4ZYQA

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10s
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
519
structure length
517
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 172
structure length 517
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zyqA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zyqA02
1CP6A 2PJ3A 1HEEA 4JLLA 3V2BA 1XBUA 1ARMA 1NSAA 3PB4X 3RBUA 3MRUA 4W9YA 2GREA 2FXKA 1VGYA 4NGQA 4NGSA 4ZY1A 4FWUA 2ZEDA 5I4MA 2ABZA 4P6YA 2IQ6A 3SI1A 3D66A 1BPNA 1RTQA 3PB8X 3K9TA 4Z65A 4MCPA 3NH8A 1XMBA 4ESSA 2IMOA 2LGRA 2AFXA 1XRYA 4OIWA 3GB0A 3CPXA 2JBKA 1Z8LA 5JGFA 3GPOA 2AFZA 3IWWA 3L2NA 1DTDA 3TX8A 1F2PA 1TF8A 4MCRA 3FEEA 4R76A 3Q6ZA 4PXDA 3H8FA 4X3RA 5DS0A 2EK8A 3S9LA 3I1UA 3BHXA 4F8ZA 2CTBA 1ELMP 2IJZA 1Y7EA 1YSJA 3IC1A 3GPQA 3SJXA 3H8GA 5D29A 4K0CA 1TKHA 6CPAA 1CPXA 1LAMA 1ZR5A 4OC2A 2JBJA 3D68A 4NGNA 2ZEEA 3EWQA 2PJCA 4OC4A 4A94A 1M4LA 3RAMA 2PE3A 1PYTB 3NH5A 3S9NA 4P4DA 4ZYQA 1YD9A 2ZOGA 2PRQA 2V77A 2AFWA 3PB7X 2WYRA 4J4ZA 3IIFA 1UWYA 4P45A 4ETKA 4G1PA 4UMLA 2GU2A 4MCSA 1Z2LA 3SJEA 3CPAA 2FAVA 3LWUA 1LOKA 4DYOA 3ETIA 1VIXA 1CP7A 1TKFA 1GYTA 4P4EA 2PJ1A 5CBMA 2VL1A 5HOLA 1IY7A 4PPZA 2RB7A 3SIGA 4J5SA 2PVWA 4EFDA 3JZTA 2AFOA 3FMCA 3Q71A 4P4IA 3SJFA 1LAPA 4R7MA 2HC9A 4NJQA 3KR5A 3QNVA 3NFZA 3NH4A 4DJLA 3EKEA 2O4HA 4K3NA 3IIDA 3B3TA 2DEAA 3HLPA 3B3WA 2AFUA 3FJUA 3WC7A 4P4FA 1XJOA 3SI0A 3SI2A 3KGQA 5AILA 2VRIA 3K2KA 2F8HA 3PEIA 4OKOA 4P4JA 4OC5A 2V8GA 3WT4A 3EWPA 3KI9A 2CIJA 1NJRA 2PVVA 3B7IA 3D7HA 3EJGA 4YWYA 1VHOA 3D4UA 3KQXA 2G9DA 3MN8A 2ANPA 1ZLIA 1H8LA 4JCAA 4IQYA 2ZEHA 4JVVA 4MHNA 4Q7AA 1AMPA 1HJZA 1YW4A 2Q51A 2RFHA 4NJRA 4UF4A 7CPAA 2PCUA 2PIZA 2BCOA 4A39A 2ZELA 8CPAA 2ZEMA 3PB6X 2POKA 5F09A 4MRIA 2C6PA 3D7DA 4AXVA 1TKJA 4JGKA 4UEFA 2X47A 1QMUA 1SPVA 4IHMA 3HUVA 5HVFA 3D67A 3GUXA 3KL9A 2PJBA 2AFSA 4OMEA 5LRGA 5LYLA 2WZNA 3KHXA 3D7FA 4MHPA 4IK2A 1LCPA 3B3SA 2EEEA 2DX6A 3B3VA 4MHZA 5HVHA 4ZY2A 3KR4A 5E3BA 4OC1A 5K8NA 3RZAA 5J1QA 3FECA 3GQOA 4O23A 3VH9A 4PXCA 4UEZA 4NFRA 2GLJA 3WABA 2OOTA 2ZEOA 5D8NA 1ELLP 1PCAA 1CBXA 3VATA 5JH9A 2AFCA 1FT7A 2AFMA 1ARLA 3LMSA 1LANA 3GQEA 4ETJA 1YLOA 4JZ0A 3PRTA 3KASA 3NA6A 1EE3P 4PQAA 3BXMA 4UIBA 5LRKA 2CF4A 3V7ZA 2HB6A 2J9AA 3IO1A 4ZY0A 4FBEA 1Y0RA 4P4BA 2PIYA 3WC6A 5IB9A 2Q43A 2Q4ZA 3H8EA 2QVPA 3S9MA 2OR4A 5LYIA 4P10A 3FVLA 3SIJA 2V8VA 1BAVA 5K8OA 1TY8A 4KYBA 4CPAA 4R6TA 3B35A 3PBBA 4IAVA 5LYDA 3B3CA 3N5FA 1F57A 2ACFA 5LYFA 4D86A 4F9UA 3EWRA 2PJ8A 4TNUA 3IEHA 4OC0A 1CX8A 1DE4C 2V8HA 3VARA 1ZG9A 4DUKA 4NGPA 3FH4A 1VHEA 1F2OA 4MCQA 4ZX9A 1Q7LA 3KQZA 4GUAA 1QQ9A 2C6GA 3ISXA 4ONWA 3WC5A 2GLFA 5FSYA 4H2KA 2ZEGA 5JM6A 2L8RA 5ELYA 1TXZA 3KHZA 2XEFA 1CG2A 2PJ9A 2XEJA 1XFOA 4JYWA 3KZWA 3PBEA 2PJ7A 2FG1A 1Z5RA 4YU9A 3SJGA 4FUUA 4NGRA 2C1CA 4P44A 1BLLE 1AYEA 4ZI6A 4A38A 5HIHA 2XEIA 3FEDA 5CB5A 1ZG7A 2ZEPA 2BO9A 4ABLA 2BFQA 1TF9A 3JRUA 3B2YA 1JQGA 2XD7A 4GVWA 2PJAA 3PFEA 4PXBA 3IIBA 2PJ6A 2QJ8A 2PJ0A 3D7GA 4GM5A 2BOAA 3DGVA 4MMOA 4OC3A 3FF3A 5CB3A 4EWTA 5LRJA 2PJ2A 4LQGA 4J5QA 3FX6A 4R8FA 1VHUA 2NSMA 5THWA 2NYQA 4KSIA 4X8IA 4F9VA 2PJ4A 4GVVA 5FSZA 1FNOA 3BI0A 5HVGA 5CMSA 1CPSA 1KWMA 3PFOA 4OP4A 5CPAA 1OBRA 3EWOA 4EMEA 2BFRA 5K8MA 3ISZA 3DLJA 1Y0YA 4ZX8A 4X2TA 3GLJA 2F7VA 2PJ5A 1ZLHA 3T8WA 4FAIA 2QYVA 4NGTA 2ZOFA 1HDQA 3SIIA 2ZENA 3PB9X 4WJBA 1TXRA 3BI1A 3EJFA 3CDXA 1R43A 4NGMA 3GPGA 1ZR3A 3CT9A 2EWBA 2FVGA 4A37A 5FSUA 1LFWA 1YW6A 2XEGA 4RUHA 1ZG8A 3VFQA 4ABKA 2O53A 5K8PA 3EW5A 2ZEFA 5FSVA 1BPMA 4OIDA 2JEWA 5HXDA 4UEEA 4MXUA 4J5RA 4B6ZA 1IGBA 1YMEA 5FSXA 4WWVA 1R3NA 4BD9A 2CTCA 4UIAA 4TU0A 2C6CA 3IJ3A 3SIHA 1HDUA 2I3CA 3V38A 4MHYA 4TWEA 2V8DA 3TC8A 5DUSA 3IFEA 2EK9A 4PXEA 3V45A
