4ZYQA

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10s
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
519
structure length
517
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
total genus 172
structure length 517
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zyqA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zyqA02
1Z5RA 3FEDA 4P4IA 4UEZA 4ETKA 2QYVA 4A94A 2PJCA 1ZR5A 1IY7A 3CPXA 1F2PA 4JYWA 4ZI6A 5FSUA 4NGSA 1CX8A 1XBUA 4AXVA 2CF4A 4BD9A 4IAVA 3SJXA 1Y7EA 3GB0A 4F9UA 5CBMA 2O53A 2DEAA 5HXDA 2O4HA 1EE3P 2ZEEA 4MHZA 5LRKA 1ZR3A 4GUAA 1Y0YA 2PVVA 1BPNA 4OC0A 5LRJA 3V38A 1R3NA 5K8OA 1ARLA 4ZY1A 3MRUA 5F09A 2WYRA 2PIZA 3NH4A 1XJOA 2CTCA 5HVFA 2IJZA 1XMBA 3PB7X 4F9VA 2PJBA 1YLOA 4KYBA 3V7ZA 4MHPA 2POKA 1TKHA 2FVGA 2PE3A 1LFWA 5CPAA 2ZEGA 2VRIA 1CBXA 2WZNA 1TKJA 4CPAA 2V8DA 5HVHA 1HDUA 1KWMA 4ZX8A 1QQ9A 4OP4A 3VARA 4NJRA 2OOTA 3RZAA 5J1QA 3KASA 1JQGA 1YW4A 5D29A 4P10A 1ZG8A 2PJ8A 2AFZA 3MN8A 4DJLA 5K8NA 1HJZA 3B2YA 3KL9A 1YW6A 4ZX9A 2IQ6A 3GUXA 4A37A 5LRGA 1H8LA 1HEEA 1UWYA 1Z2LA 2AFOA 3VFQA 1SPVA 3TX8A 4NGMA 2X47A 3NA6A 3PBEA 5HOLA 3B3SA 1LOKA 4NGPA 4UMLA 2HB6A 5AILA 2VL1A 3KR5A 2AFXA 1XFOA 2I3CA 5JM6A 3NH5A 4MHNA 4K3NA 2EWBA 3EWRA 3EWOA 2XD7A 1YMEA 3D66A 3TC8A 4R6TA 2OR4A 4DUKA 5LYIA 2FG1A 3SIIA 4P4JA 4MMOA 1NSAA 3NFZA 2ACFA 4JGKA 5CB5A 2PRQA 1CP6A 4P6YA 3KR4A 3WC6A 3IFEA 3FJUA 1CPXA 3PFOA 2F7VA 4B6ZA 3BI0A 3H8GA 4J5RA 3SI1A 1LCPA 3ISXA 4UIAA 8CPAA 4JZ0A 5HIHA 3H8EA 1VHEA 4ETJA 4A39A 2AFSA 2PJ0A 1PCAA 4P4BA 1GYTA 3PB8X 1CG2A 3VATA 3WC7A 3VH9A 4GM5A 2FXKA 4YWYA 6CPAA 4PQAA 3IWWA 4LQGA 2GREA 4J5SA 2JEWA 4H2KA 5DUSA 3SI0A 4MXUA 3H8FA 3HLPA 2AFWA 2CIJA 4PXBA 2ANPA 3T8WA 2AFCA 3IIDA 5CB3A 3BXMA 3NH8A 2RB7A 5FSXA 2XEFA 4PXCA 4EFDA 2NYQA 4IK2A 4EMEA 1BPMA 1ZG9A 1R43A 3D7FA 3D4UA 2PJ3A 3KQZA 1LAMA 3KZWA 2GLFA 2IMOA 3LMSA 3SJFA 4J4ZA 3KHZA 3IIBA 3Q71A 4TU0A 2L8RA 2PVWA 4ABKA 4ZY0A 2BFRA 4R76A 1F57A 3B7IA 3KGQA 4OC4A 1TF9A 1TXZA 2G9DA 5DS0A 1Y0RA 1PYTB 4W9YA 4IQYA 2EK9A 2PJ5A 2RFHA 3S9NA 4P4EA 2PJ4A 3EWQA 4NGQA 4UIBA 4NGRA 2JBKA 4MCRA 2J9AA 3PB6X 4OIDA 4EWTA 7CPAA 2V8VA 3PBBA 4TWEA 3CPAA 4UEEA 4KSIA 2GU2A 2C1CA 3PEIA 2EK8A 4MHYA 4NJQA 1TY8A 3FEEA 3HUVA 4J5QA 2EEEA 2XEJA 4MRIA 1TKFA 3IIFA 2CTBA 5IB9A 3KI9A 1NJRA 2PJ6A 3GLJA 1ZLHA 3PB4X 4OC2A 1ELLP 4GVWA 4P4DA 5LYDA 1QMUA 3GPOA 3FVLA 3QNVA 2Q51A 4O23A 3D67A 3V45A 4MCQA 1F2OA 2ZEHA 1YSJA 4X8IA 2QJ8A 1XRYA 5FSYA 3JRUA 4IHMA 1ZG7A 5FSZA 4JLLA 4YU9A 3S9MA 3FH4A 2BO9A 3CDXA 3DGVA 1VIXA 1BLLE 4X2TA 3PFEA 3PRTA 4NGTA 4ZYQA 1HDQA 3B3TA 3WABA 1ELMP 3ISZA 2AFMA 1AMPA 3GPQA 2V8HA 3N5FA 4FBEA 4NGNA 4OKOA 4Z65A 3JZTA 3PB9X 1M4LA 3EJFA 3GQEA 5K8MA 2V8GA 5K8PA 1RTQA 3B3VA 1AYEA 2JBJA 1OBRA 3FF3A 4OIWA 3IEHA 1BAVA 4OC5A 4A38A 4OC1A 4ABLA 4DYOA 2PJ9A 2C6GA 4P44A 4GVVA 1VHUA 4WJBA 3IC1A 2Q43A 3K2KA 3D68A 2ZEPA 3B3WA 3LWUA 2ZEDA 3EKEA 2XEGA 2V77A 4TNUA 2F8HA 2FAVA 3RAMA 2DX6A 2HC9A 3D7HA 2AFUA 5E3BA 3RBUA 3SJEA 2ZEOA 3B35A 2LGRA 3GPGA 1VGYA 3FECA 4WWVA 3GQOA 2ZEMA 4ZY2A 5JH9A 2PCUA 4UEFA 3KQXA 4X3RA 5LYLA 3SI2A 1CP7A 1DTDA 1TXRA 4PXEA 5ELYA 4ESSA 4P45A 2ZOGA 2BOAA 4D86A 4OMEA 2XEIA 3Q6ZA 1ARMA 3IJ3A 4OC3A 3SIGA 3S9LA 3V2BA 1LAPA 2PJ1A 3DLJA 1YD9A 2ZELA 5D8NA 1Z8LA 4MCSA 5HVGA 3KHXA 2ABZA 4R8FA 4FWUA 4K0CA 2ZOFA 4P4FA 2GLJA 3FX6A 3WT4A 4RUHA 3K9TA 2BFQA 1TF8A 1ZLIA 3CT9A 4R7MA 5THWA 4PPZA 3L2NA 2BCOA 3SJGA 1LANA 4JCAA 5LYFA 1VHOA 3ETIA 4PXDA 1FT7A 2ZEFA 3SIJA 4Q7AA 5I4MA 2ZENA 1IGBA 2NSMA 3EWPA 3FMCA 4MCPA 3B3CA 3I1UA 3IO1A 4FAIA 2PIYA 1DE4C 1FNOA 3BHXA 3SIHA 4G1PA 2PJ7A 3D7GA 5FSVA 1CPSA 1Q7LA 4UF4A 3D7DA 4JVVA 5JGFA 3EJGA 2PJ2A 2PJAA 2QVPA 3EW5A 4F8ZA 2Q4ZA 4NFRA 5CMSA 3WC5A 4ONWA 3BI1A 2C6PA 2C6CA 4FUUA
chains in the Genus database with same CATH superfamily
