A4NA 2AFUA 1YMEA 1ARLA 2Q0YA 1MJ9A 3H4QA 2FE7A 4H6UA 4UEFA 3FXTA 3EC4A 4YWYA 1QQ9A 2GIVA 3EO4A 1I21A 1ON0A 2PVWA 2CNTA 2PVVA 1XMBA 1CG2A 1YW6A 3D66A 2FSRA 4GM5A 4UF4A 4ZY0A 5FSVA 4UFVA 4E0AA 1XIXA 3VWEA 3K9TA 3R9GA 4IF5A 1HDQA 2PIZA 6CPAA 4OADA 2WZNA 4XPLA 4OC1A 2VBQA 1F57A 1SPVA 2FIAA 3LWUA 4MCQA 5KTAA 1Y0YA 2PJ7A 4P45A 3WT4A 4JLLA 4C7IA 1YLEA 4KVME 2ZW5A 2AFOA 2PDOA 4CAXA 4EFDA 1KUVA 1IOIA 1IIDA 1MJAA 2XEIA 3S9NA 2Z3PA 4NGQA 1CX8A 1TXZA 3PZJA 3TO7A 4JCAA 3VFQA 1Q7LA 2B4DB 3IU1A 2PJ3A 1LANA 2Z0ZA 4C2XA 2BL1A 3VATA 1I12A 2ZEDA 4ESSA 4AB7A 4MY3A 3EWPA 4W9YA 1YREA 4XPDB 3SI0A 4AVAA 3V38A 4H89A 2PRQA 3PFOA 3S9LA 1NJRA 4MBUA 4P4IA 3DSBA 2AFXA 3FB3A 4C7HA 5HVGA 2FL4A 4II9A 1QMUA 3ISZA 3B3SA 1CBXA 4M3SA 5KTDA 4ETKA 2I3CA 1XJOA 3CXSA 2CTCA 3FBUA 4PSXA 2DPTA 4M6GA 3RYOA 3RO0A 4CGPA 4MHNA 3CZXA 2PJ2A 3BI1A 3GB0A 3PB9X 2REEA 4P44A 3GQOA 3BLNA 2PR1A 4RN7A 4UIAA 4EMEA 2FCKA 1TKFA 4A38A 2NMTA 4XNHB 2OH1A 4C2ZA 1BPMA 2JEVA 2GREA 5DS0A 3V8IA 5ISVA 3PB4X 5D8NA 2JBJA 2ZEFA 4YRHA 4PXEA 3TFYA 5I4MA 2C6PA 3FMCA 1OZPA 4UA3A 4OC2A 2RB7A 3TC8A 4CGLA 4DNCA 3NH4A 7CPAA 2WSAA 3ISXA 5JM6A 2P6GA 3CT9A 4B5PA 1H8LA 2PQ8A 4CGOA 4CYOA 3KZWA 1YGHA 3FRMA 4PXBA 3KASA 5F09A 1BAVA 2C1CA 2NSMA 4MFLA 3WR7A 1NMTA 3IU2A 2HB6A 2ZEOA 2CIJA 2Z3MA 5AILA 5IX3A 3PB6X 5LRJA 3SIIA 5ELYA 5G21A 3PFEA 4A37A 3JTKA 1IYLA 3P2HA 2AFZA 4GXHA 2IMOA 3ZJ0A 4MHYA 1YX0A 3CDXA 4F6AA 1Z8TA 2PE3A 4U5YA 3LD2A 5D29A 4H6ZA 1B6BA 1TF9A 4BBHA 1RTQA 1ELMP 2D4PA 2Q44A 5IB9A 4PQAA 4X8IA 2XD7A 4U9YA 1ARMA 1PCAA 2CTBA 3IO1A 3DR8A 3NE8A 3GIUA 4LUAA 4NGPA 5E96A 4K30A 2WPWA 3LACA 3N5FA 3V7ZA 1Z8LA 2JZDA 2BFRA 2AFSA 2C6CA 5CPAA 1YW4A 1WWZA 2OB0A 1U6MA 2ODFA 4M85A 2ATRA 2JEWA 2QMLA 3BI0A 4P10A 2CF4A 1VHEA 4F9VA 4F8ZA 2O53A 3FYNA 1IYKA 3B2YA 4R6TA 5CB3A 3FH4A 1M44A 4J3GA 4KLVA 4AVBA 4J4ZA 4MFKA 4YFJA 3SIJA 4OAEA 3SJEA 1HDUA 2PRBA 3D3SA 2DF5A 4DUKA 1FT7A 4ABLA 3TE4A 2FS5A 1LAPA 4RS2A 3EFAA 3I9SA 3VH9A 5JGFA 2ZOGA 4NGTA 2FXFA 4TU0A 3D7DA 3W6SA 3MN8A 2AFWA 1WK4A 1M4DA 4KYBA 3IIDA 2GLJA 2XEGA 2EEEA 4H2KA 3NE7A 1JWQA 2H5MA 3E0KA 2GANA 4U9ZA 1TXRA 4ZX8A 1HJZA 4ZY2A 2GFQA 2VI7A 4AXVA 1LAMA 4PXDA 4UWIA 3NA6A 4FWUA 4FD4A 1XBUA 1Y9WA 2ZW4A 3I1UA 4MMOA 4NGNA 1XRYA 2VZZA 3NFZA 2ACFA 4TWEA 3CXQA 5LRGA 3PBEA 5LYDA 5AG7A 5AG5A 4JYWA 2CY2A 3LMSA 5BWAB 2EK8A 3P2FA 3N7ZA 2X47A 3C26A 3NH5A 4PXCA 4KSIA 5K8NA 3JUWA 3MGDA 3EJGA 4CAVA 2ABZA 4AG9A 4ONUA 1CPXA 4JWPA 3JRUA 4NGSA 4B11A 1S7NA 1S7LA 1UFHA 2FG1A 3QNVA 5K8PA 3BJ8A 3KL9A 2EK9A 2Z10A 3PGPA 1Z4EA 3IWWA 4WWVA 4ZY1A 2YNCC 1YR0A 1EE3P 3WC6A 4P4JA 3WC7A 2O4HA 2Q4YA 3S9MA 2JDDA 5C88A 5LYLA 3T8WA 1IY7A 2DX6A 2BO9A 4B12A 5CBMA 4MCSA 4PSWA 4BD9A 4J5RA 8CPAA 4MFJA 1P0HA 4ETJA 4KSAA 4UIBA 2CNMA 2GU2A 3UY5A 4IAVA 3SJXA 4FAIA 1XMTA 3KR4A 2FIWA 3PRTA 5A28A 2POKA 1VHSA 3F0AA 2V77A 2YNEA 3D8PA 3FVLA 4AG7A 4P4DA 2L8RA 4CYQA 1Z2LA 4A39A 1IGBA 2Z3OA 4GVVA 2PJ1A 3LODA 2PJBA 4G1PA 4A33A 3FJUA 4E2AA 1QSRA 2YNDA 4KOUA 2EWBA 3EWOA 1AYEA 2V8DA 3F8KA 4GUAA 3I3GA 1LRZA 2QJ8A 1CM0A 3FEDA 4NJQA 4OC3A 5GCNA 4B6ZA 4R3KA 2EUIA 1M4GA 3D4UA 3VWDA 1J4JA 1N71A 4NXYA 4LQ6A 4KVOE 5F49A 5G22A 2F7VA 1CJWA 3SIGA 3D7GA 3FNCA 4UFWA 5FSZA 1DTDA 3W91A 1TIQA 2B5GB 4UCMA 4PK2A 4FD7A 1LFWA 2ZELA 2FAVA 4F9UA 3VARA 4ZGYB 4X3RA 1Y7RA 1HEEA 3PEIA 1ZG7A 4EWTA 2PR8A 2IJZA 2VQYA 5H86A 4ZX9A 5HIHA 3V45A 1IU8A 3GLJA 5LYIA 3R95A 1GYTA 4MCPA 2C27A 3B3WA 2ZPAA 2J8MA 1YVKA 2ANPA 4CRZB 5J8CA 5G20A 2BEIA 5C82A 2G0BA 4R3LA 2HC9A 4UFXA 2DXQA 2BOAA 3DLJA 3KHXA 3F5BA 3IGRA 1F2OA 4OLLA 5DWNA 4P6YA 3SXOA 4B5PB 4O23A 3CPXA 3ZZIA 4R57A 2ZW6A 1CPSA 5CNPA 2JLMA 1A2ZA 2J8RA 4CAEA 1MJBA 2YGWA 3JZTA 2PCUA 5DWMA 2B4BA 4CRYB 4FD5A 4P4BA 2Z3NA 2DEAA 3D2PA 4A31A 1V0CA 4NGRA 1ZG9A 3JVNA 2G9DA 3DNSA 4YU9A 4CAWA 3IJ3A 1S3ZA 2RNKA 2JBKA 2CXAA 4JVVA 2NYQA 