chains in the Genus database with same CATH superfamily
2RNKA 2NMTA 1CP6A 1Z8XA 2PQ8A 3H4QA 2Z3LA 4ZBGA 2PJ3A 1HEEA 4JLLA 1VKCA 3V2BA 2OU2A 4CS0B 1S7KA 1XBUA 4II9A 1ARMA 1NSAA 3PB4X 3DNSA 4YGOA 3RBUA 4NF1A 2Q7BA 3MRUA 4IF5A 4XNHC 2R8VA 4W9YA 3QAYA 2GREA 4HKFA 4KOUA 2FXKA 1VGYA 3NE7A 3OWCA 4NGQA 4ZY1A 4NGSA 4FWUA 4OLLA 5EBVA 3D2PA 2ZEDA 4HNYB 5I4MA 2ABZA 4P6YA 2IQ6A 2VI7A 4B5PB 2W2GA 3SI1A 4B5PA 3D66A 1BPNA 1RTQA 3PB8X 3IWGA 3F5BA 3R1KA 3K9TA 4C2XA 4Z65A 3H5ZA 4MCPA 3NH8A 3TCVA 1XMBA 4ESSA 2IMOA 2LGRA 2GE3A 2AFXA 1XRYA 2OB0A 3RO0A 4CAXA 2OZGA 4OIWA 1KZFA 1M4IA 3GB0A 4MFQA 3CPXA 2H5MA 2JBKA 4XPDB 1Z8LA 4C2ZA 4KORA 5JGFA 3GPOA 4JLYA 2AFZA 3FBUA 3IWWA 1MJ9A 4K30A 5IV0A 3GIUA 4AVBA 1XF8A 1PU9A 1S5KA 3L2NA 1DTDA 4MFJA 3TX8A 2R98A 4A95A 1F2PA 1TF8A 4MCRA 3FEEA 4R76A 3Q6ZA 4PXDA 3H8FA 4X3RA 1Q2CA 2EO8A 5DS0A 3G8WA 1NSLA 4EVYA 1VHSA 2EK8A 5H86A 2WPXA 4XNHB 3S9LA 2B4DA 3I1UA 3BHXA 4F8ZA 2CTBA 1ELMP 2IJZA 1YLEA 5F46A 1Y7EA 1YSJA 3IC1A 3GPQA 3SJXA 3H8GA 4RN7A 5D29A 4K0CA 1TKHA 2PR8A 4CGNA 6CPAA 1CPXA 2WSAA 3DR8A 4KS9A 2O28A 2I79A 1LAMA 1YX0A 1ZR5A 4OC2A 4UCMA 3ZZIA 2JBJA 3D68A 1FY7A 4NGNA 2G0BA 1KUXA 4R57A 5FVJA 2ZEEA 3EWQA 2PJCA 4OC4A 4A94A 4MFPA 4NXYA 1M4LA 1K4JA 3RAMA 2PE3A 5G21A 1PYTB 3B8GA 3NH5A 2WCTA 3S9NA 2R1IA 4P4DA 4ZYQA 3CXPA 1YD9A 2Y0MA 2ZOGA 2PRQA 2V77A 3W6SA 2AFWA 3LODA 3PB7X 4MJ8A 1CM0A 2Q4VA 4J4ZA 3IIFA 2EUIA 2WYRA 4GS4A 2JZFA 1UWYA 2HQYA 5AGEA 3T90A 3SXOA 4P45A 5IB0A 4ETKA 3EXNA 1U6MA 1RXTA 4G1PA 3GYAA 4UMLA 4KLWA 1KUVA 2GU2A 2RC4A 4LX9A 3QB8A 4MCSA 4NSQA 1Z2LA 3SJEA 1X10A 5KTCA 3CPAA 2FAVA 3LWUA 2JLMA 4DNCA 4UFVA 1LOKA 3TO9A 4DYOA 3ETIA 1VIXA 1CP7A 4B12A 1TKFA 1GYTA 4P4EA 2PJ1A 2Q7SA 5CBMA 2ARHA 2FCKA 2Z3PA 2VL1A 2BUEA 4C7HA 3VWEA 5HOLA 3E0KA 1IY7A 3BJ7A 3SXNA 4PPZA 1Y9KA 4PK3A 2RB7A 3SIGA 4YRHA 4J5SA 2ZW4A 2PVWA 4MY0A 4U9YA 4A2ZA 4L8AA 4EFDA 3JZTA 4L89A 4RI1A 2AFOA 2P6GA 3FMCA 4MI4A 3Q71A 1YREA 1QSTA 4P4IA 1XIXA 1YQEA 4KSFA 4H89A 3SJFA 1LAPA 2KQVA 3DR6A 5BWAB 3TFYA 4R7MA 3C26A 2HC9A 5ISVA 2D4PA 4NJQA 3KR5A 3FYNA 3QNVA 3NFZA 3NH4A 2FT0A 5AG7A 3MGDA 3EKEA 3W6XA 2O4HA 4DJLA 4K3NA 3IIDA 4CGOA 3TTHA 4OADA 3B3TA 3FXTA 2CNSA 2DPSA 2DEAA 3HLPA 3B3WA 4J3GA 4ZGYB 2AFUA 4HNWB 3FJUA 4UFWA 3UY5A 3WC7A 5HMNA 4U5YA 4P4FA 1XJOA 3DDDA 3SI0A 5JQ4A 3SI2A 3KGQA 5AILA 2VRIA 1ON0A 3K2KA 5C88A 2F8HA 3F0AA 2PR1A 5AG6A 3PEIA 2KCWA 4OKOA 4P4JA 4B14A 4OC5A 2V8GA 4QUSA 3WT4A 2Z11A 2REEA 3EWPA 2QIRA 4FD7A 3KI9A 3W91A 2CIJA 4U9ZA 1NJRA 4C68A 2PVVA 3B7IA 3D7HA 4CRZB 3EJGA 1UFHA 2B5GB 3EY5A 4YWYA 1VHOA 3D4UA 2DPTA 3KQXA 3I3GA 2G9DA 3MN8A 2ANPA 2B4DB 1ZLIA 1H8LA 2VBQA 2ZW7A 4JCAA 4IQYA 2ZEHA 4KOWA 4JVVA 3D2MA 4MHNA 2P0WA 4PK2A 1AMPA 4Q7AA 1HJZA 2GANA 1AUGA 4R87A 1YW4A 1Y7RA 4CRYB 5AG4A 1P4NA 2J8RA 2Q51A 2RFHA 4NJRA 4KOYA 2CNTA 4MFLA 4UF4A 2PCUA 2BSWA 2PIZA 3EO4A 7CPAA 2DXQA 2BCOA 4M85A 4A39A 1IU8A 2P6FA 2ZELA 2ATRA 8CPAA 2ZEMA 4A30A 3PB6X 3F8KA 2POKA 4I49A 4QB9A 4CGMA 4MRIA 2C6PA 2G3AA 4PV6A 5F09A 3R96A 3D7DA 3V8IA 3RYOA 2AE6A 4MY3A 4AXVA 1TKJA 4KLVA 4JGKA 2BL1A 3TO7A 4E8OA 4UEFA 2X47A 1QMUA 4CYPA 1SPVA 1IIDA 3HUVA 4IHMA 4UWIA 3S6HA 5HVFA 4X5KA 2WUUA 3D67A 3GUXA 3KL9A 2PJBA 2AFSA 3D3SA 4OMEA 2OZHA 5J8FA 3R9GA 4KOTA 3GY9A 2VXKA 5LRGA 3TOBA 5A27A 3R9EA 5LYLA 1Z8TA 4H6ZA 2WZNA 3KHXA 4HPSA 3D7FA 2VEZA 