1Z5RA 3FEDA 1U6MA 4P4IA 4UEZA 4ETKA 3TO6A 4PK2A 2QYVA 4MY0A 2FIWA 2PJCA 4A94A 1ZR5A 1MK4A 1IY7A 5EC4A 3CPXA 1F2PA 2JEVA 3IU2A 4HNXB 4KOTA 4JYWA 4FD7A 4ZI6A 5FSUA 4NGSA 1CX8A 1XBUA 4AXVA 5DWNA 1J4JA 2CF4A 4YGOA 3UY5A 4BBHA 4IAVA 4GXHA 3SJXA 2FT0A 4BD9A 1Y7EA 2ZW4A 3GB0A 3VWEA 4F9UA 5CBMA 2O53A 2DEAA 4PSXA 4XNHB 4A32A 2HQYA 5HXDA 3G3SA 2JDDA 1Y9WA 2O4HA 1EE3P 2ZEEA 4UCPA 4MHZA 4NCZA 4JJXA 2Q0YA 1ZR3A 3W6XA 5A27A 5KTAA 4CGMA 5LRKA 3F8KA 4GUAA 2JZDA 5F47A 1Y0YA 4KSFA 2HV2A 2PVVA 1BPNA 4OC0A 5LRJA 3S6FA 1R3NA 4KZTA 1ARLA 3V38A 4ZY1A 5K8OA 3MRUA 5F09A 2WYRA 3FB3A 3W6SA 2PIZA 3NH4A 2OZHA 1XJOA 2AJ6A 2CTCA 3KKWA 3EY5A 5HVFA 1Y9KA 2IJZA 1XMBA 2OH1A 3PB7X 4CGLA 4F9VA 2DPSA 2PJBA 4A30A 1YLOA 4KYBA 4MFLA 3S6HA 5C88A 3V7ZA 4MHPA 2POKA 4QB9A 1TKHA 2FVGA 2PE3A 1LFWA 4DNCA 5CPAA 2ZEGA 3IWGA 2B4DA 4XPKA 2FCKA 2VRIA 2ZPAA 1CBXA 1Q2YA 4UFVA 3SXNA 1QSTA 4UCMA 2WZNA 1TKJA 4UA3A 3QAHA 1SQHA 1XIXA 2V8DA 4CPAA 5HVHA 1CM0A 1HDUA 1KWMA 4CGPA 4ZX8A 1QQ9A 2CNSA 5JQ4A 1YGHA 4OP4A 3DR6A 3VARA 2ARHA 4IUSA 2YNCC 4E0AA 4NJRA 4MJ8A 1KUYA 2OOTA 3RZAA 5J1QA 3KASA 3S6GA 1JQGA 1YW4A 5BWAB 4MHDA 4P10A 5D29A 3D3SA 1ZG8A 2C27A 2PJ8A 2AFZA 4IF5A 3MN8A 4DJLA 5K8NA 1HJZA 2FSRA 3B2YA 1YW6A 3KL9A 4ZX9A 2IQ6A 3GUXA 1WK4A 2CNTA 3NE8A 3TO7A 3R9FA 4A37A 1XOVA 1H8LA 1HEEA 2BL1A 5LRGA 2GIVA 5G1ZA 1UWYA 1B6BA 1Z2LA 2AFOA 1R57A 1OZPA 4LQ6A 3VFQA 1SPVA 2R98A 3TX8A 1BO4A 2X47A 4JD6A 2O28A 4NGMA 4KUBA 2B58A 3NA6A 3D2MA 1Q2DA 3PBEA 4JWPA 3RYOA 3S6KA 5HOLA 1P4NA 4UWJA 3B3SA 1LOKA 2Q4VA 4K30A 4NGPA 4UMLA 3RNZA 2HB6A 5AILA 2VL1A 3KR5A 4FD5A 4B5PA 3ZZIA 2ZW7A 4A33A 2AFXA 1XFOA 2Z11A 4PK3A 2I3CA 4MFKA 5JM6A 1IYKA 2OZGA 3FRMA 3NH5A 4K3NA 4MHNA 4OAEA 2EWBA 3EWRA 3EWOA 2XD7A 1YMEA 3D66A 3TC8A 3R9GA 2JZEA 3F5BA 4R6TA 2OR4A 4CYPA 2J8RA 4DUKA 4MFPA 3FIXA 3H4QA 1IOIA 4M3SA 5LYIA 2FG1A 3BJ7A 3P2HA 3SIIA 4R87A 4P4JA 4MMOA 1M44A 4A2ZA 3IU1A 1NSAA 3NFZA 5IV0A 1XEBA 2ACFA 3CXQA 4JGKA 5CB5A 2PRQA 1CP6A 4P6YA 3KR4A 2P6GA 3WC6A 3IFEA 4R3KA 3FJUA 1CPXA 3PFOA 2BSWA 2F7VA 2Z3LA 3BI0A 3D8PA 3H8GA 4J5RA 3EC4A 3CXSA 4B6ZA 2R1IA 1B87A 1UFHA 2GANA 3SI1A 1LCPA 2QECA 3ISXA 4UIAA 8CPAA 4JZ0A 4CYOA 5F46A 5HIHA 3H8EA 1VHEA 2EVNA 4ETJA 4A39A 2AFSA 2PJ0A 3GIUA 2FXFA 1QSRA 1PCAA 4CYQA 4P4BA 4CAWA 1GYTA 4MFJA 3PB8X 1CG2A 4MI4A 2BEIA 3TFYA 4ONUA 3VATA 3WC7A 1KZFA 1VHSA 4JXRA 3VH9A 2ODFA 3LODA 4GM5A 2FXKA 4YWYA 6CPAA 2B3VA 2A4NA 4PQAA 5I0CA 4RI1A 2Z3PA 1GHEA 4UFWA 3IWWA 2G3AA 2CXAA 4LQGA 2GREA 4J5SA 4PSWA 2JEWA 4H2KA 5DUSA 4AG7A 4II9A 3SI0A 4KOWA 4MXUA 2D4OA 3GY9A 3H8FA 1XMTA 3HLPA 2AFWA 2CIJA 2QIRA 3BLNA 3JUWA 4C2XA 4PXBA 4AVBA 1KUXA 2ANPA 3T8WA 2AFCA 3IIDA 5CB3A 1CJWA 3BXMA 3NH8A 2RB7A 5FSXA 2XEFA 1L0CA 4PXCA 3TO9A 4EFDA 2NYQA 3P2FA 4F0YA 4IK2A 4EMEA 1BPMA 1ZG9A 1R43A 2Z3NA 3D7FA 3D4UA 2PJ3A 3BJ8A 3WR7A 3KQZA 1LAMA 3KZWA 2GLFA 1A2ZA 1FY7A 2IMOA 5AG6A 2P6EA 2JZFA 1JWQA 4R57A 1IICA 3LMSA 3SJFA 1RXTA 4J4ZA 3KHZA 4RN7A 3IIBA 4Q38A 3Q71A 3V8IA 2G0BA 3K9UA 4TU0A 2ZW5A 4YRHA 2L8RA 3DSBA 4ABKA 2PVWA 4ZY0A 4HNYB 2BFRA 4OADA 5E96A 4HPSA 3FNCA 4R76A 5AG5A 2REEA 5KTDA 1F57A 4KOSA 4CRZB 3B7IA 5G21A 4H89A 1QSNA 4B11A 3KGQA 4OC4A 1TF9A 1TXZA 1IB1E 4C2ZA 2G9DA 3TCVA 5ISVA 5DS0A 1Y0RA 3JVNA 4L89A 1PYTB 4CAVA 4W9YA 4IQYA 2EK9A 2PJ5A 2RFHA 2Q7SA 2R8VA 3S9NA 4P4EA 1Y7RA 2PJ4A 3EWQA 2B5GB 4NGQA 4UIBA 2VI7A 4NGRA 1NE9A 2FS5A 2JBKA 5F48A 2DXQA 1QSMA 2KQVA 4MCRA 1MJ9A 1YVKA 1Z8XA 2J9AA 1ZO0A 2OZUA 3B8GA 1YLEA 3PB6X 4OIDA 1NSLA 4EWTA 7CPAA 4U9ZA 1MJBA 2YNEA 4NXYA 2DF5A 2V8VA 3PBBA 3E0KA 4TWEA 3CPAA 2YGWA 4KSIA 4UEEA 2GU2A 2C1CA 4KOVA 1WWZA 3PEIA 2EK8A 2Q7BA 4A31A 3C26A 4MHYA 4KUAA 4NJQA 1TY8A 1YQEA 2W2GA 3FEEA 3IWEA 4XPDC 3T9YA 3HUVA 4J5QA 2EEEA 2XEJA 3PZJA 1TKFA 3IIFA 1I21A 2CTBA 2IL4A 2P0WA 4MRIA 1YVOA 4RS2A 5IB9A 3TTHA 4UCNA 1Z9UA 3KI9A 5EBVA 1XF8A 4F0XA 1NJRA 4NEXA 4FD4A 2PJ6A 4MFQA 3GLJA 1ZLHA 3ZJ0A 4AVAA 2PRBA 2PSWA 3PB4X 4OC2A 4Q36A 4B14A 1ELLP 3G8WA 1PUAA 1VKCA 4GVWA 4P4DA 5LYDA 1QMUA 3R95A 3GPOA 3FVLA 4OLLA 1M1DA 3LD2A 2DPTA 3QNVA 2Q51A 5HMNA 4O23A 3D67A 2REFA 3V45A 4MCQA 5H86A 2J8NA 4M6GA 1F2OA 1MJAA 2NMTA 2ZEHA 4KVME 4B12A 2WPXA 1XE4A 4KOYA 1M4GA 1YSJA 3PGPA 4B13A 4X8IA 4E2AA 2QJ8A 2RC4A 4LX9A 1XRYA 5FSYA 4ZGYB 3JRUA 3TT2A 3I3GA 3TOAA 1V0CA 1ZG7A 4IHMA 3PP9A 5FSZA 2G3TA 4KOUA 2Z10A 1AUGA 4YFJA 4JLLA 4YU9A 3S9MA 3OWCA 3FH4A 4C2YA 2WCTA 2BO9A 3CDXA 3DGVA 1VIXA 1BLLE 4X2TA 3PFEA 2VZYA 3PRTA 4NGTA 4ZYQA 4KSAA 4R9MA 1HDQA 3B3TA 3WABA 4MBUA 5EMIA 5J8FA 1Z8WA 5C82A 4XPDB 5KTCA 4QBJA 1S3ZA 2B5GA 1ELMP 1IU8A 3ISZA 2AFMA 4FD6A 3JTKA 3DNSA 4I49A 4GS4A 3R1KA 3NE7A 4PV6A 1TIQA 2VBQA 1AMPA 1X12A 2I79A 3GPQA 2V8HA 1IYLA 3N5FA 4FBEA 4NGNA 4OKOA 2RNKA 4Z65A 3JZTA 5A28A 3PB9X 2J8MA 1M4LA 1S7NA 3EJFA 3GQEA 5K8MA 2V8GA 2Q4YA 5K8PA 1Z4RA 1RTQA 1NMTA 4XPLA 1AYEA 3B3VA 4NSQA 4C68A 2JBJA 2JDCA 2GE3A 4L8AA 1OBRA 3FF3A 4OIWA 2Q04A 3IEHA 1BAVA 2EUIA 4C7IA 5AGEA 4OC5A 4U9YA 4HNWB 4ABLA 3CZXA 4OC1A 4A38A 4KVOE 2PJ9A 4KORA 4DYOA 2FIAA 2C6GA 