4MI4A 3D7HA 1XE4A 4A32A 2ZEPA 3D67A 4QUSA 5HXDA 3QAYA 5JPHA 1NE9A 4XPDC 1VIXA 1M1DA 3IIFA 3TTHA 5THWA 1YVOA 3Q71A 2PJCA 2EVNA 4R8FA 4YGOA 1VKCA 3R96A 2PJAA 4OMEA 2LGRA 2ZENA 1NSAA 5J1QA 1S5KA 2BCOA 5EMIA 5FSXA 5DUSA 3R9EA 1JQGA 2ZEEA 3EXNA 3FEEA 4MFZA 3FECA 4Z65A 3OWCA 3IFEA 2JZEA 2VRIA 1ZR5A 4K0CA 1L0CA 5IB0A 3S6HA 2YNCA 4R76A 4UMLA 2RFHA 1R43A 2F5IA 2Z11A 4KLWA 1OBRA 4KOWA 5A27A 5F46A 2FXKA 2PJ0A 3KGQA 4PK3A 4JXRA 4MHZA 4XNHC 4J5SA 4AVCA 3TO9A 2OU2A 4P4FA 2PJ4A 1BPNA 2GLFA 1YK3A 3EWRA 3GY9A 3B3VA 2Q7SA 2VZYA 4HNWB 4MFQA 2Q7BA 3S6KA 2ZXVA 3BXMA 1LOKA 2OZGA 3NH8A 4RUHA 5AGEA 1BOBA 2EO8A 4A95A 1Y0RA 4M6HA 3SJGA 3CPAA 2WCTA 4JZ0A 3Q6ZA 4B10A 4NF1A 3FF3A 4XPKA 4IUSA 3B35A 1Y7EA 3G3SA 3QB8A 2J9AA 5FSUA 4MCRA 3SHPA 3D68A 3DDDA 3EKEA 1IICA 4CPAA 5HH1A 4X5KA 1M4IA 1TKJA 2BUEA 2FT0A 2QYVA 4KVXA 4OC5A 1I1DA 2PJ6A 4ZI6A 1R3NA 1PYTB 3TOAA 4KS9A 3BHXA 5LYFA 4LX9A 4IQYA 3TX8A 4EVYA 5F48A 1S7FA 1B87A 4J5QA 3TT2A 4GVWA 2FVGA 2Y0MA 1VHOA 5G1ZA 3B8GA 2XEFA 4L8AA 4Q38A 1Q2YA 2HQYA 1Z5RA 2Q4ZA 2Z3KA 3EJFA 4D86A 3SI1A 1YSJA 4QB9A 4FD6A 4Q7AA 4MY0A 4UEZA 4NSQA 1ZO0A 5IV0A 2JDCA 1Z9UA 4R7MA 4OKOA 2RC4A 2Q43A 3SXNA 3TCVA 3R1KA 4Y49B 4FUUA 4B5OA 5JQ4A 3DGVA 4P4EA 1KZFA 4MRIA 1XFOA 4CGNA 5CMSA 1FY7A 1TKHA 5HOLA 4NGMA 4KZTA 4KOXA 1XF8A 4B13A 5HVFA 4F0XA 3SIHA 2PIYA 4CYPA 4CGMA 2J8NA 4A30A 4MFPA 4C68A 4OC0A 1ZLHA 4KOTA 4CAFA 4F0YA 3PP9A 3T90A 1XEBA 2HV2A 4OP4A 3KHZA 3GKRA 5HVHA 1YQEA 2B4DA 1SQHA 2OZUA 3TOBA 2X7BA 4QBJA 4KORA 5J8FA 3KI9A 2Q04A 4MXUA 4OC4A 3KQZA 1LCPA 1Y9KA 2WUUA 4HNYB 4GS4A 1IOFA 2ZW7A 1Q2DA 5F47A 3QAHA 4UCNA 3H8FA 1AUGA 4BINA 5I0CA 1GHEA 1IB1E 4CYNA 3B3TA 5LRKA 4JLYA 1Z4RA 3A9LA 3PB7X 2OZHA 2XEJA 2R1IA 2R98A 3CXPA 1BO4A 2DPSA 4JJXA 3BJ7A 2EBJA 2ZEMA 4R87A 2AJ6A 2F8HA 1KUXA 1ZG8A 4ZYQA 2OOTA 2WPXA 2R7HA 4Q36A 4HNXB 4JXQA 4R9MA 1UWYA 5K8MA 1BLLE 1RO5A 4ABKA 3RAMA 2B5GA 2Q4VA 2ZOFA 2B3UA 3B7IA 3GPGA 4LQGA 5JH9A 4B14A 5K8OA 3PBBA 2QIRA 4NEXA 1R57A 2K5TA 3WABA 4K3NA 4CS0B 4PV6A 3IWEA 2P6EA 1ZR3A 1QSMA 2BFQA 2AFMA 3GPOA 5KTCA 4HKFA 1Z8WA 4PPZA 5FSYA 1ELLP 4Y49C 2P6FA 4KOVA 1KWMA 2KQVA 2WYRA 1MK4A 2ZEGA 1S60A 3ETIA 1YLOA 2VEZA 2Q51A 4JGKA 1F2PA 1QSOA 3IWGA 3K2KA 3KKWA 4MHPA 1KUYA 3PB8X 4ZBGA 3S6GA 4QVTA 2V8HA 3W6XA 2V8VA 5CB5A 4DJLA 2OR4A 4KOSA 4KUAA 3B3CA 4HPSA 4TNUA 2D4OA 3EW5A 3RZAA 3WC5A 1RXTA 4JD6A 4NFRA 4KUBA 4NJRA 4KOYA 1S7KA 2REFA 4UCPA 1NSLA 4OIDA 3FIXA 3IEHA 4DYOA 5AG6A
chains in the Genus database with same CATH topology
3GQEA 4WJBA 2C6GA 3HLPA 3KQXA 3HUVA 2ZEHA 1TF8A 4OIWA 3H8GA 1AMPA 1CP6A 1DE4C 2IQ6A 3V2BA 2QVPA 4IK2A 3L2NA 3D7FA 3GPQA 1VHUA 2AFCA 4FBEA 1ZLIA 4ONWA 3SJFA 3MRUA 3IIBA 1M4LA 1CP7A 3FX6A 3IC1A 1VGYA 3EWQA 5E3BA 2PJ9A 3H8EA 2PJ5A 4IHMA 3KR5A 1TY8A 1FNOA 2PJ8A 2VL1A 1YD9A 3SI2A 4X2TA 3GUXA 2V8GA 4UEEA 3RBUA 4A94A 2AFUA 1YMEA 1ARLA 4UEFA 4YWYA 1QQ9A 2PVWA 2PVVA 1XMBA 1CG2A 1YW6A 3D66A 4GM5A 4UF4A 4ZY0A 5FSVA 3K9TA 6CPAA 1HDQA 2PIZA 2WZNA 4OC1A 1F57A 1SPVA 3LWUA 4MCQA 1Y0YA 2PJ7A 4P45A 3WT4A 4JLLA 2AFOA 4EFDA 2XEIA 3S9NA 4NGQA 1CX8A 1TXZA 4JCAA 3VFQA 1Q7LA 2PJ3A 1LANA 3VATA 2ZEDA 4ESSA 3EWPA 4W9YA 3SI0A 3V38A 2PRQA 3PFOA 3S9LA 1NJRA 4P4IA 2AFXA 1QMUA 3ISZA 3B3SA 1CBXA 4ETKA 2I3CA 1XJOA 2CTCA 4MHNA 2PJ2A 3BI1A 3GB0A 3PB9X 4P44A 3GQOA 4UIAA 4EMEA 1TKFA 4A38A 1BPMA 2GREA 5DS0A 5D8NA 2JBJA 2ZEFA 4PXEA 5I4MA 2C6PA 3FMCA 4OC2A 2RB7A 3TC8A 7CPAA 3NH4A 3ISXA 5JM6A 3CT9A 1H8LA 3KZWA 4PXBA 3KASA 1BAVA 2C1CA 2NSMA 2HB6A 2ZEOA 2CIJA 5AILA 3PB6X 5LRJA 3SIIA 5ELYA 3PFEA 4A37A 2AFZA 2IMOA 4MHYA 3CDXA 2PE3A 5D29A 1TF9A 1RTQA 1ELMP 5IB9A 4PQAA 4X8IA 2XD7A 5F09A 1ARMA 1PCAA 2CTBA 3IO1A 4NGPA 3N5FA 3V7ZA 1Z8LA 2BFRA 2AFSA 2C6CA 5CPAA 1YW4A 2JEWA 3BI0A 4P10A 2CF4A 1VHEA 4F9VA 4F8ZA 2O53A 3B2YA 4R6TA 5CB3A 3FH4A 4J4ZA 3SIJA 3SJEA 1HDUA 4DUKA 1FT7A 