3NE8A 2FSRA 2AJ6A 3I9SA 4MHPA 4IK2A 1LCPA 3B3SA 2VZYA 3BLNA 2EEEA 1Z4RA 2ODFA 1M4GA 3WR7A 2DX6A 1MJAA 3B3VA 3N7ZA 4MHZA 4ZY2A 3S6FA 5HVHA 3FRMA 3KR4A 2I00A 5E3BA 3JTKA 3CXQA 4OC1A 5K8NA 3RZAA 5J1QA 3FECA 3GQOA 1LRZA 2Q0YA 2CY2A 4O23A 3ZJ0A 1IB1E 4PXCA 3VH9A 4UEZA 4AVAA 1S3ZA 4LUAA 4NFRA 2GLJA 3WABA 4R3KA 2OOTA 1KUYA 1Z8WA 2ZEOA 4LQ6A 5D8NA 1N71A 1ELLP 1PCAA 3FNCA 1ZO0A 5G22A 3IGRA 2F5IA 1CBXA 3VATA 5JH9A 2GFQA 1YK3A 2AFCA 1XE4A 1FT7A 2AFMA 1ARLA 3EFAA 1L0CA 3LMSA 1Q2YA 2IL4A 4Q36A 4QC6A 3P2FA 1LANA 3GQEA 4ETJA 4CAWA 1YLOA 3PGPA 4JZ0A 4ONUA 4E2AA 2DF5A 4MFZA 2R7HA 4Y49C 3PRTA 3KASA 1BOBA 1M44A 3NA6A 1EE3P 4PQAA 3BXMA 4UIBA 1IICA 5LRKA 2CF4A 2B4BA 2HB6A 3V7ZA 2YNDA 2J9AA 3IO1A 4ZY0A 4R9MA 5AG5A 4FBEA 2JDCA 1Y0RA 4P4BA 2PIYA 3PP9A 3WC6A 5H84A 2X7BA 4CYNA 1WK4A 5IB9A 2Q43A 4KOVA 2Q4ZA 3R95A 3H8EA 4MHDA 2QVPA 3S9MA 3T9YA 2OR4A 5LYIA 4JWPA 4BBHA 4P10A 2FXFA 3FVLA 3SIJA 2QMLA 2OH1A 2EVNA 3A9LA 2V8VA 4UCNA 2Q04A 4AB7A 1BAVA 4M6HA 5K8OA 4CAFA 1OZPA 1TY8A 4KYBA 1IOFA 1YVKA 4CPAA 4R6TA 3LD2A 2ZW5A 3B35A 4OAEA 3PBBA 4IAVA 5LYDA 3B3CA 2YGWA 1QSMA 3N5FA 1F57A 2ACFA 4UCPA 5LYFA 1I1DA 4D86A 4AG7A 4E0AA 4F9UA 4KOSA 5KTDA 2BEIA 3EWRA 2PJ8A 3IWEA 1CJWA 4TNUA 3IEHA 4OC0A 5F48A 2FS5A 1Y9WA 3CXSA 1CX8A 1DE4C 1XOVA 5J8CA 2FIWA 2V8HA 4Q38A 4UBRA 3VARA 1ZG9A 4DUKA 4NGPA 2J8NA 3TT2A 3FH4A 4CYOA 1VHEA 1F2OA 4MCQA 4ZX9A 1Q7LA 4HNXB 4CGPA 4QBJA 3KQZA 4GUAA 1QQ9A 2C6GA 1SQHA 2FE7A 3ISXA 4ONWA 3WC5A 1S60A 2GLFA 2JDDA 5FSYA 4H2KA 1NMTA 2ZEGA 1Z9UA 3FB3A 5JM6A 2L8RA 3LACA 4M6IA 2PSWA 5ELYA 1TXZA 3KHZA 3D8PA 2XEFA 1CG2A 2PJ9A 2XEJA 1GHEA 3KKWA 4H6UA 1XFOA 3PZJA 4JYWA 1X12A 3KZWA 3PBEA 1QSOA 2PJ7A 2FG1A 1Z5RA 4YU9A 3SJGA 2YNCC 4FUUA 4QVTA 1QSRA 4NGRA 5F49A 2C1CA 4P44A 1BLLE 1AYEA 2B58A 4AVCA 3TE4A 4ZI6A 1V0CA 2PC1A 5HH1A 4A38A 5HIHA 1QSNA 4B5OA 2XEIA 3FEDA 4B13A 4KUAA 2ZW6A 1JWQA 5CB5A 5CNPA 1J4JA 1A2ZA 1ZG7A 2ZEPA 4CAVA 2BO9A 4ABLA 2BFQA 3IU2A 1TF9A 1P0HA 2B5GA 3JRUA 1JQGA 2XD7A 4GVWA 2OZUA 2PJAA 3B2YA 4JD6A 2JZEA 3PFEA 4A31A 2Q44A 2Z10A 4PXBA 4B11A 4C2YA 2PDOA 2G3TA 4GXHA 3IIBA 4RS2A 4F0XA 2PJ6A 1TIQA 2Z3OA 4FD5A 2Q4YA 5EMIA 5GCNA 2QJ8A 2VQYA 2P6EA 2PJ0A 5I0CA 2QECA 3D7GA 2B3VA 4GM5A 3IU1A 2BOAA 5G1ZA 2JEVA 3DGVA 4BMHA 4MMOA 4JXRA 2WPWA 5C82A 2C27A 4OC3A 3FF3A 5CB3A 2Z3NA 4JXQA 2EBJA 5LRJA 4EWTA 4M3SA 3JVNA 2ZXVA 2PJ2A 2PRBA 5A28A 3QAHA 4LQGA 1R57A 4XPKA 4J5QA 3FX6A 1Q2DA 4R8FA 1VHUA 4UWJA 2GIVA 2NSMA 5THWA 2NYQA 4CAEA 4KSIA 4AG9A 1M1DA 4X8IA 2K5TA 4F9VA 2PJ4A 4GVVA 1IYLA 1M4DA 1Z4EA 1IOIA 5FSZA 1FNOA 4FD6A 3BI0A 4Y49B 5HVGA 4KOXA 4PSXA 5CMSA 1XMTA 4NEXA 4CGLA 1IYKA 2YNCA 2B3UA 1B6BA 1CPSA 1KWMA 3PFOA 4OP4A 1YVOA 5CPAA 1OBRA 3EWOA 3EC4A 5EC4A 4EMEA 1YGHA 4NCZA 2BFRA 5K8MA 4KUBA 3ISZA 1S7NA 2VZZA 1Y0YA 2YNEA 4ZX8A 4X2TA 2CNMA 3DLJA 3GLJA 3R9FA 2F7VA 3VWDA 2FL4A 5IX3A 2PJ5A 1ZLHA 3T8WA 2REFA 2Z3KA 4XPDC 4FAIA 2QYVA 4NGTA 2ZOFA 2HUZA 4ORFA 5F47A 1NE9A 1HDQA 3SIIA 2ZENA 3PB9X 4WJBA 1TXRA 3BI1A 3DSBA 3P2HA 3EJFA 4FD4A 3CDXA 4BINA 4F6AA 3TOAA 3S6GA 1R43A 4M6GA 2JZDA 3GPGA 4NGMA 3SHPA 5E96A 4F0YA 1ZR3A 3CT9A 2EWBA 2FVGA 4UFXA 3G3SA 3RNZA 3CZXA 4A37A 5FSUA 4KSAA 1LFWA 1B87A 3JUWA 4IUSA 1YW6A 2XEGA 4RUHA 1ZG8A 1XEBA 3VFQA 4KVOE 1RO5A 2D4OA 4ABKA 2O53A 5K8PA 1BO4A 4CYQA 2J8MA 3EW5A 2Z0ZA 2ZEFA 4XPLA 4KZTA 5DWMA 5FSVA 3TO6A 4A32A 4MBUA 1BPMA 4OIDA 2JEWA 5HXDA 4UEEA 5KTAA 1MJBA 4MXUA 4J5RA 1S7FA 1IGBA 1WWZA 4B10A 4B6ZA 1YMEA 4C7IA 5FSXA 4WWVA 3S6KA 1R3NA 4BD9A 3BJ8A 1MK4A 4KVXA 2CTCA 4YFJA 3K9UA 4KVME 4MFKA 2ZPAA 2A4NA 4UA3A 4TU0A 2C6CA 2CXAA 3IJ3A 1I21A 4UIAA 5G20A 1PUAA 1YR0A 3SIHA 5DWNA 2HV2A 1HDUA 2I3CA 4PSWA 3GKRA 4R3LA 3V38A 4A33A 5JPHA 3FIXA 4MHYA 4TWEA 1I12A 2V8DA 1S7LA 3TC8A 2FIAA 5DUSA 3IFEA 2EK9A 4PXEA 3V45A 4JJXA 2Z3MA