3LACA 3FYNA 4P44A 2PR8A 3D2PA 4E8OA 4GVVA 2VXKA 4H6ZA 4QC6A 3DDDA 1S5KA 1VHUA 4WJBA 5J8CA 3IC1A 2Q43A 1Q2CA 3A9LA 3QB8A 4CRYB 3K2KA 3D68A 1S7LA 4UWIA 2ZEPA 4NF1A 3B3WA 5IX3A 4QVTA 3LWUA 1P0HA 4B5PB 2ZEDA 4CGOA 4KLVA 3EKEA 4CAEA 2XEGA 2YNCA 2V77A 4TNUA 2F8HA 2FAVA 3RAMA 2DX6A 2HC9A 3D7HA 4CAXA 2AFUA 2FE7A 5E3BA 4LUAA 3RBUA 3SJEA 1KUVA 2ZEOA 3B35A 2LGRA 3GPGA 3TE4A 4Y49C 1VGYA 2AE6A 5DWMA 3FECA 3FXTA 3GQOA 4ZY2A 2ZEMA 2JLMA 4WWVA 3R9EA 5JH9A 2PCUA 4UEFA 2OU2A 4CS0B 3KQXA 4X3RA 4C7HA 5LYLA 2Z3KA 2FL4A 4U5YA 4UBRA 2Z0ZA 3R96A 3SI2A 1K4JA 4KLWA 1N71A 2GFQA 2QMLA 3EXNA 3W91A 4A95A 1CP7A 1DTDA 1TXRA 5CNPA 4AVCA 4F6AA 4PXEA 2WPWA 1IIDA 5ELYA 4R3LA 4ESSA 4P45A 3I9SA 4UFXA 4ORFA 4B5OA 4AB7A 3N7ZA 2ZOGA 2BOAA 5H84A 4BMHA 4D86A 4HKFA 4OMEA 3VWDA 1S60A 1PU9A 2VQYA 3RO0A 2XEIA 3Q6ZA 2PQ8A 4AG9A 5IB0A 1ARMA 2Z3OA 2EBJA 3IJ3A 2WSAA 4OC3A 3DR8A 3SIGA 3EO4A 3S9LA 2PR1A 3EFAA 2Z3MA 3V2BA 2HUZA 3GYAA 4MFZA 1LAPA 4JXQA 2PJ1A 3DLJA 1YD9A 1ON0A 2ZELA 5D8NA 1Z4EA 2EO8A 4H6UA 4J3GA 4EVYA 1Z8LA 4MCSA 5G22A 2VZZA 5HVGA 3CXPA 3MGDA 2ZW6A 3KHXA 2ABZA 4R8FA 4CGNA 4FWUA 1M4DA 2Y0MA 4MY3A 4K0CA 1X10A 2ZOFA 4P4FA 3TOBA 2GLJA 4QUSA 4KOXA 3FX6A 3WT4A 1YX0A 4RUHA 1I12A 4Y49B 2I00A 3K9TA 2BFQA 1TF8A 5AG4A 5LYFA 5GCNA 3T90A 2D4PA 2ATRA 1ZLIA 3CT9A 4KVXA 4R7MA 5THWA 4PPZA 2WUUA 3L2NA 2PDOA 2BCOA 4X5KA 2YNDA 3SJGA 2ZXVA 5G20A 3IGRA 1LANA 4JCAA 2CY2A 1VHOA 2B4BA 3QAYA 4JLYA 3ETIA 4M6HA 1I1DA 4PXDA 5AG7A 1FT7A 5HH1A 2ZEFA 3SIJA 4Q7AA 5I4MA 2ZENA 3FBUA 1IGBA 1IOFA 2NSMA 3SHPA 3EWPA 2F5IA 4B10A 5FVJA 3FMCA 2CNMA 4MCPA 4XNHC 5F49A 2Q44A 3B3CA 3I1UA 3IO1A 4M6IA 4FAIA 1Z8TA 2PIYA 1LRZA 2B4DB 1DE4C 1M4IA 3SXOA 2P6FA 1FNOA 1YR0A 2B3UA 3SIHA 1BOBA 3BHXA 1RO5A 2BUEA 2OB0A 1YREA 4G1PA 1S7FA 2PJ7A 3D7GA 5FSVA 1CPSA 1Q7LA 4UF4A 3D7DA 4JVVA 1QSOA 4M85A 5JGFA 3EJGA 2PJ2A 1YK3A 2K5TA 4ZBGA 4CAFA 2PJAA 2QVPA 5JPHA 3EW5A 4F8ZA 2Q4ZA 2VEZA 4CYNA 2H5MA 2KCWA 3F0AA 4BINA 3GKRA 4NFRA 4KS9A 5CMSA 3WC5A 4ONWA 3BI1A 3H5ZA 2C6PA 1S7KA 2R7HA 2X7BA 2PC1A 2C6CA 4FUUA
chains in the Genus database with same CATH topology
1Z5RA 3FEDA 4P4IA 4UEZA 4ETKA 2QYVA 4A94A 2PJCA 1ZR5A 1IY7A 3CPXA 1F2PA 4JYWA 4ZI6A 5FSUA 4NGSA 1CX8A 1XBUA 4AXVA 2CF4A 4BD9A 4IAVA 3SJXA 1Y7EA 3GB0A 4F9UA 5CBMA 2O53A 2DEAA 5HXDA 2O4HA 1EE3P 2ZEEA 4MHZA 5LRKA 1ZR3A 4GUAA 1Y0YA 2PVVA 1BPNA 4OC0A 5LRJA 3V38A 1R3NA 5K8OA 1ARLA 4ZY1A 3MRUA 5F09A 2WYRA 2PIZA 3NH4A 1XJOA 2CTCA 5HVFA 2IJZA 1XMBA 3PB7X 4F9VA 2PJBA 1YLOA 4KYBA 3V7ZA 4MHPA 2POKA 1TKHA 2FVGA 2PE3A 1LFWA 5CPAA 2ZEGA 2VRIA 1CBXA 2WZNA 1TKJA 4CPAA 2V8DA 5HVHA 1HDUA 1KWMA 4ZX8A 1QQ9A 4OP4A 3VARA 4NJRA 2OOTA 3RZAA 5J1QA 3KASA 1JQGA 1YW4A 5D29A 4P10A 1ZG8A 2PJ8A 2AFZA 3MN8A 4DJLA 5K8NA 1HJZA 3B2YA 3KL9A 1YW6A 4ZX9A 2IQ6A 3GUXA 4A37A 5LRGA 1H8LA 1HEEA 1UWYA 1Z2LA 2AFOA 3VFQA 1SPVA 3TX8A 4NGMA 2X47A 3NA6A 3PBEA 5HOLA 3B3SA 1LOKA 4NGPA 4UMLA 2HB6A 5AILA 2VL1A 3KR5A 2AFXA 1XFOA 2I3CA 5JM6A 3NH5A 4MHNA 4K3NA 2EWBA 3EWRA 3EWOA 2XD7A 1YMEA 3D66A 3TC8A 4R6TA 2OR4A 4DUKA 5LYIA 2FG1A 3SIIA 4P4JA 4MMOA 1NSAA 3NFZA 2ACFA 4JGKA 5CB5A 2PRQA 1CP6A 4P6YA 3KR4A 3WC6A 3IFEA 3FJUA 1CPXA 3PFOA 2F7VA 4B6ZA 3BI0A 3H8GA 4J5RA 3SI1A 1LCPA 3ISXA 4UIAA 8CPAA 4JZ0A 5HIHA 3H8EA 1VHEA 4ETJA 4A39A 2AFSA 2PJ0A 1PCAA 4P4BA 1GYTA 3PB8X 1CG2A 3VATA 3WC7A 3VH9A 4GM5A 2FXKA 4YWYA 6CPAA 4PQAA 3IWWA 4LQGA 2GREA 4J5SA 2JEWA 4H2KA 5DUSA 3SI0A 4MXUA 3H8FA 3HLPA 2AFWA 2CIJA 4PXBA 2ANPA 3T8WA 2AFCA 3IIDA 5CB3A 3BXMA 3NH8A 2RB7A 5FSXA 2XEFA 4PXCA 4EFDA 2NYQA 4IK2A 4EMEA 1BPMA 1ZG9A 1R43A 3D7FA 3D4UA 2PJ3A 3KQZA 1LAMA 3KZWA 2GLFA 2IMOA 3LMSA 3SJFA 4J4ZA 3KHZA 3IIBA 3Q71A 4TU0A 2L8RA 2PVWA 4ABKA 4ZY0A 2BFRA 4R76A 1F57A 3B7IA 3KGQA 4OC4A 1TF9A 1TXZA 2G9DA 5DS0A 1Y0RA 1PYTB 4W9YA 4IQYA 2EK9A 2PJ5A 2RFHA 3S9NA 4P4EA 2PJ4A 3EWQA 4NGQA 4UIBA 4NGRA 2JBKA 4MCRA 2J9AA 3PB6X 4OIDA 4EWTA 7CPAA 2V8VA 3PBBA 4TWEA 3CPAA 4UEEA 4KSIA 2GU2A 2C1CA 3PEIA 2EK8A 4MHYA 4NJQA 1TY8A 3FEEA 3HUVA 4J5QA 2EEEA 2XEJA 4MRIA 1TKFA 3IIFA 2CTBA 5IB9A 3KI9A 1NJRA 2PJ6A 3GLJA 1ZLHA 3PB4X 4OC2A 1ELLP 4GVWA 4P4DA 5LYDA 1QMUA 3GPOA 3FVLA 3QNVA 2Q51A 4O23A 3D67A 3V45A 4MCQA 1F2OA 2ZEHA 1YSJA 4X8IA 2QJ8A 1XRYA 5FSYA 3JRUA 4IHMA 1ZG7A 5FSZA 4JLLA 4YU9A 3S9MA 3FH4A 2BO9A 3CDXA 3DGVA 1VIXA 1BLLE 4X2TA 3PFEA 3PRTA 4NGTA 4ZYQA 1HDQA 3B3TA 3WABA 1ELMP 3ISZA 2AFMA 1AMPA 3GPQA 2V8HA 3N5FA 4FBEA 4NGNA 