4ABLA 1LAPA 3VH9A 5JGFA 2ZOGA 4NGTA 3D7DA 4TU0A 3MN8A 2AFWA 4KYBA 3IIDA 2GLJA 2XEGA 2EEEA 4H2KA 1TXRA 4ZX8A 1HJZA 4ZY2A 4AXVA 1LAMA 4PXDA 3NA6A 4FWUA 1XBUA 3I1UA 4MMOA 4NGNA 1XRYA 3NFZA 2ACFA 4TWEA 5LRGA 5LYDA 3PBEA 5HVGA 4JYWA 3LMSA 2EK8A 2X47A 3NH5A 4PXCA 4KSIA 5K8NA 3EJGA 2ABZA 1CPXA 4NGSA 3JRUA 2FG1A 3QNVA 5K8PA 3KL9A 2EK9A 3IWWA 4WWVA 4ZY1A 1EE3P 3WC6A 4P4JA 3WC7A 2O4HA 3S9MA 5LYLA 3T8WA 1IY7A 2DX6A 2BO9A 5CBMA 4MCSA 4BD9A 8CPAA 4J5RA 4UIBA 4ETJA 2GU2A 5K8MA 4FAIA 4IAVA 3SJXA 3KR4A 3PRTA 2POKA 2V77A 3FVLA 4P4DA 2L8RA 1Z2LA 4A39A 1IGBA 4GVVA 2PJ1A 4G1PA 2PJBA 3FJUA 2EWBA 3EWOA 1AYEA 2V8DA 4NJQA 4GUAA 4B6ZA 2QJ8A 3FEDA 4OC3A 3D4UA 2F7VA 3SIGA 3D7GA 5FSZA 1DTDA 1LFWA 2ZELA 2FAVA 4F9UA 3VARA 4X3RA 1HEEA 3PEIA 1ZG7A 4EWTA 2IJZA 4ZX9A 5HIHA 3V45A 3GLJA 5LYIA 1GYTA 4MCPA 3B3WA 2ANPA 2HC9A 2BOAA 3DLJA 3KHXA 1F2OA 4P6YA 4O23A 3CPXA 1CPSA 3JZTA 2PCUA 4P4BA 2DEAA 4NGRA 1ZG9A 2G9DA 4YU9A 3IJ3A 2JBKA 2NYQA 4JVVA 3D7HA 2ZEPA 3D67A 5HXDA 1VIXA 3IIFA 5THWA 2PJCA 3Q71A 4R8FA 2PJAA 4OMEA 2LGRA 2ZENA 1NSAA 5J1QA 2BCOA 5FSXA 5DUSA 1JQGA 2ZEEA 3FEEA 3FECA 4Z65A 3IFEA 2VRIA 1ZR5A 4K0CA 4R76A 2RFHA 4UMLA 1R43A 1OBRA 2FXKA 2PJ0A 3KGQA 4MHZA 4J5SA 4P4FA 2PJ4A 1BPNA 2GLFA 3EWRA 3B3VA 3BXMA 1LOKA 3NH8A 4RUHA 1Y0RA 3SJGA 3CPAA 4JZ0A 3Q6ZA 3FF3A 3B35A 1Y7EA 2J9AA 5FSUA 4MCRA 3D68A 3EKEA 4CPAA 1TKJA 2QYVA 4OC5A 2PJ6A 4ZI6A 1R3NA 1PYTB 3BHXA 5LYFA 4IQYA 3TX8A 4J5QA 4GVWA 2FVGA 1VHOA 2XEFA 2Q4ZA 1Z5RA 3EJFA 4D86A 3SI1A 1YSJA 4Q7AA 4UEZA 4OKOA 4R7MA 2Q43A 4FUUA 3DGVA 4P4EA 4MRIA 1XFOA 5CMSA 1TKHA 5HOLA 4NGMA 5HVFA 3SIHA 2PIYA 4OC0A 1ZLHA 4OP4A 3KHZA 5HVHA 3KI9A 4MXUA 4OC4A 3KQZA 1LCPA 3H8FA 3B3TA 5LRKA 3PB7X 2XEJA 2ZEMA 2F8HA 1ZG8A 4ZYQA 2OOTA 1UWYA 1BLLE 4ABKA 3RAMA 2ZOFA 3B7IA 3GPGA 4LQGA 5JH9A 5K8OA 3PBBA 3WABA 4K3NA 1ZR3A 2BFQA 2AFMA 3GPOA 4PPZA 5FSYA 1ELLP 1KWMA 2WYRA 2ZEGA 3ETIA 1YLOA 2Q51A 4JGKA 1F2PA 4MHPA 3K2KA 3PB8X 2V8HA 2V8VA 5CB5A 4DJLA 2OR4A 3B3CA 4TNUA 3EW5A 3RZAA 3WC5A 4NFRA 4NJRA 4OIDA 3IEHA 3PB4X 4DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQE A;  4WJB A;  2C6G A;  3HLP A;  3KQX A;  3HUV A;  2ZEH A;  1TF8 A;  4OIW A;  3H8G A;  1AMP A;  1CP6 A;  1DE4 C;  2IQ6 A;  3V2B A;  2QVP A;  4IK2 A;  3L2N A;  3D7F A;  3GPQ A;  1VHU A;  2AFC A;  4FBE A;  1ZLI A;  4ONW A;  3SJF A;  3MRU A;  3IIB A;  1M4L A;  1CP7 A;  3FX6 A;  3IC1 A;  1VGY A;  3EWQ A;  5E3B A;  2PJ9 A;  3H8E A;  2PJ5 A;  4IHM A;  3KR5 A;  1TY8 A;  1FNO A;  2PJ8 A;  2VL1 A;  1YD9 A;  3SI2 A;  4X2T A;  3GUX A;  2V8G A;  4UEE A;  3RBU A;  4A94 A;  2AFU A;  1YME A;  1ARL A;  4UEF A;  4YWY A;  1QQ9 A;  2PVW A;  2PVV A;  1XMB A;  1CG2 A;  1YW6 A;  3D66 A;  4GM5 A;  4UF4 A;  4ZY0 A;  5FSV A;  3K9T A;  6CPA A;  1HDQ A;  2PIZ A;  2WZN A;  4OC1 A;  1F57 A;  1SPV A;  3LWU A;  4MCQ A;  1Y0Y A;  2PJ7 A;  4P45 A;  3WT4 A;  4JLL A;  2AFO A;  4EFD A;  2XEI A;  3S9N A;  4NGQ A;  1CX8 A;  1TXZ A;  4JCA A;  3VFQ A;  1Q7L A;  2PJ3 A;  1LAN A;  3VAT A;  2ZED A;  4ESS A;  3EWP A;  4W9Y A;  3SI0 A;  3V38 A;  2PRQ A;  3PFO A;  3S9L A;  1NJR A;  4P4I A;  2AFX A;  1QMU A;  3ISZ A;  3B3S A;  1CBX A;  4ETK A;  2I3C A;  1XJO A;  2CTC A;  4MHN A;  2PJ2 A;  3BI1 A;  3GB0 A;  3PB9 X;  4P44 A;  3GQO A;  4UIA A;  4EME A;  1TKF A;  4A38 A;  1BPM A;  2GRE A;  5DS0 A;  5D8N A;  2JBJ A;  2ZEF A;  4PXE A;  5I4M A;  2C6P A;  3FMC A;  4OC2 A;  2RB7 A;  3TC8 A;  7CPA A;  3NH4 A;  3ISX A;  5JM6 A;  3CT9 A;  1H8L A;  3KZW A;  4PXB A;  3KAS A;  1BAV A;  2C1C A;  2NSM A;  2HB6 A;  2ZEO A;  2CIJ A;  5AIL A;  3PB6 X;  5LRJ A;  3SII A;  5ELY A;  3PFE A;  4A37 A;  2AFZ A;  2IMO A;  4MHY A;  3CDX A;  2PE3 A;  5D29 A;  1TF9 A;  1RTQ A;  1ELM P;  5IB9 A;  4PQA A;  4X8I A;  2XD7 A;  5F09 A;  1ARM A;  1PCA A;  2CTB A;  3IO1 A;  