chains in the Genus database with same CATH topology
1CP6A 2PJ3A 1HEEA 4JLLA 3V2BA 1XBUA 1ARMA 1NSAA 3PB4X 3RBUA 3MRUA 4W9YA 2GREA 2FXKA 1VGYA 4NGQA 4NGSA 4ZY1A 4FWUA 2ZEDA 5I4MA 2ABZA 4P6YA 2IQ6A 3SI1A 3D66A 1BPNA 1RTQA 3PB8X 3K9TA 4Z65A 4MCPA 3NH8A 1XMBA 4ESSA 2IMOA 2LGRA 2AFXA 1XRYA 4OIWA 3GB0A 3CPXA 2JBKA 1Z8LA 5JGFA 3GPOA 2AFZA 3IWWA 3L2NA 1DTDA 3TX8A 1F2PA 1TF8A 4MCRA 3FEEA 4R76A 3Q6ZA 4PXDA 3H8FA 4X3RA 5DS0A 2EK8A 3S9LA 3I1UA 3BHXA 4F8ZA 2CTBA 1ELMP 2IJZA 1Y7EA 1YSJA 3IC1A 3GPQA 3SJXA 3H8GA 5D29A 4K0CA 1TKHA 6CPAA 1CPXA 1LAMA 1ZR5A 4OC2A 2JBJA 3D68A 4NGNA 2ZEEA 3EWQA 2PJCA 4OC4A 4A94A 1M4LA 3RAMA 2PE3A 1PYTB 3NH5A 3S9NA 4P4DA 4ZYQA 1YD9A 2ZOGA 2PRQA 2V77A 2AFWA 3PB7X 2WYRA 4J4ZA 3IIFA 1UWYA 4P45A 4ETKA 4G1PA 4UMLA 2GU2A 4MCSA 1Z2LA 3SJEA 3CPAA 2FAVA 3LWUA 1LOKA 4DYOA 3ETIA 1VIXA 1CP7A 1TKFA 1GYTA 4P4EA 2PJ1A 5CBMA 2VL1A 5HOLA 1IY7A 4PPZA 2RB7A 3SIGA 4J5SA 2PVWA 4EFDA 3JZTA 2AFOA 3FMCA 3Q71A 4P4IA 3SJFA 1LAPA 4R7MA 2HC9A 4NJQA 3KR5A 3QNVA 3NFZA 3NH4A 4DJLA 3EKEA 2O4HA 4K3NA 3IIDA 3B3TA 2DEAA 3HLPA 3B3WA 2AFUA 3FJUA 3WC7A 4P4FA 1XJOA 3SI0A 3SI2A 3KGQA 5AILA 2VRIA 3K2KA 2F8HA 3PEIA 4OKOA 4P4JA 4OC5A 2V8GA 3WT4A 3EWPA 3KI9A 2CIJA 1NJRA 2PVVA 3B7IA 3D7HA 3EJGA 4YWYA 1VHOA 3D4UA 3KQXA 2G9DA 3MN8A 2ANPA 1ZLIA 1H8LA 4JCAA 4IQYA 2ZEHA 4JVVA 4MHNA 4Q7AA 1AMPA 1HJZA 1YW4A 2Q51A 2RFHA 4NJRA 4UF4A 7CPAA 2PCUA 2PIZA 2BCOA 4A39A 2ZELA 8CPAA 2ZEMA 3PB6X 2POKA 5F09A 4MRIA 2C6PA 3D7DA 4AXVA 1TKJA 4JGKA 4UEFA 2X47A 1QMUA 1SPVA 4IHMA 3HUVA 5HVFA 3D67A 3GUXA 3KL9A 2PJBA 2AFSA 4OMEA 5LRGA 5LYLA 2WZNA 3KHXA 3D7FA 4MHPA 4IK2A 1LCPA 3B3SA 2EEEA 2DX6A 3B3VA 4MHZA 5HVHA 4ZY2A 3KR4A 5E3BA 4OC1A 5K8NA 3RZAA 5J1QA 3FECA 3GQOA 4O23A 3VH9A 4PXCA 4UEZA 4NFRA 2GLJA 3WABA 2OOTA 2ZEOA 5D8NA 1ELLP 1PCAA 1CBXA 3VATA 5JH9A 2AFCA 1FT7A 2AFMA 1ARLA 3LMSA 1LANA 3GQEA 4ETJA 1YLOA 4JZ0A 3PRTA 3KASA 3NA6A 1EE3P 4PQAA 3BXMA 4UIBA 5LRKA 2CF4A 3V7ZA 2HB6A 2J9AA 3IO1A 4ZY0A 4FBEA 1Y0RA 4P4BA 2PIYA 3WC6A 5IB9A 2Q43A 2Q4ZA 3H8EA 2QVPA 3S9MA 2OR4A 5LYIA 4P10A 3FVLA 3SIJA 2V8VA 1BAVA 5K8OA 1TY8A 4KYBA 4CPAA 4R6TA 3B35A 3PBBA 4IAVA 5LYDA 3B3CA 3N5FA 1F57A 2ACFA 5LYFA 4D86A 4F9UA 3EWRA 2PJ8A 4TNUA 3IEHA 4OC0A 1CX8A 1DE4C 2V8HA 3VARA 1ZG9A 4DUKA 4NGPA 3FH4A 1VHEA 1F2OA 4MCQA 4ZX9A 1Q7LA 3KQZA 4GUAA 1QQ9A 2C6GA 3ISXA 4ONWA 3WC5A 2GLFA 5FSYA 4H2KA 2ZEGA 5JM6A 2L8RA 5ELYA 1TXZA 3KHZA 2XEFA 1CG2A 2PJ9A 2XEJA 1XFOA 4JYWA 3KZWA 3PBEA 2PJ7A 2FG1A 1Z5RA 4YU9A 3SJGA 4FUUA 4NGRA 2C1CA 4P44A 1BLLE 1AYEA 4ZI6A 4A38A 5HIHA 2XEIA 3FEDA 5CB5A 1ZG7A 2ZEPA 2BO9A 4ABLA 2BFQA 1TF9A 3JRUA 3B2YA 1JQGA 2XD7A 4GVWA 2PJAA 3PFEA 4PXBA 3IIBA 2PJ6A 2QJ8A 2PJ0A 3D7GA 4GM5A 2BOAA 3DGVA 4MMOA 4OC3A 3FF3A 5CB3A 4EWTA 5LRJA 2PJ2A 4LQGA 4J5QA 3FX6A 4R8FA 1VHUA 2NSMA 5THWA 2NYQA 4KSIA 4X8IA 4F9VA 2PJ4A 4GVVA 5FSZA 1FNOA 3BI0A 5HVGA 5CMSA 1CPSA 1KWMA 3PFOA 4OP4A 5CPAA 1OBRA 3EWOA 4EMEA 2BFRA 5K8MA 3ISZA 3DLJA 1Y0YA 4ZX8A 4X2TA 3GLJA 2F7VA 2PJ5A 1ZLHA 3T8WA 4FAIA 2QYVA 4NGTA 2ZOFA 1HDQA 3SIIA 2ZENA 3PB9X 4WJBA 1TXRA 3BI1A 3EJFA 3CDXA 1R43A 4NGMA 3GPGA 1ZR3A 3CT9A 2EWBA 2FVGA 4A37A 5FSUA 1LFWA 1YW6A 2XEGA 4RUHA 1ZG8A 3VFQA 4ABKA 2O53A 5K8PA 3EW5A 2ZEFA 5FSVA 1BPMA 4OIDA 2JEWA 5HXDA 4UEEA 4MXUA 4J5RA 4B6ZA 