4OKOA 4Z65A 3JZTA 3PB9X 1M4LA 3EJFA 3GQEA 5K8MA 2V8GA 5K8PA 1RTQA 3B3VA 1AYEA 2JBJA 1OBRA 3FF3A 4OIWA 3IEHA 1BAVA 4OC5A 4A38A 4OC1A 4ABLA 4DYOA 2PJ9A 2C6GA 4P44A 4GVVA 1VHUA 4WJBA 3IC1A 2Q43A 3K2KA 3D68A 2ZEPA 3B3WA 3LWUA 2ZEDA 3EKEA 2XEGA 2V77A 4TNUA 2F8HA 2FAVA 3RAMA 2DX6A 2HC9A 3D7HA 2AFUA 5E3BA 3RBUA 3SJEA 2ZEOA 3B35A 2LGRA 3GPGA 1VGYA 3FECA 4WWVA 3GQOA 2ZEMA 4ZY2A 5JH9A 2PCUA 4UEFA 3KQXA 4X3RA 5LYLA 3SI2A 1CP7A 1DTDA 1TXRA 4PXEA 5ELYA 4ESSA 4P45A 2ZOGA 2BOAA 4D86A 4OMEA 2XEIA 3Q6ZA 1ARMA 3IJ3A 4OC3A 3SIGA 3S9LA 3V2BA 1LAPA 2PJ1A 3DLJA 1YD9A 2ZELA 5D8NA 1Z8LA 4MCSA 5HVGA 3KHXA 2ABZA 4R8FA 4FWUA 4K0CA 2ZOFA 4P4FA 2GLJA 3FX6A 3WT4A 4RUHA 3K9TA 2BFQA 1TF8A 1ZLIA 3CT9A 4R7MA 5THWA 4PPZA 3L2NA 2BCOA 3SJGA 1LANA 4JCAA 5LYFA 1VHOA 3ETIA 4PXDA 1FT7A 2ZEFA 3SIJA 4Q7AA 5I4MA 2ZENA 1IGBA 2NSMA 3EWPA 3FMCA 4MCPA 3B3CA 3I1UA 3IO1A 4FAIA 2PIYA 1DE4C 1FNOA 3BHXA 3SIHA 4G1PA 2PJ7A 3D7GA 5FSVA 1CPSA 1Q7LA 4UF4A 3D7DA 4JVVA 5JGFA 3EJGA 2PJ2A 2PJAA 2QVPA 3EW5A 4F8ZA 2Q4ZA 4NFRA 5CMSA 3WC5A 4ONWA 3BI1A 2C6PA 2C6CA 4FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5R A;  3FED A;  4P4I A;  4UEZ A;  4ETK A;  2QYV A;  4A94 A;  2PJC A;  1ZR5 A;  1IY7 A;  3CPX A;  1F2P A;  4JYW A;  4ZI6 A;  5FSU A;  4NGS A;  1CX8 A;  1XBU A;  4AXV A;  2CF4 A;  4BD9 A;  4IAV A;  3SJX A;  1Y7E A;  3GB0 A;  4F9U A;  5CBM A;  2O53 A;  2DEA A;  5HXD A;  2O4H A;  1EE3 P;  2ZEE A;  4MHZ A;  5LRK A;  1ZR3 A;  4GUA A;  1Y0Y A;  2PVV A;  1BPN A;  4OC0 A;  5LRJ A;  3V38 A;  1R3N A;  5K8O A;  1ARL A;  4ZY1 A;  3MRU A;  5F09 A;  2WYR A;  2PIZ A;  3NH4 A;  1XJO A;  2CTC A;  5HVF A;  2IJZ A;  1XMB A;  3PB7 X;  4F9V A;  2PJB A;  1YLO A;  4KYB A;  3V7Z A;  4MHP A;  2POK A;  1TKH A;  2FVG A;  2PE3 A;  1LFW A;  5CPA A;  2ZEG A;  2VRI A;  1CBX A;  2WZN A;  1TKJ A;  4CPA A;  2V8D A;  5HVH A;  1HDU A;  1KWM A;  4ZX8 A;  1QQ9 A;  4OP4 A;  3VAR A;  4NJR A;  2OOT A;  3RZA A;  5J1Q A;  3KAS A;  1JQG A;  1YW4 A;  5D29 A;  4P10 A;  1ZG8 A;  2PJ8 A;  2AFZ A;  3MN8 A;  4DJL A;  5K8N A;  1HJZ A;  3B2Y A;  3KL9 A;  1YW6 A;  4ZX9 A;  2IQ6 A;  3GUX A;  4A37 A;  5LRG A;  1H8L A;  1HEE A;  1UWY A;  1Z2L A;  2AFO A;  3VFQ A;  1SPV A;  3TX8 A;  4NGM A;  2X47 A;  3NA6 A;  3PBE A;  5HOL A;  3B3S A;  1LOK A;  4NGP A;  4UML A;  2HB6 A;  5AIL A;  2VL1 A;  3KR5 A;  2AFX A;  1XFO A;  2I3C A;  5JM6 A;  3NH5 A;  4MHN A;  4K3N A;  2EWB A;  3EWR A;  3EWO A;  2XD7 A;  1YME A;  3D66 A;  3TC8 A;  4R6T A;  2OR4 A;  4DUK A;  5LYI A;  2FG1 A;  3SII A;  4P4J A;  4MMO A;  1NSA A;  3NFZ A;  2ACF A;  4JGK A;  5CB5 A;  2PRQ A;  1CP6 A;  4P6Y A;  3KR4 A;  3WC6 A;  3IFE A;  3FJU A;  1CPX A;  3PFO A;  2F7V A;  4B6Z A;  3BI0 A;  3H8G A;  4J5R A;  3SI1 A;  1LCP A;  3ISX A;  4UIA A;  8CPA A;  4JZ0 A;  5HIH A;  3H8E A;  1VHE A;  4ETJ A;  4A39 A;  2AFS A;  2PJ0 A;  1PCA A;  4P4B A;  1GYT A;  3PB8 X;  1CG2 A;  3VAT A;  3WC7 A;  3VH9 A;  4GM5 A;  2FXK A;  4YWY A;  6CPA A;  4PQA A;  3IWW A;  4LQG A;  2GRE A;  4J5S A;  2JEW A;  4H2K A;  5DUS A;  3SI0 A;  4MXU A;  3H8F A;  3HLP A;  2AFW A;  2CIJ A;  4PXB A;  2ANP A;  3T8W A;  2AFC A;  3IID A;  5CB3 A;  3BXM A;  3NH8 A;  2RB7 A;  5FSX A;  2XEF A;  4PXC A;  4EFD A;  2NYQ A;  4IK2 A;  4EME A;  1BPM A;  1ZG9 A;  1R43 A;  3D7F A;  3D4U A;  2PJ3 A;  3KQZ A;  1LAM A;  3KZW A;  2GLF A;  2IMO A;  3LMS A;  3SJF A;  4J4Z A;  3KHZ A;  3IIB A;  3Q71 A;  4TU0 A;  2L8R A;  2PVW A;  4ABK A;  4ZY0 A;  2BFR A;  4R76 A;  1F57 A;  3B7I A;  3KGQ A;  4OC4 A;  1TF9 A;  1TXZ A;  2G9D A;  5DS0 A;  1Y0R A;  1PYT B;  4W9Y A;  4IQY A;  2EK9 A;  2PJ5 A;  2RFH A;  3S9N A;  4P4E A;  2PJ4 A;  3EWQ A;  4NGQ A;  4UIB A;  4NGR A;  2JBK A;  4MCR A;  2J9A A;  3PB6 X;  4OID A;  4EWT A;  7CPA A;  2V8V A;  3PBB A;  4TWE A;  3CPA A;  4UEE A;  4KSI A;  2GU2 A;  2C1C A;  3PEI A;  2EK8 A;  4MHY A;  4NJQ A;  1TY8 A;  3FEE A;  3HUV A;  4J5Q A;  2EEE A;  2XEJ A;  4MRI A;  1TKF A;  3IIF A;  2CTB A;  5IB9 A;  3KI9 A;  1NJR A;  2PJ6 A;  3GLJ A;  1ZLH A;  3PB4 X;  4OC2 A;  1ELL P;  4GVW A;  4P4D A;  5LYD A;  1QMU A;  3GPO A;  3FVL A;  3QNV A;  2Q51 A;  4O23 A;  3D67 A;  3V45 A;  4MCQ A;  1F2O A;  2ZEH A;  1YSJ A;  4X8I A;  2QJ8 A;  1XRY A;  5FSY A;  3JRU A;  4IHM A;  1ZG7 A;  5FSZ A;  4JLL A;  4YU9 A;  3S9M A;  3FH4 A;  2BO9 A;  3CDX A;  3DGV A;  1VIX A;  1BLL