4NGP A;  3N5F A;  3V7Z A;  1Z8L A;  2BFR A;  2AFS A;  2C6C A;  5CPA A;  1YW4 A;  2JEW A;  3BI0 A;  4P10 A;  2CF4 A;  1VHE A;  4F9V A;  4F8Z A;  2O53 A;  3B2Y A;  4R6T A;  5CB3 A;  3FH4 A;  4J4Z A;  3SIJ A;  3SJE A;  1HDU A;  4DUK A;  1FT7 A;  4ABL A;  1LAP A;  3VH9 A;  5JGF A;  2ZOG A;  4NGT A;  3D7D A;  4TU0 A;  3MN8 A;  2AFW A;  4KYB A;  3IID A;  2GLJ A;  2XEG A;  2EEE A;  4H2K A;  1TXR A;  4ZX8 A;  1HJZ A;  4ZY2 A;  4AXV A;  1LAM A;  4PXD A;  3NA6 A;  4FWU A;  1XBU A;  3I1U A;  4MMO A;  4NGN A;  1XRY A;  3NFZ A;  2ACF A;  4TWE A;  5LRG A;  5LYD A;  3PBE A;  5HVG A;  4JYW A;  3LMS A;  2EK8 A;  2X47 A;  3NH5 A;  4PXC A;  4KSI A;  5K8N A;  3EJG A;  2ABZ A;  1CPX A;  4NGS A;  3JRU A;  2FG1 A;  3QNV A;  5K8P A;  3KL9 A;  2EK9 A;  3IWW A;  4WWV A;  4ZY1 A;  1EE3 P;  3WC6 A;  4P4J A;  3WC7 A;  2O4H A;  3S9M A;  5LYL A;  3T8W A;  1IY7 A;  2DX6 A;  2BO9 A;  5CBM A;  4MCS A;  4BD9 A;  8CPA A;  4J5R A;  4UIB A;  4ETJ A;  2GU2 A;  5K8M A;  4FAI A;  4IAV A;  3SJX A;  3KR4 A;  3PRT A;  2POK A;  2V77 A;  3FVL A;  4P4D A;  2L8R A;  1Z2L A;  4A39 A;  1IGB A;  4GVV A;  2PJ1 A;  4G1P A;  2PJB A;  3FJU A;  2EWB A;  3EWO A;  1AYE A;  2V8D A;  4NJQ A;  4GUA A;  4B6Z A;  2QJ8 A;  3FED A;  4OC3 A;  3D4U A;  2F7V A;  3SIG A;  3D7G A;  5FSZ A;  1DTD A;  1LFW A;  2ZEL A;  2FAV A;  4F9U A;  3VAR A;  4X3R A;  1HEE A;  3PEI A;  1ZG7 A;  4EWT A;  2IJZ A;  4ZX9 A;  5HIH A;  3V45 A;  3GLJ A;  5LYI A;  1GYT A;  4MCP A;  3B3W A;  2ANP A;  2HC9 A;  2BOA A;  3DLJ A;  3KHX A;  1F2O A;  4P6Y A;  4O23 A;  3CPX A;  1CPS A;  3JZT A;  2PCU A;  4P4B A;  2DEA A;  4NGR A;  1ZG9 A;  2G9D A;  4YU9 A;  3IJ3 A;  2JBK A;  2NYQ A;  4JVV A;  3D7H A;  2ZEP A;  3D67 A;  5HXD A;  1VIX A;  3IIF A;  5THW A;  2PJC A;  3Q71 A;  4R8F A;  2PJA A;  4OME A;  2LGR A;  2ZEN A;  1NSA A;  5J1Q A;  2BCO A;  5FSX A;  5DUS A;  1JQG A;  2ZEE A;  3FEE A;  3FEC A;  4Z65 A;  3IFE A;  2VRI A;  1ZR5 A;  4K0C A;  4R76 A;  2RFH A;  4UML A;  1R43 A;  1OBR A;  2FXK A;  2PJ0 A;  3KGQ A;  4MHZ A;  4J5S A;  4P4F A;  2PJ4 A;  1BPN A;  2GLF A;  3EWR A;  3B3V A;  3BXM A;  1LOK A;  3NH8 A;  4RUH A;  1Y0R A;  3SJG A;  3CPA A;  4JZ0 A;  3Q6Z A;  3FF3 A;  3B35 A;  1Y7E A;  2J9A A;  5FSU A;  4MCR A;  3D68 A;  3EKE A;  4CPA A;  1TKJ A;  2QYV A;  4OC5 A;  2PJ6 A;  4ZI6 A;  1R3N A;  1PYT B;  3BHX A;  5LYF A;  4IQY A;  3TX8 A;  4J5Q A;  4GVW A;  2FVG A;  1VHO A;  2XEF A;  2Q4Z A;  1Z5R A;  3EJF A;  4D86 A;  3SI1 A;  1YSJ A;  4Q7A A;  4UEZ A;  4OKO A;  4R7M A;  2Q43 A;  4FUU A;  3DGV A;  4P4E A;  4MRI A;  1XFO A;  5CMS A;  1TKH A;  5HOL A;  4NGM A;  5HVF A;  3SIH A;  2PIY A;  4OC0 A;  1ZLH A;  4OP4 A;  3KHZ A;  5HVH A;  3KI9 A;  4MXU A;  4OC4 A;  3KQZ A;  1LCP A;  3H8F A;  3B3T A;  5LRK A;  3PB7 X;  2XEJ A;  2ZEM A;  2F8H A;  1ZG8 A;  4ZYQ A;  2OOT A;  1UWY A;  1BLL E;  4ABK A;  3RAM A;  2ZOF A;  3B7I A;  3GPG A;  4LQG A;  5JH9 A;  5K8O A;  3PBB A;  3WAB A;  4K3N A;  1ZR3 A;  2BFQ A;  2AFM A;  3GPO A;  4PPZ A;  5FSY A;  1ELL P;  1KWM A;  2WYR A;  2ZEG A;  3ETI A;  1YLO A;  2Q51 A;  4JGK A;  1F2P A;  4MHP A;  3K2K A;  3PB8 X;  2V8H A;  2V8V A;  5CB5 A;  4DJL A;  2OR4 A;  3B3C A;  4TNU A;  3EW5 A;  3RZA A;  3WC5 A;  4NFR A;  4NJR A;  4OID A;  3IEH A;  3PB4 X;  4DYO A; 
#chains in the Genus database with same CATH topology