1IGBA 1YMEA 5FSXA 4WWVA 1R3NA 4BD9A 2CTCA 4UIAA 4TU0A 2C6CA 3IJ3A 3SIHA 1HDUA 2I3CA 3V38A 4MHYA 4TWEA 2V8DA 3TC8A 5DUSA 3IFEA 2EK9A 4PXEA 3V45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CP6 A;  2PJ3 A;  1HEE A;  4JLL A;  3V2B A;  1XBU A;  1ARM A;  1NSA A;  3PB4 X;  3RBU A;  3MRU A;  4W9Y A;  2GRE A;  2FXK A;  1VGY A;  4NGQ A;  4NGS A;  4ZY1 A;  4FWU A;  2ZED A;  5I4M A;  2ABZ A;  4P6Y A;  2IQ6 A;  3SI1 A;  3D66 A;  1BPN A;  1RTQ A;  3PB8 X;  3K9T A;  4Z65 A;  4MCP A;  3NH8 A;  1XMB A;  4ESS A;  2IMO A;  2LGR A;  2AFX A;  1XRY A;  4OIW A;  3GB0 A;  3CPX A;  2JBK A;  1Z8L A;  5JGF A;  3GPO A;  2AFZ A;  3IWW A;  3L2N A;  1DTD A;  3TX8 A;  1F2P A;  1TF8 A;  4MCR A;  3FEE A;  4R76 A;  3Q6Z A;  4PXD A;  3H8F A;  4X3R A;  5DS0 A;  2EK8 A;  3S9L A;  3I1U A;  3BHX A;  4F8Z A;  2CTB A;  1ELM P;  2IJZ A;  1Y7E A;  1YSJ A;  3IC1 A;  3GPQ A;  3SJX A;  3H8G A;  5D29 A;  4K0C A;  1TKH A;  6CPA A;  1CPX A;  1LAM A;  1ZR5 A;  4OC2 A;  2JBJ A;  3D68 A;  4NGN A;  2ZEE A;  3EWQ A;  2PJC A;  4OC4 A;  4A94 A;  1M4L A;  3RAM A;  2PE3 A;  1PYT B;  3NH5 A;  3S9N A;  4P4D A;  4ZYQ A;  1YD9 A;  2ZOG A;  2PRQ A;  2V77 A;  2AFW A;  3PB7 X;  2WYR A;  4J4Z A;  3IIF A;  1UWY A;  4P45 A;  4ETK A;  4G1P A;  4UML A;  2GU2 A;  4MCS A;  1Z2L A;  3SJE A;  3CPA A;  2FAV A;  3LWU A;  1LOK A;  4DYO A;  3ETI A;  1VIX A;  1CP7 A;  1TKF A;  1GYT A;  4P4E A;  2PJ1 A;  5CBM A;  2VL1 A;  5HOL A;  1IY7 A;  4PPZ A;  2RB7 A;  3SIG A;  4J5S A;  2PVW A;  4EFD A;  3JZT A;  2AFO A;  3FMC A;  3Q71 A;  4P4I A;  3SJF A;  1LAP A;  4R7M A;  2HC9 A;  4NJQ A;  3KR5 A;  3QNV A;  3NFZ A;  3NH4 A;  4DJL A;  3EKE A;  2O4H A;  4K3N A;  3IID A;  3B3T A;  2DEA A;  3HLP A;  3B3W A;  2AFU A;  3FJU A;  3WC7 A;  4P4F A;  1XJO A;  3SI0 A;  3SI2 A;  3KGQ A;  5AIL A;  2VRI A;  3K2K A;  2F8H A;  3PEI A;  4OKO A;  4P4J A;  4OC5 A;  2V8G A;  3WT4 A;  3EWP A;  3KI9 A;  2CIJ A;  1NJR A;  2PVV A;  3B7I A;  3D7H A;  3EJG A;  4YWY A;  1VHO A;  3D4U A;  3KQX A;  2G9D A;  3MN8 A;  2ANP A;  1ZLI A;  1H8L A;  4JCA A;  4IQY A;  2ZEH A;  4JVV A;  4MHN A;  4Q7A A;  1AMP A;  1HJZ A;  1YW4 A;  2Q51 A;  2RFH A;  4NJR A;  4UF4 A;  7CPA A;  2PCU A;  2PIZ A;  2BCO A;  4A39 A;  2ZEL A;  8CPA A;  2ZEM A;  3PB6 X;  2POK A;  5F09 A;  4MRI A;  2C6P A;  3D7D A;  4AXV A;  1TKJ A;  4JGK A;  4UEF A;  2X47 A;  1QMU A;  1SPV A;  4IHM A;  3HUV A;  5HVF A;  3D67 A;  3GUX A;  3KL9 A;  2PJB A;  2AFS A;  4OME A;  5LRG A;  5LYL A;  2WZN A;  3KHX A;  3D7F A;  4MHP A;  4IK2 A;  1LCP A;  3B3S A;  2EEE A;  2DX6 A;  3B3V A;  4MHZ A;  5HVH A;  4ZY2 A;  3KR4 A;  5E3B A;  4OC1 A;  5K8N A;  3RZA A;  5J1Q A;  3FEC A;  3GQO A;  4O23 A;  3VH9 A;  4PXC A;  4UEZ A;  4NFR A;  2GLJ A;  3WAB A;  2OOT A;  2ZEO A;  5D8N A;  1ELL P;  1PCA A;  1CBX A;  3VAT A;  5JH9 A;  2AFC A;  1FT7 A;  2AFM A;  1ARL A;  3LMS A;  1LAN A;  3GQE A;  4ETJ A;  1YLO A;  4JZ0 A;  3PRT A;  3KAS A;  3NA6 A;  1EE3 P;  4PQA A;  3BXM A;  4UIB A;  5LRK A;  2CF4 A;  3V7Z A;  2HB6 A;  2J9A A;  3IO1 A;  4ZY0 A;  4FBE A;  1Y0R A;  4P4B A;  2PIY A;  3WC6 A;  5IB9 A;  2Q43 A;  2Q4Z A;  3H8E A;  2QVP A;  3S9M A;  2OR4 A;  5LYI A;  4P10 A;  3FVL A;  3SIJ A;  2V8V A;  1BAV A;  5K8O A;  1TY8 A;  4KYB A;  4CPA A;  4R6T A;  3B35 A;  3PBB A;  4IAV A;  5LYD A;  3B3C A;  3N5F A;  1F57 A;  2ACF A;  5LYF A;  4D86 A;  4F9U A;  3EWR A;  2PJ8 A;  4TNU A;  3IEH A;  4OC0 A;  1CX8 A;  1DE4 C;  2V8H A;  3VAR A;  1ZG9 A;  4DUK A;  