E;  4X2T A;  3PFE A;  3PRT A;  4NGT A;  4ZYQ A;  1HDQ A;  3B3T A;  3WAB A;  1ELM P;  3ISZ A;  2AFM A;  1AMP A;  3GPQ A;  2V8H A;  3N5F A;  4FBE A;  4NGN A;  4OKO A;  4Z65 A;  3JZT A;  3PB9 X;  1M4L A;  3EJF A;  3GQE A;  5K8M A;  2V8G A;  5K8P A;  1RTQ A;  3B3V A;  1AYE A;  2JBJ A;  1OBR A;  3FF3 A;  4OIW A;  3IEH A;  1BAV A;  4OC5 A;  4A38 A;  4OC1 A;  4ABL A;  4DYO A;  2PJ9 A;  2C6G A;  4P44 A;  4GVV A;  1VHU A;  4WJB A;  3IC1 A;  2Q43 A;  3K2K A;  3D68 A;  2ZEP A;  3B3W A;  3LWU A;  2ZED A;  3EKE A;  2XEG A;  2V77 A;  4TNU A;  2F8H A;  2FAV A;  3RAM A;  2DX6 A;  2HC9 A;  3D7H A;  2AFU A;  5E3B A;  3RBU A;  3SJE A;  2ZEO A;  3B35 A;  2LGR A;  3GPG A;  1VGY A;  3FEC A;  4WWV A;  3GQO A;  2ZEM A;  4ZY2 A;  5JH9 A;  2PCU A;  4UEF A;  3KQX A;  4X3R A;  5LYL A;  3SI2 A;  1CP7 A;  1DTD A;  1TXR A;  4PXE A;  5ELY A;  4ESS A;  4P45 A;  2ZOG A;  2BOA A;  4D86 A;  4OME A;  2XEI A;  3Q6Z A;  1ARM A;  3IJ3 A;  4OC3 A;  3SIG A;  3S9L A;  3V2B A;  1LAP A;  2PJ1 A;  3DLJ A;  1YD9 A;  2ZEL A;  5D8N A;  1Z8L A;  4MCS A;  5HVG A;  3KHX A;  2ABZ A;  4R8F A;  4FWU A;  4K0C A;  2ZOF A;  4P4F A;  2GLJ A;  3FX6 A;  3WT4 A;  4RUH A;  3K9T A;  2BFQ A;  1TF8 A;  1ZLI A;  3CT9 A;  4R7M A;  5THW A;  4PPZ A;  3L2N A;  2BCO A;  3SJG A;  1LAN A;  4JCA A;  5LYF A;  1VHO A;  3ETI A;  4PXD A;  1FT7 A;  2ZEF A;  3SIJ A;  4Q7A A;  5I4M A;  2ZEN A;  1IGB A;  2NSM A;  3EWP A;  3FMC A;  4MCP A;  3B3C A;  3I1U A;  3IO1 A;  4FAI A;  2PIY A;  1DE4 C;  1FNO A;  3BHX A;  3SIH A;  4G1P A;  2PJ7 A;  3D7G A;  5FSV A;  1CPS A;  1Q7L A;  4UF4 A;  3D7D A;  4JVV A;  5JGF A;  3EJG A;  2PJ2 A;  2PJA A;  2QVP A;  3EW5 A;  4F8Z A;  2Q4Z A;  4NFR A;  5CMS A;  3WC5 A;  4ONW A;  3BI1 A;  2C6P A;  2C6C A;  4FUU A; 
#chains in the Genus database with same CATH topology
 1Z5R A;  3FED A;  1U6M A;  4P4I A;  4UEZ A;  4ETK A;  3TO6 A;  4PK2 A;  2QYV A;  4MY0 A;  2FIW A;  2PJC A;  4A94 A;  1ZR5 A;  1MK4 A;  1IY7 A;  5EC4 A;  3CPX A;  1F2P A;  2JEV A;  3IU2 A;  4HNX B;  4KOT A;  4JYW A;  4FD7 A;  4ZI6 A;  5FSU A;  4NGS A;  1CX8 A;  1XBU A;  4AXV A;  5DWN A;  1J4J A;  2CF4 A;  4YGO A;  3UY5 A;  4BBH A;  4IAV A;  4GXH A;  3SJX A;  2FT0 A;  4BD9 A;  1Y7E A;  2ZW4 A;  3GB0 A;  3VWE A;  4F9U A;  5CBM A;  2O53 A;  2DEA A;  4PSX A;  4XNH B;  4A32 A;  2HQY A;  5HXD A;  3G3S A;  2JDD A;  1Y9W A;  2O4H A;  1EE3 P;  2ZEE A;  4UCP A;  4MHZ A;  4NCZ A;  4JJX A;  2Q0Y A;  1ZR3 A;  3W6X A;  5A27 A;  5KTA A;  4CGM A;  5LRK A;  3F8K A;  4GUA A;  2JZD A;  5F47 A;  1Y0Y A;  4KSF A;  2HV2 A;  2PVV A;  1BPN A;  4OC0 A;  5LRJ A;  3S6F A;  1R3N A;  4KZT A;  1ARL A;  3V38 A;  4ZY1 A;  5K8O A;  3MRU A;  5F09 A;  2WYR A;  3FB3 A;  3W6S A;  2PIZ A;  3NH4 A;  2OZH A;  1XJO A;  2AJ6 A;  2CTC A;  3KKW A;  3EY5 A;  5HVF A;  1Y9K A;  2IJZ A;  1XMB A;  2OH1 A;  3PB7 X;  4CGL A;  4F9V A;  2DPS A;  2PJB A;  4A30 A;  1YLO A;  4KYB A;  4MFL A;  3S6H A;  5C88 A;  3V7Z A;  4MHP A;  2POK A;  4QB9 A;  1TKH A;  2FVG A;  2PE3 A;  1LFW A;  4DNC A;  5CPA A;  2ZEG A;  3IWG A;  2B4D A;  4XPK A;  2FCK A;  2VRI A;  2ZPA A;  1CBX A;  1Q2Y A;  4UFV A;  3SXN A;  1QST A;  4UCM A;  2WZN A;  1TKJ A;  4UA3 A;  3QAH A;  1SQH A;  1XIX A;  2V8D A;  4CPA A;  5HVH A;  1CM0 A;  1HDU A;  1KWM A;  4CGP A;  4ZX8 A;  1QQ9 A;  2CNS A;  5JQ4 A;  1YGH A;  4OP4 A;  3DR6 A;  3VAR A;  2ARH A;  4IUS A;  2YNC C;  4E0A A;  4NJR A;  4MJ8 A;  1KUY A;  2OOT A;  3RZA A;  5J1Q A;  3KAS A;  3S6G A;  1JQG A;  1YW4 A;  5BWA B;  4MHD A;  4P10 A;  5D29 A;  3D3S A;  1ZG8 A;  2C27 A;  2PJ8 A;  2AFZ A;  4IF5 A;  3MN8 A;  4DJL A;  5K8N A;  1HJZ A;  2FSR A;  3B2Y A;  1YW6 A;  3KL9 A;  4ZX9 A;  2IQ6 A;  3GUX A;  1WK4 A;  2CNT A;  3NE8 A;  3TO7 A;  3R9F A;  4A37 A;  1XOV A;  1H8L A;  1HEE A;  2BL1 A;  5LRG A;  2GIV A;  5G1Z A;  1UWY A;  1B6B A;  1Z2L A;  2AFO A;  1R57 A;  1OZP A;  4LQ6 A;  3VFQ A;  1SPV A;  2R98 A;  3TX8 A;  1BO4 A;  2X47 A;  4JD6 A;  2O28 A;  4NGM A;  4KUB A;  2B58 A;  3NA6 A;  3D2M A;  1Q2D A;  3PBE A;  4JWP A;  3RYO A;  3S6K A;  5HOL A;  1P4N A;  4UWJ A;  3B3S A;  1LOK A;  2Q4V A;  4K30 A;  4NGP A;  4UML A;  3RNZ A;  2HB6 A;  5AIL A;  2VL1 A;  3KR5 A;  4FD5 A;  4B5P A;  3ZZI A;  2ZW7 A;  4A33 A;  2AFX A;  1XFO A;  2Z11 A;  4PK3 A;  2I3C A;  4MFK A;  5JM6 A;  1IYK A;  2OZG A;  3FRM A;  3NH5 A;  