 3K9U A;  4C2Y A;  3GQE A;  4WJB A;  3G8W A;  1X10 A;  2C6G A;  4MHD A;  3HLP A;  4QC6 A;  3T9Y A;  3KQX A;  3HUV A;  2ZEH A;  2G3T A;  1TF8 A;  4OIW A;  2P0W A;  3R9F A;  2CNS A;  3H8G A;  1AMP A;  1CP6 A;  1DE4 C;  5EBV A;  2IQ6 A;  5FVJ A;  3RNZ A;  4ORF A;  3V2B A;  2QVP A;  4IK2 A;  3GYA A;  3L2N A;  2ARH A;  4RI1 A;  1P4N A;  3D7F A;  3GPQ A;  3D2M A;  1K4J A;  1X12 A;  1VHU A;  2AFC A;  3H5Z A;  4M6I A;  1PUA A;  5H84 A;  2PSW A;  2G3A A;  1ZLI A;  4ONW A;  4FBE A;  5AG4 A;  2Z3L A;  3SJF A;  2KCW A;  2B58 A;  1M4L A;  1CP7 A;  3EY5 A;  3IIB A;  2HUZ A;  3MRU A;  4L89 A;  4E8O A;  4KSF A;  5EC4 A;  3FX6 A;  2B3V A;  3IC1 A;  1VGY A;  3EWQ A;  3DR6 A;  5E3B A;  2O28 A;  2PJ9 A;  4BMH A;  5HMN A;  2QEC A;  3TO6 A;  1PU9 A;  2GE3 A;  4MJ8 A;  2VXK A;  3H8E A;  4UBR A;  3S6F A;  2PJ5 A;  4IHM A;  4UWJ A;  4NCZ A;  1Z8X A;  3KR5 A;  4A2Z A;  1TY8 A;  1Q2C A;  2AE6 A;  1QST A;  1FNO A;  2PJ8 A;  2R8V A;  2BSW A;  2VL1 A;  2PC1 A;  2IL4 A;  1XOV A;  1YD9 A;  3SI2 A;  4X2T A;  3GUX A;  2V8G A;  4UEE A;  2JZF A;  2I79 A;  2I00 A;  4I49 A;  2W2G A;  3RBU A;  4A94 A;  1QSN A;  2A4N A;  2AFU A;  1YME A;  1ARL A;  2Q0Y A;  1MJ9 A;  3H4Q A;  2FE7 A;  4H6U A;  4UEF A;  3FXT A;  3EC4 A;  4YWY A;  1QQ9 A;  2GIV A;  3EO4 A;  1I21 A;  1ON0 A;  2PVW A;  2CNT A;  2PVV A;  1XMB A;  1CG2 A;  1YW6 A;  3D66 A;  2FSR A;  4GM5 A;  4UF4 A;  4ZY0 A;  5FSV A;  4UFV A;  4E0A A;  1XIX A;  3VWE A;  3K9T A;  3R9G A;  4IF5 A;  1HDQ A;  2PIZ A;  6CPA A;  4OAD A;  2WZN A;  4XPL A;  4OC1 A;  2VBQ A;  1F57 A;  1SPV A;  2FIA A;  3LWU A;  4MCQ A;  5KTA A;  1Y0Y A;  2PJ7 A;  4P45 A;  3WT4 A;  4JLL A;  4C7I A;  1YLE A;  4KVM E;  2ZW5 A;  2AFO A;  2PDO A;  4CAX A;  4EFD A;  1KUV A;  1IOI A;  1IID A;  1MJA A;  2XEI A;  3S9N A;  2Z3P A;  4NGQ A;  1CX8 A;  1TXZ A;  3PZJ A;  3TO7 A;  4JCA A;  3VFQ A;  1Q7L A;  2B4D B;  3IU1 A;  2PJ3 A;  1LAN A;  2Z0Z A;  4C2X A;  2BL1 A;  3VAT A;  1I12 A;  2ZED A;  4ESS A;  4AB7 A;  4MY3 A;  3EWP A;  4W9Y A;  1YRE A;  4XPD B;  3SI0 A;  4AVA A;  3V38 A;  4H89 A;  2PRQ A;  3PFO A;  3S9L A;  1NJR A;  4MBU A;  4P4I A;  3DSB A;  2AFX A;  3FB3 A;  4C7H A;  5HVG A;  2FL4 A;  4II9 A;  1QMU A;  3ISZ A;  3B3S A;  1CBX A;  4M3S A;  5KTD A;  4ETK A;  2I3C A;  1XJO A;  3CXS A;  2CTC A;  3FBU A;  4PSX A;  2DPT A;  4M6G A;  3RYO A;  3RO0 A;  4CGP A;  4MHN A;  3CZX A;  2PJ2 A;  3BI1 A;  3GB0 A;  3PB9 X;  2REE A;  4P44 A;  3GQO A;  3BLN A;  2PR1 A;  4RN7 A;  4UIA A;  4EME A;  2FCK A;  1TKF A;  4A38 A;  2NMT A;  4XNH B;  2OH1 A;  4C2Z A;  1BPM A;  2JEV A;  2GRE A;  5DS0 A;  3V8I A;  5ISV A;  3PB4 X;  5D8N A;  2JBJ A;  2ZEF A;  4YRH A;  4PXE A;  3TFY A;  5I4M A;  2C6P A;  3FMC A;  1OZP A;  4UA3 A;  4OC2 A;  2RB7 A;  3TC8 A;  4CGL A;  4DNC A;  3NH4 A;  7CPA A;  2WSA A;  3ISX A;  5JM6 A;  2P6G A;  3CT9 A;  4B5P A;  1H8L A;  2PQ8 A;  4CGO A;  4CYO A;  3KZW A;  1YGH A;  3FRM A;  4PXB A;  3KAS A;  5F09 A;  1BAV A;  2C1C A;  2NSM A;  4MFL A;  3WR7 A;  1NMT A;  3IU2 A;  2HB6 A;  2ZEO A;  2CIJ A;  2Z3M A;  5AIL A;  5IX3 A;  3PB6 X;  5LRJ A;  3SII A;  5ELY A;  5G21 A;  3PFE A;  4A37 A;  3JTK A;  1IYL A;  3P2H A;  2AFZ A;  4GXH A;  2IMO A;  3ZJ0 A;  4MHY A;  1YX0 A;  3CDX A;  4F6A A;  1Z8T A;  2PE3 A;  4U5Y A;  3LD2 A;  5D29 A;  4H6Z A;  1B6B A;  1TF9 A;  4BBH A;  1RTQ A;  1ELM P;  2D4P A;  2Q44 A;  5IB9 A;  4PQA A;  4X8I A;  2XD7 A;  4U9Y A;  1ARM A;  1PCA A;  2CTB A;  3IO1 A;  3DR8 A;  3NE8 A;  3GIU A;  4LUA A;  4NGP A;  5E96 A;  4K30 A;  2WPW A;  3LAC A;  3N5F A;  3V7Z A;  1Z8L A;  2JZD A;  2BFR A;  2AFS A;  2C6C A;  5CPA A;  1YW4 A;  1WWZ A;  2OB0 A;  1U6M A;  2ODF A;  4M85 A;  2ATR A;  2JEW A;  2QML A;  3BI0 A;  4P10 A;  2CF4 A;  1VHE A;  4F9V A;  4F8Z A;  2O53 A;  3FYN A;  1IYK A;  3B2Y A;  4R6T A;  5CB3 A;  3FH4 A;  1M44 A;  4J3G A;  4KLV A;  4AVB A;  4J4Z A;  4MFK A;  4YFJ A;  3SIJ A;  4OAE A;  3SJE A;  1HDU A;  2PRB A;  3D3S A;  2DF5 A;  4DUK A;  1FT7 A;  4ABL A;  3TE4 A;  2FS5 A;  1LAP A;  4RS2 A;  3EFA A;  3I9S A;  3VH9 A;  5JGF A;  2ZOG A;  4NGT A;  2FXF A;  4TU0 A;  3D7D A;  3W6S A;  3MN8 A;  2AFW A;  1WK4 A;  1M4D A;  4KYB A;  3IID A;  2GLJ A;  2XEG A;  