4NGP A;  3FH4 A;  1VHE A;  1F2O A;  4MCQ A;  4ZX9 A;  1Q7L A;  3KQZ A;  4GUA A;  1QQ9 A;  2C6G A;  3ISX A;  4ONW A;  3WC5 A;  2GLF A;  5FSY A;  4H2K A;  2ZEG A;  5JM6 A;  2L8R A;  5ELY A;  1TXZ A;  3KHZ A;  2XEF A;  1CG2 A;  2PJ9 A;  2XEJ A;  1XFO A;  4JYW A;  3KZW A;  3PBE A;  2PJ7 A;  2FG1 A;  1Z5R A;  4YU9 A;  3SJG A;  4FUU A;  4NGR A;  2C1C A;  4P44 A;  1BLL E;  1AYE A;  4ZI6 A;  4A38 A;  5HIH A;  2XEI A;  3FED A;  5CB5 A;  1ZG7 A;  2ZEP A;  2BO9 A;  4ABL A;  2BFQ A;  1TF9 A;  3JRU A;  3B2Y A;  1JQG A;  2XD7 A;  4GVW A;  2PJA A;  3PFE A;  4PXB A;  3IIB A;  2PJ6 A;  2QJ8 A;  2PJ0 A;  3D7G A;  4GM5 A;  2BOA A;  3DGV A;  4MMO A;  4OC3 A;  3FF3 A;  5CB3 A;  4EWT A;  5LRJ A;  2PJ2 A;  4LQG A;  4J5Q A;  3FX6 A;  4R8F A;  1VHU A;  2NSM A;  5THW A;  2NYQ A;  4KSI A;  4X8I A;  4F9V A;  2PJ4 A;  4GVV A;  5FSZ A;  1FNO A;  3BI0 A;  5HVG A;  5CMS A;  1CPS A;  1KWM A;  3PFO A;  4OP4 A;  5CPA A;  1OBR A;  3EWO A;  4EME A;  2BFR A;  5K8M A;  3ISZ A;  3DLJ A;  1Y0Y A;  4ZX8 A;  4X2T A;  3GLJ A;  2F7V A;  2PJ5 A;  1ZLH A;  3T8W A;  4FAI A;  2QYV A;  4NGT A;  2ZOF A;  1HDQ A;  3SII A;  2ZEN A;  3PB9 X;  4WJB A;  1TXR A;  3BI1 A;  3EJF A;  3CDX A;  1R43 A;  4NGM A;  3GPG A;  1ZR3 A;  3CT9 A;  2EWB A;  2FVG A;  4A37 A;  5FSU A;  1LFW A;  1YW6 A;  2XEG A;  4RUH A;  1ZG8 A;  3VFQ A;  4ABK A;  2O53 A;  5K8P A;  3EW5 A;  2ZEF A;  5FSV A;  1BPM A;  4OID A;  2JEW A;  5HXD A;  4UEE A;  4MXU A;  4J5R A;  4B6Z A;  1IGB A;  1YME A;  5FSX A;  4WWV A;  1R3N A;  4BD9 A;  2CTC A;  4UIA A;  4TU0 A;  2C6C A;  3IJ3 A;  3SIH A;  1HDU A;  2I3C A;  3V38 A;  4MHY A;  4TWE A;  2V8D A;  3TC8 A;  5DUS A;  3IFE A;  2EK9 A;  4PXE A;  3V45 A; 
#chains in the Genus database with same CATH topology
 2RNK A;  2NMT A;  1CP6 A;  1Z8X A;  2PQ8 A;  3H4Q A;  2Z3L A;  4ZBG A;  2PJ3 A;  1HEE A;  4JLL A;  1VKC A;  3V2B A;  2OU2 A;  4CS0 B;  1S7K A;  1XBU A;  4II9 A;  1ARM A;  1NSA A;  3PB4 X;  3DNS A;  4YGO A;  3RBU A;  4NF1 A;  2Q7B A;  3MRU A;  4IF5 A;  4XNH C;  2R8V A;  4W9Y A;  3QAY A;  2GRE A;  4HKF A;  4KOU A;  2FXK A;  1VGY A;  3NE7 A;  3OWC A;  4NGQ A;  4ZY1 A;  4NGS A;  4FWU A;  4OLL A;  5EBV A;  3D2P A;  2ZED A;  4HNY B;  5I4M A;  2ABZ A;  4P6Y A;  2IQ6 A;  2VI7 A;  4B5P B;  2W2G A;  3SI1 A;  4B5P A;  3D66 A;  1BPN A;  1RTQ A;  3PB8 X;  3IWG A;  3F5B A;  3R1K A;  3K9T A;  4C2X A;  4Z65 A;  3H5Z A;  4MCP A;  3NH8 A;  3TCV A;  1XMB A;  4ESS A;  2IMO A;  2LGR A;  2GE3 A;  2AFX A;  1XRY A;  2OB0 A;  3RO0 A;  4CAX A;  2OZG A;  4OIW A;  1KZF A;  1M4I A;  3GB0 A;  4MFQ A;  3CPX A;  2H5M A;  2JBK A;  4XPD B;  1Z8L A;  4C2Z A;  4KOR A;  5JGF A;  3GPO A;  4JLY A;  2AFZ A;  3FBU A;  3IWW A;  1MJ9 A;  4K30 A;  5IV0 A;  3GIU A;  4AVB A;  1XF8 A;  1PU9 A;  1S5K A;  3L2N A;  1DTD A;  4MFJ A;  3TX8 A;  2R98 A;  4A95 A;  1F2P A;  1TF8 A;  4MCR A;  3FEE A;  4R76 A;  3Q6Z A;  4PXD A;  3H8F A;  4X3R A;  1Q2C A;  2EO8 A;  5DS0 A;  3G8W A;  1NSL A;  4EVY A;  1VHS A;  2EK8 A;  5H86 A;  2WPX A;  4XNH B;  3S9L A;  2B4D A;  3I1U A;  3BHX A;  4F8Z A;  2CTB A;  1ELM P;  2IJZ A;  1YLE A;  5F46 A;  1Y7E A;  1YSJ A;  3IC1 A;  3GPQ A;  3SJX A;  3H8G A;  4RN7 A;  5D29 A;  4K0C A;  1TKH A;  2PR8 A;  4CGN A;  6CPA A;  1CPX A;  2WSA A;  3DR8 A;  4KS9 A;  2O28 A;  2I79 A;  1LAM A;  1YX0 A;  1ZR5 A;  4OC2 A;  4UCM A;  3ZZI A;  2JBJ A;  3D68 A;  1FY7 A;  4NGN A;  2G0B A;  1KUX A;  4R57 A;  5FVJ A;  2ZEE A;  3EWQ A;  2PJC A;  4OC4 A;  4A94 