4K3N A;  4MHN A;  4OAE A;  2EWB A;  3EWR A;  3EWO A;  2XD7 A;  1YME A;  3D66 A;  3TC8 A;  3R9G A;  2JZE A;  3F5B A;  4R6T A;  2OR4 A;  4CYP A;  2J8R A;  4DUK A;  4MFP A;  3FIX A;  3H4Q A;  1IOI A;  4M3S A;  5LYI A;  2FG1 A;  3BJ7 A;  3P2H A;  3SII A;  4R87 A;  4P4J A;  4MMO A;  1M44 A;  4A2Z A;  3IU1 A;  1NSA A;  3NFZ A;  5IV0 A;  1XEB A;  2ACF A;  3CXQ A;  4JGK A;  5CB5 A;  2PRQ A;  1CP6 A;  4P6Y A;  3KR4 A;  2P6G A;  3WC6 A;  3IFE A;  4R3K A;  3FJU A;  1CPX A;  3PFO A;  2BSW A;  2F7V A;  2Z3L A;  3BI0 A;  3D8P A;  3H8G A;  4J5R A;  3EC4 A;  3CXS A;  4B6Z A;  2R1I A;  1B87 A;  1UFH A;  2GAN A;  3SI1 A;  1LCP A;  2QEC A;  3ISX A;  4UIA A;  8CPA A;  4JZ0 A;  4CYO A;  5F46 A;  5HIH A;  3H8E A;  1VHE A;  2EVN A;  4ETJ A;  4A39 A;  2AFS A;  2PJ0 A;  3GIU A;  2FXF A;  1QSR A;  1PCA A;  4CYQ A;  4P4B A;  4CAW A;  1GYT A;  4MFJ A;  3PB8 X;  1CG2 A;  4MI4 A;  2BEI A;  3TFY A;  4ONU A;  3VAT A;  3WC7 A;  1KZF A;  1VHS A;  4JXR A;  3VH9 A;  2ODF A;  3LOD A;  4GM5 A;  2FXK A;  4YWY A;  6CPA A;  2B3V A;  2A4N A;  4PQA A;  5I0C A;  4RI1 A;  2Z3P A;  1GHE A;  4UFW A;  3IWW A;  2G3A A;  2CXA A;  4LQG A;  2GRE A;  4J5S A;  4PSW A;  2JEW A;  4H2K A;  5DUS A;  4AG7 A;  4II9 A;  3SI0 A;  4KOW A;  4MXU A;  2D4O A;  3GY9 A;  3H8F A;  1XMT A;  3HLP A;  2AFW A;  2CIJ A;  2QIR A;  3BLN A;  3JUW A;  4C2X A;  4PXB A;  4AVB A;  1KUX A;  2ANP A;  3T8W A;  2AFC A;  3IID A;  5CB3 A;  1CJW A;  3BXM A;  3NH8 A;  2RB7 A;  5FSX A;  2XEF A;  1L0C A;  4PXC A;  3TO9 A;  4EFD A;  2NYQ A;  3P2F A;  4F0Y A;  4IK2 A;  4EME A;  1BPM A;  1ZG9 A;  1R43 A;  2Z3N A;  3D7F A;  3D4U A;  2PJ3 A;  3BJ8 A;  3WR7 A;  3KQZ A;  1LAM A;  3KZW A;  2GLF A;  1A2Z A;  1FY7 A;  2IMO A;  5AG6 A;  2P6E A;  2JZF A;  1JWQ A;  4R57 A;  1IIC A;  3LMS A;  3SJF A;  1RXT A;  4J4Z A;  3KHZ A;  4RN7 A;  3IIB A;  4Q38 A;  3Q71 A;  3V8I A;  2G0B A;  3K9U A;  4TU0 A;  2ZW5 A;  4YRH A;  2L8R A;  3DSB A;  4ABK A;  2PVW A;  4ZY0 A;  4HNY B;  2BFR A;  4OAD A;  5E96 A;  4HPS A;  3FNC A;  4R76 A;  5AG5 A;  2REE A;  5KTD A;  1F57 A;  4KOS A;  4CRZ B;  3B7I A;  5G21 A;  4H89 A;  1QSN A;  4B11 A;  3KGQ A;  4OC4 A;  1TF9 A;  1TXZ A;  1IB1 E;  4C2Z A;  2G9D A;  3TCV A;  5ISV A;  5DS0 A;  1Y0R A;  3JVN A;  4L89 A;  1PYT B;  4CAV A;  4W9Y A;  4IQY A;  2EK9 A;  2PJ5 A;  2RFH A;  2Q7S A;  2R8V A;  3S9N A;  4P4E A;  1Y7R A;  2PJ4 A;  3EWQ A;  2B5G B;  4NGQ A;  4UIB A;  2VI7 A;  4NGR A;  1NE9 A;  2FS5 A;  2JBK A;  5F48 A;  2DXQ A;  1QSM A;  2KQV A;  4MCR A;  1MJ9 A;  1YVK A;  1Z8X A;  2J9A A;  1ZO0 A;  2OZU A;  3B8G A;  1YLE A;  3PB6 X;  4OID A;  1NSL A;  4EWT A;  7CPA A;  4U9Z A;  1MJB A;  2YNE A;  4NXY A;  2DF5 A;  2V8V A;  3PBB A;  3E0K A;  4TWE A;  3CPA A;  2YGW A;  4KSI A;  4UEE A;  2GU2 A;  2C1C A;  4KOV A;  1WWZ A;  3PEI A;  2EK8 A;  2Q7B A;  4A31 A;  3C26 A;  4MHY A;  4KUA A;  4NJQ A;  1TY8 A;  1YQE A;  2W2G A;  3FEE A;  3IWE A;  4XPD C;  3T9Y A;  3HUV A;  4J5Q A;  2EEE A;  2XEJ A;  3PZJ A;  1TKF A;  3IIF A;  1I21 A;  2CTB A;  2IL4 A;  2P0W A;  4MRI A;  1YVO A;  4RS2 A;  5IB9 A;  3TTH A;  4UCN A;  1Z9U A;  3KI9 A;  5EBV A;  1XF8 A;  4F0X A;  1NJR A;  4NEX A;  4FD4 A;  2PJ6 A;  4MFQ A;  3GLJ A;  1ZLH A;  3ZJ0 A;  4AVA A;  2PRB A;  2PSW A;  3PB4 X;  4OC2 A;  4Q36 A;  4B14 A;  1ELL P;  3G8W A;  1PUA A;  1VKC A;  4GVW A;  4P4D A;  5LYD A;  1QMU A;  3R95 A;  3GPO A;  3FVL A;  4OLL A;  1M1D A;  3LD2 A;  2DPT A;  3QNV A;  2Q51 A;  5HMN A;  4O23 A;  3D67 A;  2REF A;  3V45 A;  4MCQ A;  5H86 A;  2J8N A;  4M6G A;  1F2O A;  1MJA A;  2NMT A;  2ZEH A;  4KVM E;  4B12 A;  2WPX A;  1XE4 A;  4KOY A;  1M4G A;  1YSJ A;  3PGP A;  4B13 A;  4X8I A;  4E2A A;  2QJ8 A;  2RC4 A;  4LX9 A;  1XRY A;  5FSY A;  4ZGY B;  3JRU A;  3TT2 A;  3I3G A;  3TOA A;  1V0C A;  1ZG7 A;  4IHM A;  3PP9 A;  5FSZ A;  2G3T A;  4KOU A;  2Z10 A;  1AUG A;  4YFJ A;  4JLL A;  4YU9 A;  3S9M A;  3OWC A;  3FH4 A;  4C2Y A;  2WCT A;  2BO9 A;  3CDX A;  3DGV A;  1VIX A;  1BLL E;  4X2T A;  3PFE A;  2VZY A;  3PRT A;  4NGT A;  4ZYQ A;  4KSA A;  4R9M A;  1HDQ A;  3B3T A;  3WAB A;  4MBU A;  5EMI A;  5J8F A;  1Z8W A;  5C82 A;  4XPD B;  5KTC A;  4QBJ A;  1S3Z A;  2B5G A;  1ELM P;  1IU8 A;  3ISZ A;  2AFM A;  4FD6 A;  3JTK A;  3DNS A;  4I49 A;  4GS4 A;  3R1K A;  3NE7 A;  4PV6 A;  1TIQ A;  2VBQ A;  1AMP A;  