2EEE A;  4H2K A;  3NE7 A;  1JWQ A;  2H5M A;  3E0K A;  2GAN A;  4U9Z A;  1TXR A;  4ZX8 A;  1HJZ A;  4ZY2 A;  2GFQ A;  2VI7 A;  4AXV A;  1LAM A;  4PXD A;  4UWI A;  3NA6 A;  4FWU A;  4FD4 A;  1XBU A;  1Y9W A;  2ZW4 A;  3I1U A;  4MMO A;  4NGN A;  1XRY A;  2VZZ A;  3NFZ A;  2ACF A;  4TWE A;  3CXQ A;  5LRG A;  3PBE A;  5LYD A;  5AG7 A;  5AG5 A;  4JYW A;  2CY2 A;  3LMS A;  5BWA B;  2EK8 A;  3P2F A;  3N7Z A;  2X47 A;  3C26 A;  3NH5 A;  4PXC A;  4KSI A;  5K8N A;  3JUW A;  3MGD A;  3EJG A;  4CAV A;  2ABZ A;  4AG9 A;  4ONU A;  1CPX A;  4JWP A;  3JRU A;  4NGS A;  4B11 A;  1S7N A;  1S7L A;  1UFH A;  2FG1 A;  3QNV A;  5K8P A;  3BJ8 A;  3KL9 A;  2EK9 A;  2Z10 A;  3PGP A;  1Z4E A;  3IWW A;  4WWV A;  4ZY1 A;  2YNC C;  1YR0 A;  1EE3 P;  3WC6 A;  4P4J A;  3WC7 A;  2O4H A;  2Q4Y A;  3S9M A;  2JDD A;  5C88 A;  5LYL A;  3T8W A;  1IY7 A;  2DX6 A;  2BO9 A;  4B12 A;  5CBM A;  4MCS A;  4PSW A;  4BD9 A;  4J5R A;  8CPA A;  4MFJ A;  1P0H A;  4ETJ A;  4KSA A;  4UIB A;  2CNM A;  2GU2 A;  3UY5 A;  4IAV A;  3SJX A;  4FAI A;  1XMT A;  3KR4 A;  2FIW A;  3PRT A;  5A28 A;  2POK A;  1VHS A;  3F0A A;  2V77 A;  2YNE A;  3D8P A;  3FVL A;  4AG7 A;  4P4D A;  2L8R A;  4CYQ A;  1Z2L A;  4A39 A;  1IGB A;  2Z3O A;  4GVV A;  2PJ1 A;  3LOD A;  2PJB A;  4G1P A;  4A33 A;  3FJU A;  4E2A A;  1QSR A;  2YND A;  4KOU A;  2EWB A;  3EWO A;  1AYE A;  2V8D A;  3F8K A;  4GUA A;  3I3G A;  1LRZ A;  2QJ8 A;  1CM0 A;  3FED A;  4NJQ A;  4OC3 A;  5GCN A;  4B6Z A;  4R3K A;  2EUI A;  1M4G A;  3D4U A;  3VWD A;  1J4J A;  1N71 A;  4NXY A;  4LQ6 A;  4KVO E;  5F49 A;  5G22 A;  2F7V A;  1CJW A;  3SIG A;  3D7G A;  3FNC A;  4UFW A;  5FSZ A;  1DTD A;  3W91 A;  1TIQ A;  2B5G B;  4UCM A;  4PK2 A;  4FD7 A;  1LFW A;  2ZEL A;  2FAV A;  4F9U A;  3VAR A;  4ZGY B;  4X3R A;  1Y7R A;  1HEE A;  3PEI A;  1ZG7 A;  4EWT A;  2PR8 A;  2IJZ A;  2VQY A;  5H86 A;  4ZX9 A;  5HIH A;  3V45 A;  1IU8 A;  3GLJ A;  5LYI A;  3R95 A;  1GYT A;  4MCP A;  2C27 A;  3B3W A;  2ZPA A;  2J8M A;  1YVK A;  2ANP A;  4CRZ B;  5J8C A;  5G20 A;  2BEI A;  5C82 A;  2G0B A;  4R3L A;  2HC9 A;  4UFX A;  2DXQ A;  2BOA A;  3DLJ A;  3KHX A;  3F5B A;  3IGR A;  1F2O A;  4OLL A;  5DWN A;  4P6Y A;  3SXO A;  4B5P B;  4O23 A;  3CPX A;  3ZZI A;  4R57 A;  2ZW6 A;  1CPS A;  5CNP A;  2JLM A;  1A2Z A;  2J8R A;  4CAE A;  1MJB A;  2YGW A;  3JZT A;  2PCU A;  5DWM A;  2B4B A;  4CRY B;  4FD5 A;  4P4B A;  2Z3N A;  2DEA A;  3D2P A;  4A31 A;  1V0C A;  4NGR A;  1ZG9 A;  3JVN A;  2G9D A;  3DNS A;  4YU9 A;  4CAW A;  3IJ3 A;  1S3Z A;  2RNK A;  2JBK A;  2CXA A;  4JVV A;  2NYQ A;  4MI4 A;  3D7H A;  1XE4 A;  4A32 A;  2ZEP A;  3D67 A;  4QUS A;  5HXD A;  3QAY A;  5JPH A;  1NE9 A;  4XPD C;  1VIX A;  1M1D A;  3IIF A;  3TTH A;  5THW A;  1YVO A;  3Q71 A;  2PJC A;  2EVN A;  4R8F A;  4YGO A;  1VKC A;  3R96 A;  2PJA A;  4OME A;  2LGR A;  2ZEN A;  1NSA A;  5J1Q A;  1S5K A;  2BCO A;  5EMI A;  5FSX A;  5DUS A;  3R9E A;  1JQG A;  2ZEE A;  3EXN A;  3FEE A;  4MFZ A;  3FEC A;  4Z65 A;  3OWC A;  3IFE A;  2JZE A;  2VRI A;  1ZR5 A;  4K0C A;  1L0C A;  5IB0 A;  3S6H A;  2YNC A;  4R76 A;  4UML A;  2RFH A;  1R43 A;  2F5I A;  2Z11 A;  4KLW A;  1OBR A;  4KOW A;  5A27 A;  5F46 A;  2FXK A;  2PJ0 A;  3KGQ A;  4PK3 A;  4JXR A;  4MHZ A;  4XNH C;  4J5S A;  4AVC A;  3TO9 A;  2OU2 A;  4P4F A;  2PJ4 A;  1BPN A;  2GLF A;  1YK3 A;  3EWR A;  3GY9 A;  3B3V A;  2Q7S A;  2VZY A;  4HNW B;  4MFQ A;  2Q7B A;  3S6K A;  2ZXV A;  3BXM A;  1LOK A;  2OZG A;  3NH8 A;  4RUH A;  5AGE A;  1BOB A;  2EO8 A;  4A95 A;  1Y0R A;  4M6H A;  3SJG A;  3CPA A;  2WCT A;  4JZ0 A;  3Q6Z A;  4B10 A;  4NF1 A;  3FF3 A;  4XPK A;  4IUS A;  3B35 A;  1Y7E A;  3G3S A;  3QB8 A;  2J9A A;  5FSU A;  4MCR A;  3SHP A;  3D68 A;  3DDD A;  3EKE A;  1IIC A;  4CPA