A;  4MFP A;  4NXY A;  1M4L A;  1K4J A;  3RAM A;  2PE3 A;  5G21 A;  1PYT B;  3B8G A;  3NH5 A;  2WCT A;  3S9N A;  2R1I A;  4P4D A;  4ZYQ A;  3CXP A;  1YD9 A;  2Y0M A;  2ZOG A;  2PRQ A;  2V77 A;  3W6S A;  2AFW A;  3LOD A;  3PB7 X;  4MJ8 A;  1CM0 A;  2Q4V A;  4J4Z A;  3IIF A;  2EUI A;  2WYR A;  4GS4 A;  2JZF A;  1UWY A;  2HQY A;  5AGE A;  3T90 A;  3SXO A;  4P45 A;  5IB0 A;  4ETK A;  3EXN A;  1U6M A;  1RXT A;  4G1P A;  3GYA A;  4UML A;  4KLW A;  1KUV A;  2GU2 A;  2RC4 A;  4LX9 A;  3QB8 A;  4MCS A;  4NSQ A;  1Z2L A;  3SJE A;  1X10 A;  5KTC A;  3CPA A;  2FAV A;  3LWU A;  2JLM A;  4DNC A;  4UFV A;  1LOK A;  3TO9 A;  4DYO A;  3ETI A;  1VIX A;  1CP7 A;  4B12 A;  1TKF A;  1GYT A;  4P4E A;  2PJ1 A;  2Q7S A;  5CBM A;  2ARH A;  2FCK A;  2Z3P A;  2VL1 A;  2BUE A;  4C7H A;  3VWE A;  5HOL A;  3E0K A;  1IY7 A;  3BJ7 A;  3SXN A;  4PPZ A;  1Y9K A;  4PK3 A;  2RB7 A;  3SIG A;  4YRH A;  4J5S A;  2ZW4 A;  2PVW A;  4MY0 A;  4U9Y A;  4A2Z A;  4L8A A;  4EFD A;  3JZT A;  4L89 A;  4RI1 A;  2AFO A;  2P6G A;  3FMC A;  4MI4 A;  3Q71 A;  1YRE A;  1QST A;  4P4I A;  1XIX A;  1YQE A;  4KSF A;  4H89 A;  3SJF A;  1LAP A;  2KQV A;  3DR6 A;  5BWA B;  3TFY A;  4R7M A;  3C26 A;  2HC9 A;  5ISV A;  2D4P A;  4NJQ A;  3KR5 A;  3FYN A;  3QNV A;  3NFZ A;  3NH4 A;  2FT0 A;  5AG7 A;  3MGD A;  3EKE A;  3W6X A;  2O4H A;  4DJL A;  4K3N A;  3IID A;  4CGO A;  3TTH A;  4OAD A;  3B3T A;  3FXT A;  2CNS A;  2DPS A;  2DEA A;  3HLP A;  3B3W A;  4J3G A;  4ZGY B;  2AFU A;  4HNW B;  3FJU A;  4UFW A;  3UY5 A;  3WC7 A;  5HMN A;  4U5Y A;  4P4F A;  1XJO A;  3DDD A;  3SI0 A;  5JQ4 A;  3SI2 A;  3KGQ A;  5AIL A;  2VRI A;  1ON0 A;  3K2K A;  5C88 A;  2F8H A;  3F0A A;  2PR1 A;  5AG6 A;  3PEI A;  2KCW A;  4OKO A;  4P4J A;  4B14 A;  4OC5 A;  2V8G A;  4QUS A;  3WT4 A;  2Z11 A;  2REE A;  3EWP A;  2QIR A;  4FD7 A;  3KI9 A;  3W91 A;  2CIJ A;  4U9Z A;  1NJR A;  4C68 A;  2PVV A;  3B7I A;  3D7H A;  4CRZ B;  3EJG A;  1UFH A;  2B5G B;  3EY5 A;  4YWY A;  1VHO A;  3D4U A;  2DPT A;  3KQX A;  3I3G A;  2G9D A;  3MN8 A;  2ANP A;  2B4D B;  1ZLI A;  1H8L A;  2VBQ A;  2ZW7 A;  4JCA A;  4IQY A;  2ZEH A;  4KOW A;  4JVV A;  3D2M A;  4MHN A;  2P0W A;  4PK2 A;  1AMP A;  4Q7A A;  1HJZ A;  2GAN A;  1AUG A;  4R87 A;  1YW4 A;  1Y7R A;  4CRY B;  5AG4 A;  1P4N A;  2J8R A;  2Q51 A;  2RFH A;  4NJR A;  4KOY A;  2CNT A;  4MFL A;  4UF4 A;  2PCU A;  2BSW A;  2PIZ A;  3EO4 A;  7CPA A;  2DXQ A;  2BCO A;  4M85 A;  4A39 A;  1IU8 A;  2P6F A;  2ZEL A;  2ATR A;  8CPA A;  2ZEM A;  4A30 A;  3PB6 X;  3F8K A;  2POK A;  4I49 A;  4QB9 A;  4CGM A;  4MRI A;  2C6P A;  2G3A A;  4PV6 A;  5F09 A;  3R96 A;  3D7D A;  3V8I A;  3RYO A;  2AE6 A;  4MY3 A;  4AXV A;  1TKJ A;  4KLV A;  4JGK A;  2BL1 A;  3TO7 A;  4E8O A;  4UEF A;  2X47 A;  1QMU A;  4CYP A;  1SPV A;  1IID A;  3HUV A;  4IHM A;  4UWI A;  3S6H A;  5HVF A;  4X5K A;  2WUU A;  3D67 A;  3GUX A;  3KL9 A;  2PJB A;  2AFS A;  3D3S A;  4OME A;  2OZH A;  5J8F A;  3R9G A;  4KOT A;  3GY9 A;  2VXK A;  5LRG A;  3TOB A;  5A27 A;  3R9E A;  5LYL A;  1Z8T A;  4H6Z A;  2WZN A;  3KHX A;  4HPS A;  3D7F A;  2VEZ A;  3NE8 A;  2FSR A;  2AJ6 A;  3I9S A;  4MHP A;  4IK2 A;  1LCP A;  3B3S A;  2VZY A;  3BLN A;  2EEE A;  1Z4R A;  2ODF A;  1M4G A;  3WR7 A;  2DX6 A;  1MJA A;  3B3V A;  3N7Z A;  4MHZ A;  4ZY2 A;  3S6F A;  5HVH A;  3FRM A;  3KR4 A;  2I00 A;  5E3B A;  3JTK A;  3CXQ A;  4OC1 A;  5K8N A;  3RZA A;  5J1Q A;  3FEC A;  3GQO A;  1LRZ A;  2Q0Y A;  2CY2 A;  