1X12 A;  2I79 A;  3GPQ A;  2V8H A;  1IYL A;  3N5F A;  4FBE A;  4NGN A;  4OKO A;  2RNK A;  4Z65 A;  3JZT A;  5A28 A;  3PB9 X;  2J8M A;  1M4L A;  1S7N A;  3EJF A;  3GQE A;  5K8M A;  2V8G A;  2Q4Y A;  5K8P A;  1Z4R A;  1RTQ A;  1NMT A;  4XPL A;  1AYE A;  3B3V A;  4NSQ A;  4C68 A;  2JBJ A;  2JDC A;  2GE3 A;  4L8A A;  1OBR A;  3FF3 A;  4OIW A;  2Q04 A;  3IEH A;  1BAV A;  2EUI A;  4C7I A;  5AGE A;  4OC5 A;  4U9Y A;  4HNW B;  4ABL A;  3CZX A;  4OC1 A;  4A38 A;  4KVO E;  2PJ9 A;  4KOR A;  4DYO A;  2FIA A;  2C6G A;  3LAC A;  3FYN A;  4P44 A;  2PR8 A;  3D2P A;  4E8O A;  4GVV A;  2VXK A;  4H6Z A;  4QC6 A;  3DDD A;  1S5K A;  1VHU A;  4WJB A;  5J8C A;  3IC1 A;  2Q43 A;  1Q2C A;  3A9L A;  3QB8 A;  4CRY B;  3K2K A;  3D68 A;  1S7L A;  4UWI A;  2ZEP A;  4NF1 A;  3B3W A;  5IX3 A;  4QVT A;  3LWU A;  1P0H A;  4B5P B;  2ZED A;  4CGO A;  4KLV A;  3EKE A;  4CAE A;  2XEG A;  2YNC A;  2V77 A;  4TNU A;  2F8H A;  2FAV A;  3RAM A;  2DX6 A;  2HC9 A;  3D7H A;  4CAX A;  2AFU A;  2FE7 A;  5E3B A;  4LUA A;  3RBU A;  3SJE A;  1KUV A;  2ZEO A;  3B35 A;  2LGR A;  3GPG A;  3TE4 A;  4Y49 C;  1VGY A;  2AE6 A;  5DWM A;  3FEC A;  3FXT A;  3GQO A;  4ZY2 A;  2ZEM A;  2JLM A;  4WWV A;  3R9E A;  5JH9 A;  2PCU A;  4UEF A;  2OU2 A;  4CS0 B;  3KQX A;  4X3R A;  4C7H A;  5LYL A;  2Z3K A;  2FL4 A;  4U5Y A;  4UBR A;  2Z0Z A;  3R96 A;  3SI2 A;  1K4J A;  4KLW A;  1N71 A;  2GFQ A;  2QML A;  3EXN A;  3W91 A;  4A95 A;  1CP7 A;  1DTD A;  1TXR A;  5CNP A;  4AVC A;  4F6A A;  4PXE A;  2WPW A;  1IID A;  5ELY A;  4R3L A;  4ESS A;  4P45 A;  3I9S A;  4UFX A;  4ORF A;  4B5O A;  4AB7 A;  3N7Z A;  2ZOG A;  2BOA A;  5H84 A;  4BMH A;  4D86 A;  4HKF A;  4OME A;  3VWD A;  1S60 A;  1PU9 A;  2VQY A;  3RO0 A;  2XEI A;  3Q6Z A;  2PQ8 A;  4AG9 A;  5IB0 A;  1ARM A;  2Z3O A;  2EBJ A;  3IJ3 A;  2WSA A;  4OC3 A;  3DR8 A;  3SIG A;  3EO4 A;  3S9L A;  2PR1 A;  3EFA A;  2Z3M A;  3V2B A;  2HUZ A;  3GYA A;  4MFZ A;  1LAP A;  4JXQ A;  2PJ1 A;  3DLJ A;  1YD9 A;  1ON0 A;  2ZEL A;  5D8N A;  1Z4E A;  2EO8 A;  4H6U A;  4J3G A;  4EVY A;  1Z8L A;  4MCS A;  5G22 A;  2VZZ A;  5HVG A;  3CXP A;  3MGD A;  2ZW6 A;  3KHX A;  2ABZ A;  4R8F A;  4CGN A;  4FWU A;  1M4D A;  2Y0M A;  4MY3 A;  4K0C A;  1X10 A;  2ZOF A;  4P4F A;  3TOB A;  2GLJ A;  4QUS A;  4KOX A;  3FX6 A;  3WT4 A;  1YX0 A;  4RUH A;  1I12 A;  4Y49 B;  2I00 A;  3K9T A;  2BFQ A;  1TF8 A;  5AG4 A;  5LYF A;  5GCN A;  3T90 A;  2D4P A;  2ATR A;  1ZLI A;  3CT9 A;  4KVX A;  4R7M A;  5THW A;  4PPZ A;  2WUU A;  3L2N A;  2PDO A;  2BCO A;  4X5K A;  2YND A;  3SJG A;  2ZXV A;  5G20 A;  3IGR A;  1LAN A;  4JCA A;  2CY2 A;  1VHO A;  2B4B A;  3QAY A;  4JLY A;  3ETI A;  4M6H A;  1I1D A;  4PXD A;  5AG7 A;  1FT7 A;  5HH1 A;  2ZEF A;  3SIJ A;  4Q7A A;  5I4M A;  2ZEN A;  3FBU A;  1IGB A;  1IOF A;  2NSM A;  3SHP A;  3EWP A;  2F5I A;  4B10 A;  5FVJ A;  3FMC A;  2CNM A;  4MCP A;  4XNH C;  5F49 A;  2Q44 A;  3B3C A;  3I1U A;  3IO1 A;  4M6I A;  4FAI A;  1Z8T A;  2PIY A;  1LRZ A;  2B4D B;  1DE4 C;  1M4I A;  3SXO A;  2P6F A;  1FNO A;  1YR0 A;  2B3U A;  3SIH A;  1BOB A;  3BHX A;  1RO5 A;  2BUE A;  2OB0 A;  1YRE A;  4G1P A;  1S7F A;  2PJ7 A;  3D7G A;  5FSV A;  1CPS A;  1Q7L A;  4UF4 A;  3D7D A;  4JVV A;  1QSO A;  4M85 A;  5JGF A;  3EJG A;  2PJ2 A;  1YK3 A;  2K5T A;  4ZBG A;  4CAF A;  2PJA A;  2QVP A;  5JPH A;  3EW5 A;  4F8Z A;  2Q4Z A;  2VEZ A;  4CYN A;  2H5M A;  2KCW A;  3F0A A;  4BIN A;  3GKR A;  4NFR A;  4KS9 A;  5CMS A;  3WC5 A;  4ONW A;  3BI1 A;  3H5Z A;  2C6P A;  1S7K A;  2R7H A;  2X7B A;  2PC1 A;  2C6C A;  4FUU A; 
#chains in the Genus database with same CATH homology
 1Z5R A;  3FED A;  4P4I A;  4UEZ A;  4ETK A;  2QYV A;  4A94 A;  2PJC A;  1ZR5 A;  1IY7 A;  3CPX A;  1F2P A;  4JYW A;  4ZI6 A;  5FSU A;  4NGS A;  1CX8 A;  1XBU A;  4AXV A;  2CF4 A;  4BD9 A;  4IAV A;  3SJX A;  1Y7E A;  3GB0 A;  4F9U A;  5CBM A;  2O53 A;  2DEA A;  5HXD A;  2O4H A;  1EE3 P;  2ZEE A;  4MHZ A;  5LRK A;  1ZR3 A;  4GUA A;  1Y0Y A;  2PVV A;  1BPN A;  4OC0 A;  5LRJ A;  3V38 A;  1R3N A;  5K8O A;  1ARL A;  4ZY1 A;  3MRU A;  5F09 A;  2WYR A;  2PIZ A;  3NH4 A;  1XJO A;  2CTC A;  5HVF A;  2IJZ A;  1XMB A;  3PB7 X;  4F9V A;  2PJB A;  1YLO A;  4KYB A;  3V7Z A;  4MHP A;  2POK A;  1TKH A;  2FVG A;  2PE3 A;  1LFW A;  5CPA A;  2ZEG A;  2VRI A;  1CBX A;  2WZN A;  