A;  5HH1 A;  4X5K A;  1M4I A;  1TKJ A;  2BUE A;  2FT0 A;  2QYV A;  4KVX A;  4OC5 A;  1I1D A;  2PJ6 A;  4ZI6 A;  1R3N A;  1PYT B;  3TOA A;  4KS9 A;  3BHX A;  5LYF A;  4LX9 A;  4IQY A;  3TX8 A;  4EVY A;  5F48 A;  1S7F A;  1B87 A;  4J5Q A;  3TT2 A;  4GVW A;  2FVG A;  2Y0M A;  1VHO A;  5G1Z A;  3B8G A;  2XEF A;  4L8A A;  4Q38 A;  1Q2Y A;  2HQY A;  1Z5R A;  2Q4Z A;  2Z3K A;  3EJF A;  4D86 A;  3SI1 A;  1YSJ A;  4QB9 A;  4FD6 A;  4Q7A A;  4MY0 A;  4UEZ A;  4NSQ A;  1ZO0 A;  5IV0 A;  2JDC A;  1Z9U A;  4R7M A;  4OKO A;  2RC4 A;  2Q43 A;  3SXN A;  3TCV A;  3R1K A;  4Y49 B;  4FUU A;  4B5O A;  5JQ4 A;  3DGV A;  4P4E A;  1KZF A;  4MRI A;  1XFO A;  4CGN A;  5CMS A;  1FY7 A;  1TKH A;  5HOL A;  4NGM A;  4KZT A;  4KOX A;  1XF8 A;  4B13 A;  5HVF A;  4F0X A;  3SIH A;  2PIY A;  4CYP A;  4CGM A;  2J8N A;  4A30 A;  4MFP A;  4C68 A;  4OC0 A;  1ZLH A;  4KOT A;  4CAF A;  4F0Y A;  3PP9 A;  3T90 A;  1XEB A;  2HV2 A;  4OP4 A;  3KHZ A;  3GKR A;  5HVH A;  1YQE A;  2B4D A;  1SQH A;  2OZU A;  3TOB A;  2X7B A;  4QBJ A;  4KOR A;  5J8F A;  3KI9 A;  2Q04 A;  4MXU A;  4OC4 A;  3KQZ A;  1LCP A;  1Y9K A;  2WUU A;  4HNY B;  4GS4 A;  1IOF A;  2ZW7 A;  1Q2D A;  5F47 A;  3QAH A;  4UCN A;  3H8F A;  1AUG A;  4BIN A;  5I0C A;  1GHE A;  1IB1 E;  4CYN A;  3B3T A;  5LRK A;  4JLY A;  1Z4R A;  3A9L A;  3PB7 X;  2OZH A;  2XEJ A;  2R1I A;  2R98 A;  3CXP A;  1BO4 A;  2DPS A;  4JJX A;  3BJ7 A;  2EBJ A;  2ZEM A;  4R87 A;  2AJ6 A;  2F8H A;  1KUX A;  1ZG8 A;  4ZYQ A;  2OOT A;  2WPX A;  2R7H A;  4Q36 A;  4HNX B;  4JXQ A;  4R9M A;  1UWY A;  5K8M A;  1BLL E;  1RO5 A;  4ABK A;  3RAM A;  2B5G A;  2Q4V A;  2ZOF A;  2B3U A;  3B7I A;  3GPG A;  4LQG A;  5JH9 A;  4B14 A;  5K8O A;  3PBB A;  2QIR A;  4NEX A;  1R57 A;  2K5T A;  3WAB A;  4K3N A;  4CS0 B;  4PV6 A;  3IWE A;  2P6E A;  1ZR3 A;  1QSM A;  2BFQ A;  2AFM A;  3GPO A;  5KTC A;  4HKF A;  1Z8W A;  4PPZ A;  5FSY A;  1ELL P;  4Y49 C;  2P6F A;  4KOV A;  1KWM A;  2KQV A;  2WYR A;  1MK4 A;  2ZEG A;  1S60 A;  3ETI A;  1YLO A;  2VEZ A;  2Q51 A;  4JGK A;  1F2P A;  1QSO A;  3IWG A;  3K2K A;  3KKW A;  4MHP A;  1KUY A;  3PB8 X;  4ZBG A;  3S6G A;  4QVT A;  2V8H A;  3W6X A;  2V8V A;  5CB5 A;  4DJL A;  2OR4 A;  4KOS A;  4KUA A;  3B3C A;  4HPS A;  4TNU A;  2D4O A;  3EW5 A;  3RZA A;  3WC5 A;  1RXT A;  4JD6 A;  4NFR A;  4KUB A;  4NJR A;  4KOY A;  1S7K A;  2REF A;  4UCP A;  1NSL A;  4OID A;  3FIX A;  3IEH A;  4DYO A;  5AG6 A; 
#chains in the Genus database with same CATH homology
 3GQE A;  4WJB A;  2C6G A;  3HLP A;  3KQX A;  3HUV A;  2ZEH A;  1TF8 A;  4OIW A;  3H8G A;  1AMP A;  1CP6 A;  1DE4 C;  2IQ6 A;  3V2B A;  2QVP A;  4IK2 A;  3L2N A;  3D7F A;  3GPQ A;  1VHU A;  2AFC A;  4FBE A;  1ZLI A;  4ONW A;  3SJF A;  3MRU A;  3IIB A;  1M4L A;  1CP7 A;  3FX6 A;  3IC1 A;  1VGY A;  3EWQ A;  5E3B A;  2PJ9 A;  3H8E A;  2PJ5 A;  4IHM A;  3KR5 A;  1TY8 A;  1FNO A;  2PJ8 A;  2VL1 A;  1YD9 A;  3SI2 A;  4X2T A;  3GUX A;  2V8G A;  4UEE A;  3RBU A;  4A94 A;  2AFU A;  1YME A;  1ARL A;  4UEF A;  4YWY A;  1QQ9 A;  2PVW A;  2PVV A;  1XMB A;  1CG2 A;  1YW6 A;  3D66 A;  4GM5 A;  4UF4 A;  4ZY0 A;  5FSV A;  3K9T A;  6CPA A;  1HDQ A;  2PIZ A;  2WZN A;  4OC1 A;  1F57 A;  1SPV A;  3LWU A;  4MCQ A;  1Y0Y A;  2PJ7 A;  4P45 A;  3WT4 A;  4JLL A;  2AFO A;  4EFD A;  2XEI A;  3S9N A;  4NGQ A;  1CX8 A;  1TXZ A;  4JCA A;  3VFQ A;  1Q7L A;  2PJ3 A;  1LAN A;  3VAT A;  2ZED A;  4ESS A;  3EWP A;  4W9Y A;  3SI0 A;  3V38 A;  2PRQ A;  3PFO A;  3S9L A;  1NJR A;  4P4I A;  2AFX A;  1QMU A;  3ISZ A;  3B3S A;  1CBX A;  4ETK A;  2I3C A;  1XJO A;  2CTC A;  4MHN A;  2PJ2 A;  3BI1 A;  3GB0 A;  3PB9 X;  4P44 A;  3GQO A;  4UIA A;  4EME A;  1TKF A;  4A38 A;  1BPM A;  2GRE A;  5DS0 A;  5D8N A;  2JBJ A;  2ZEF A;  4PXE A;  