1TKJ A;  4CPA A;  2V8D A;  5HVH A;  1HDU A;  1KWM A;  4ZX8 A;  1QQ9 A;  4OP4 A;  3VAR A;  4NJR A;  2OOT A;  3RZA A;  5J1Q A;  3KAS A;  1JQG A;  1YW4 A;  5D29 A;  4P10 A;  1ZG8 A;  2PJ8 A;  2AFZ A;  3MN8 A;  4DJL A;  5K8N A;  1HJZ A;  3B2Y A;  3KL9 A;  1YW6 A;  4ZX9 A;  2IQ6 A;  3GUX A;  4A37 A;  5LRG A;  1H8L A;  1HEE A;  1UWY A;  1Z2L A;  2AFO A;  3VFQ A;  1SPV A;  3TX8 A;  4NGM A;  2X47 A;  3NA6 A;  3PBE A;  5HOL A;  3B3S A;  1LOK A;  4NGP A;  4UML A;  2HB6 A;  5AIL A;  2VL1 A;  3KR5 A;  2AFX A;  1XFO A;  2I3C A;  5JM6 A;  3NH5 A;  4MHN A;  4K3N A;  2EWB A;  3EWR A;  3EWO A;  2XD7 A;  1YME A;  3D66 A;  3TC8 A;  4R6T A;  2OR4 A;  4DUK A;  5LYI A;  2FG1 A;  3SII A;  4P4J A;  4MMO A;  1NSA A;  3NFZ A;  2ACF A;  4JGK A;  5CB5 A;  2PRQ A;  1CP6 A;  4P6Y A;  3KR4 A;  3WC6 A;  3IFE A;  3FJU A;  1CPX A;  3PFO A;  2F7V A;  4B6Z A;  3BI0 A;  3H8G A;  4J5R A;  3SI1 A;  1LCP A;  3ISX A;  4UIA A;  8CPA A;  4JZ0 A;  5HIH A;  3H8E A;  1VHE A;  4ETJ A;  4A39 A;  2AFS A;  2PJ0 A;  1PCA A;  4P4B A;  1GYT A;  3PB8 X;  1CG2 A;  3VAT A;  3WC7 A;  3VH9 A;  4GM5 A;  2FXK A;  4YWY A;  6CPA A;  4PQA A;  3IWW A;  4LQG A;  2GRE A;  4J5S A;  2JEW A;  4H2K A;  5DUS A;  3SI0 A;  4MXU A;  3H8F A;  3HLP A;  2AFW A;  2CIJ A;  4PXB A;  2ANP A;  3T8W A;  2AFC A;  3IID A;  5CB3 A;  3BXM A;  3NH8 A;  2RB7 A;  5FSX A;  2XEF A;  4PXC A;  4EFD A;  2NYQ A;  4IK2 A;  4EME A;  1BPM A;  1ZG9 A;  1R43 A;  3D7F A;  3D4U A;  2PJ3 A;  3KQZ A;  1LAM A;  3KZW A;  2GLF A;  2IMO A;  3LMS A;  3SJF A;  4J4Z A;  3KHZ A;  3IIB A;  3Q71 A;  4TU0 A;  2L8R A;  2PVW A;  4ABK A;  4ZY0 A;  2BFR A;  4R76 A;  1F57 A;  3B7I A;  3KGQ A;  4OC4 A;  1TF9 A;  1TXZ A;  2G9D A;  5DS0 A;  1Y0R A;  1PYT B;  4W9Y A;  4IQY A;  2EK9 A;  2PJ5 A;  2RFH A;  3S9N A;  4P4E A;  2PJ4 A;  3EWQ A;  4NGQ A;  4UIB A;  4NGR A;  2JBK A;  4MCR A;  2J9A A;  3PB6 X;  4OID A;  4EWT A;  7CPA A;  2V8V A;  3PBB A;  4TWE A;  3CPA A;  4UEE A;  4KSI A;  2GU2 A;  2C1C A;  3PEI A;  2EK8 A;  4MHY A;  4NJQ A;  1TY8 A;  3FEE A;  3HUV A;  4J5Q A;  2EEE A;  2XEJ A;  4MRI A;  1TKF A;  3IIF A;  2CTB A;  5IB9 A;  3KI9 A;  1NJR A;  2PJ6 A;  3GLJ A;  1ZLH A;  3PB4 X;  4OC2 A;  1ELL P;  4GVW A;  4P4D A;  5LYD A;  1QMU A;  3GPO A;  3FVL A;  3QNV A;  2Q51 A;  4O23 A;  3D67 A;  3V45 A;  4MCQ A;  1F2O A;  2ZEH A;  1YSJ A;  4X8I A;  2QJ8 A;  1XRY A;  5FSY A;  3JRU A;  4IHM A;  1ZG7 A;  5FSZ A;  4JLL A;  4YU9 A;  3S9M A;  3FH4 A;  2BO9 A;  3CDX A;  3DGV A;  1VIX A;  1BLL E;  4X2T A;  3PFE A;  3PRT A;  4NGT A;  4ZYQ A;  1HDQ A;  3B3T A;  3WAB A;  1ELM P;  3ISZ A;  2AFM A;  1AMP A;  3GPQ A;  2V8H A;  3N5F A;  4FBE A;  4NGN A;  4OKO A;  4Z65 A;  3JZT A;  3PB9 X;  1M4L A;  3EJF A;  3GQE A;  5K8M A;  2V8G A;  5K8P A;  1RTQ A;  3B3V A;  1AYE A;  2JBJ A;  1OBR A;  3FF3 A;  4OIW A;  3IEH A;  1BAV A;  4OC5 A;  4A38 A;  4OC1 A;  4ABL A;  4DYO A;  2PJ9 A;  2C6G A;  4P44 A;  4GVV A;  1VHU A;  4WJB A;  3IC1 A;  2Q43 A;  3K2K A;  3D68 A;  2ZEP A;  3B3W A;  3LWU A;  2ZED A;  3EKE A;  2XEG A;  2V77 A;  4TNU A;  2F8H A;  2FAV A;  3RAM A;  2DX6 A;  2HC9 A;  3D7H A;  2AFU A;  5E3B A;  3RBU A;  3SJE A;  2ZEO A;  3B35 A;  2LGR A;  3GPG A;  1VGY A;  3FEC A;  4WWV A;  3GQO A;  2ZEM A;  4ZY2 A;  5JH9 A;  2PCU A;  4UEF A;  3KQX A;  4X3R A;  5LYL A;  3SI2 A;  1CP7 A;  1DTD A;  1TXR A;  4PXE A;  5ELY A;  4ESS A;  4P45 A;  2ZOG A;  2BOA A;  4D86 A;  4OME A;  2XEI A;  3Q6Z A;  1ARM A;  3IJ3 A;  4OC3 A;  3SIG A;  3S9L A;  3V2B A;  1LAP A;  2PJ1 A;  3DLJ A;  1YD9 A;  2ZEL A;  5D8N A;  1Z8L A;  4MCS A;  5HVG A;  3KHX A;  2ABZ A;  4R8F A;  4FWU A;  4K0C A;  2ZOF A;  4P4F A;  2GLJ A;  3FX6 A;  3WT4 A;  4RUH A;  3K9T A;  2BFQ A;  1TF8 A;  1ZLI A;  3CT9 A;  4R7M A;  5THW A;  4PPZ A;  3L2N A;  2BCO A;  3SJG A;  1LAN A;  4JCA A;  5LYF A;  1VHO A;  3ETI A;  4PXD A;  1FT7 A;  2ZEF A;  3SIJ A;  4Q7A A;  5I4M A;  2ZEN A;  1IGB A;  2NSM A;  3EWP A;  3FMC A;  4MCP A;  3B3C A;  3I1U A;  3IO1 A;  4FAI A;  2PIY A;  1DE4 C;  1FNO A;  3BHX A;  3SIH A;  4G1P A;  2PJ7 A;  3D7G A;  5FSV A;  1CPS A;  1Q7L A;  4UF4 A;  3D7D A;  4JVV A;  5JGF A;  3EJG A;  2PJ2 A;  2PJA A;  2QVP A;  3EW5 A;  4F8Z A;  2Q4Z A;  4NFR A;  5CMS A;  3WC5 A;  4ONW A;  3BI1 A;  2C6P A;  2C6C A;  4FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...