5I4M A;  2C6P A;  3FMC A;  4OC2 A;  2RB7 A;  3TC8 A;  7CPA A;  3NH4 A;  3ISX A;  5JM6 A;  3CT9 A;  1H8L A;  3KZW A;  4PXB A;  3KAS A;  1BAV A;  2C1C A;  2NSM A;  2HB6 A;  2ZEO A;  2CIJ A;  5AIL A;  3PB6 X;  5LRJ A;  3SII A;  5ELY A;  3PFE A;  4A37 A;  2AFZ A;  2IMO A;  4MHY A;  3CDX A;  2PE3 A;  5D29 A;  1TF9 A;  1RTQ A;  1ELM P;  5IB9 A;  4PQA A;  4X8I A;  2XD7 A;  5F09 A;  1ARM A;  1PCA A;  2CTB A;  3IO1 A;  4NGP A;  3N5F A;  3V7Z A;  1Z8L A;  2BFR A;  2AFS A;  2C6C A;  5CPA A;  1YW4 A;  2JEW A;  3BI0 A;  4P10 A;  2CF4 A;  1VHE A;  4F9V A;  4F8Z A;  2O53 A;  3B2Y A;  4R6T A;  5CB3 A;  3FH4 A;  4J4Z A;  3SIJ A;  3SJE A;  1HDU A;  4DUK A;  1FT7 A;  4ABL A;  1LAP A;  3VH9 A;  5JGF A;  2ZOG A;  4NGT A;  3D7D A;  4TU0 A;  3MN8 A;  2AFW A;  4KYB A;  3IID A;  2GLJ A;  2XEG A;  2EEE A;  4H2K A;  1TXR A;  4ZX8 A;  1HJZ A;  4ZY2 A;  4AXV A;  1LAM A;  4PXD A;  3NA6 A;  4FWU A;  1XBU A;  3I1U A;  4MMO A;  4NGN A;  1XRY A;  3NFZ A;  2ACF A;  4TWE A;  5LRG A;  5LYD A;  3PBE A;  5HVG A;  4JYW A;  3LMS A;  2EK8 A;  2X47 A;  3NH5 A;  4PXC A;  4KSI A;  5K8N A;  3EJG A;  2ABZ A;  1CPX A;  4NGS A;  3JRU A;  2FG1 A;  3QNV A;  5K8P A;  3KL9 A;  2EK9 A;  3IWW A;  4WWV A;  4ZY1 A;  1EE3 P;  3WC6 A;  4P4J A;  3WC7 A;  2O4H A;  3S9M A;  5LYL A;  3T8W A;  1IY7 A;  2DX6 A;  2BO9 A;  5CBM A;  4MCS A;  4BD9 A;  8CPA A;  4J5R A;  4UIB A;  4ETJ A;  2GU2 A;  5K8M A;  4FAI A;  4IAV A;  3SJX A;  3KR4 A;  3PRT A;  2POK A;  2V77 A;  3FVL A;  4P4D A;  2L8R A;  1Z2L A;  4A39 A;  1IGB A;  4GVV A;  2PJ1 A;  4G1P A;  2PJB A;  3FJU A;  2EWB A;  3EWO A;  1AYE A;  2V8D A;  4NJQ A;  4GUA A;  4B6Z A;  2QJ8 A;  3FED A;  4OC3 A;  3D4U A;  2F7V A;  3SIG A;  3D7G A;  5FSZ A;  1DTD A;  1LFW A;  2ZEL A;  2FAV A;  4F9U A;  3VAR A;  4X3R A;  1HEE A;  3PEI A;  1ZG7 A;  4EWT A;  2IJZ A;  4ZX9 A;  5HIH A;  3V45 A;  3GLJ A;  5LYI A;  1GYT A;  4MCP A;  3B3W A;  2ANP A;  2HC9 A;  2BOA A;  3DLJ A;  3KHX A;  1F2O A;  4P6Y A;  4O23 A;  3CPX A;  1CPS A;  3JZT A;  2PCU A;  4P4B A;  2DEA A;  4NGR A;  1ZG9 A;  2G9D A;  4YU9 A;  3IJ3 A;  2JBK A;  2NYQ A;  4JVV A;  3D7H A;  2ZEP A;  3D67 A;  5HXD A;  1VIX A;  3IIF A;  5THW A;  2PJC A;  3Q71 A;  4R8F A;  2PJA A;  4OME A;  2LGR A;  2ZEN A;  1NSA A;  5J1Q A;  2BCO A;  5FSX A;  5DUS A;  1JQG A;  2ZEE A;  3FEE A;  3FEC A;  4Z65 A;  3IFE A;  2VRI A;  1ZR5 A;  4K0C A;  4R76 A;  2RFH A;  4UML A;  1R43 A;  1OBR A;  2FXK A;  2PJ0 A;  3KGQ A;  4MHZ A;  4J5S A;  4P4F A;  2PJ4 A;  1BPN A;  2GLF A;  3EWR A;  3B3V A;  3BXM A;  1LOK A;  3NH8 A;  4RUH A;  1Y0R A;  3SJG A;  3CPA A;  4JZ0 A;  3Q6Z A;  3FF3 A;  3B35 A;  1Y7E A;  2J9A A;  5FSU A;  4MCR A;  3D68 A;  3EKE A;  4CPA A;  1TKJ A;  2QYV A;  4OC5 A;  2PJ6 A;  4ZI6 A;  1R3N A;  1PYT B;  3BHX A;  5LYF A;  4IQY A;  3TX8 A;  4J5Q A;  4GVW A;  2FVG A;  1VHO A;  2XEF A;  2Q4Z A;  1Z5R A;  3EJF A;  4D86 A;  3SI1 A;  1YSJ A;  4Q7A A;  4UEZ A;  4OKO A;  4R7M A;  2Q43 A;  4FUU A;  3DGV A;  4P4E A;  4MRI A;  1XFO A;  5CMS A;  1TKH A;  5HOL A;  4NGM A;  5HVF A;  3SIH A;  2PIY A;  4OC0 A;  1ZLH A;  4OP4 A;  3KHZ A;  5HVH A;  3KI9 A;  4MXU A;  4OC4 A;  3KQZ A;  1LCP A;  3H8F A;  3B3T A;  5LRK A;  3PB7 X;  2XEJ A;  2ZEM A;  2F8H A;  1ZG8 A;  4ZYQ A;  2OOT A;  1UWY A;  1BLL E;  4ABK A;  3RAM A;  2ZOF A;  3B7I A;  3GPG A;  4LQG A;  5JH9 A;  5K8O A;  3PBB A;  3WAB A;  4K3N A;  1ZR3 A;  2BFQ A;  2AFM A;  3GPO A;  4PPZ A;  5FSY A;  1ELL P;  1KWM A;  2WYR A;  2ZEG A;  3ETI A;  1YLO A;  2Q51 A;  4JGK A;  1F2P A;  4MHP A;  3K2K A;  3PB8 X;  2V8H A;  2V8V A;  5CB5 A;  4DJL A;  2OR4 A;  3B3C A;  4TNU A;  3EW5 A;  3RZA A;  3WC5 A;  4NFR A;  4NJR A;  4OID A;  3IEH A;  3PB4 X;  4DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...