4O23 A;  3ZJ0 A;  1IB1 E;  4PXC A;  3VH9 A;  4UEZ A;  4AVA A;  1S3Z A;  4LUA A;  4NFR A;  2GLJ A;  3WAB A;  4R3K A;  2OOT A;  1KUY A;  1Z8W A;  2ZEO A;  4LQ6 A;  5D8N A;  1N71 A;  1ELL P;  1PCA A;  3FNC A;  1ZO0 A;  5G22 A;  3IGR A;  2F5I A;  1CBX A;  3VAT A;  5JH9 A;  2GFQ A;  1YK3 A;  2AFC A;  1XE4 A;  1FT7 A;  2AFM A;  1ARL A;  3EFA A;  1L0C A;  3LMS A;  1Q2Y A;  2IL4 A;  4Q36 A;  4QC6 A;  3P2F A;  1LAN A;  3GQE A;  4ETJ A;  4CAW A;  1YLO A;  3PGP A;  4JZ0 A;  4ONU A;  4E2A A;  2DF5 A;  4MFZ A;  2R7H A;  4Y49 C;  3PRT A;  3KAS A;  1BOB A;  1M44 A;  3NA6 A;  1EE3 P;  4PQA A;  3BXM A;  4UIB A;  1IIC A;  5LRK A;  2CF4 A;  2B4B A;  2HB6 A;  3V7Z A;  2YND A;  2J9A A;  3IO1 A;  4ZY0 A;  4R9M A;  5AG5 A;  4FBE A;  2JDC A;  1Y0R A;  4P4B A;  2PIY A;  3PP9 A;  3WC6 A;  5H84 A;  2X7B A;  4CYN A;  1WK4 A;  5IB9 A;  2Q43 A;  4KOV A;  2Q4Z A;  3R95 A;  3H8E A;  4MHD A;  2QVP A;  3S9M A;  3T9Y A;  2OR4 A;  5LYI A;  4JWP A;  4BBH A;  4P10 A;  2FXF A;  3FVL A;  3SIJ A;  2QML A;  2OH1 A;  2EVN A;  3A9L A;  2V8V A;  4UCN A;  2Q04 A;  4AB7 A;  1BAV A;  4M6H A;  5K8O A;  4CAF A;  1OZP A;  1TY8 A;  4KYB A;  1IOF A;  1YVK A;  4CPA A;  4R6T A;  3LD2 A;  2ZW5 A;  3B35 A;  4OAE A;  3PBB A;  4IAV A;  5LYD A;  3B3C A;  2YGW A;  1QSM A;  3N5F A;  1F57 A;  2ACF A;  4UCP A;  5LYF A;  1I1D A;  4D86 A;  4AG7 A;  4E0A A;  4F9U A;  4KOS A;  5KTD A;  2BEI A;  3EWR A;  2PJ8 A;  3IWE A;  1CJW A;  4TNU A;  3IEH A;  4OC0 A;  5F48 A;  2FS5 A;  1Y9W A;  3CXS A;  1CX8 A;  1DE4 C;  1XOV A;  5J8C A;  2FIW A;  2V8H A;  4Q38 A;  4UBR A;  3VAR A;  1ZG9 A;  4DUK A;  4NGP A;  2J8N A;  3TT2 A;  3FH4 A;  4CYO A;  1VHE A;  1F2O A;  4MCQ A;  4ZX9 A;  1Q7L A;  4HNX B;  4CGP A;  4QBJ A;  3KQZ A;  4GUA A;  1QQ9 A;  2C6G A;  1SQH A;  2FE7 A;  3ISX A;  4ONW A;  3WC5 A;  1S60 A;  2GLF A;  2JDD A;  5FSY A;  4H2K A;  1NMT A;  2ZEG A;  1Z9U A;  3FB3 A;  5JM6 A;  2L8R A;  3LAC A;  4M6I A;  2PSW A;  5ELY A;  1TXZ A;  3KHZ A;  3D8P A;  2XEF A;  1CG2 A;  2PJ9 A;  2XEJ A;  1GHE A;  3KKW A;  4H6U A;  1XFO A;  3PZJ A;  4JYW A;  1X12 A;  3KZW A;  3PBE A;  1QSO A;  2PJ7 A;  2FG1 A;  1Z5R A;  4YU9 A;  3SJG A;  2YNC C;  4FUU A;  4QVT A;  1QSR A;  4NGR A;  5F49 A;  2C1C A;  4P44 A;  1BLL E;  1AYE A;  2B58 A;  4AVC A;  3TE4 A;  4ZI6 A;  1V0C A;  2PC1 A;  5HH1 A;  4A38 A;  5HIH A;  1QSN A;  4B5O A;  2XEI A;  3FED A;  4B13 A;  4KUA A;  2ZW6 A;  1JWQ A;  5CB5 A;  5CNP A;  1J4J A;  1A2Z A;  1ZG7 A;  2ZEP A;  4CAV A;  2BO9 A;  4ABL A;  2BFQ A;  3IU2 A;  1TF9 A;  1P0H A;  2B5G A;  3JRU A;  1JQG A;  2XD7 A;  4GVW A;  2OZU A;  2PJA A;  3B2Y A;  4JD6 A;  2JZE A;  3PFE A;  4A31 A;  2Q44 A;  2Z10 A;  4PXB A;  4B11 A;  4C2Y A;  2PDO A;  2G3T A;  4GXH A;  3IIB A;  4RS2 A;  4F0X A;  2PJ6 A;  1TIQ A;  2Z3O A;  4FD5 A;  2Q4Y A;  5EMI A;  5GCN A;  2QJ8 A;  2VQY A;  2P6E A;  2PJ0 A;  5I0C A;  2QEC A;  3D7G A;  2B3V A;  4GM5 A;  3IU1 A;  2BOA A;  5G1Z A;  2JEV A;  3DGV A;  4BMH A;  4MMO A;  4JXR A;  2WPW A;  5C82 A;  2C27 A;  4OC3 A;  3FF3 A;  5CB3 A;  2Z3N A;  4JXQ A;  2EBJ A;  5LRJ A;  4EWT A;  4M3S A;  3JVN A;  2ZXV A;  2PJ2 A;  2PRB A;  5A28 A;  3QAH A;  4LQG A;  1R57 A;  4XPK A;  4J5Q A;  3FX6 A;  1Q2D A;  4R8F A;  1VHU A;  4UWJ A;  2GIV A;  2NSM A;  5THW A;  2NYQ A;  4CAE A;  4KSI A;  4AG9 A;  1M1D A;  4X8I A;  2K5T A;  4F9V A;  2PJ4 A;  4GVV A;  1IYL A;  1M4D A;  1Z4E A;  1IOI A;  5FSZ A;  1FNO A;  4FD6 A;  3BI0 A;  4Y49 B;  5HVG A;  4KOX A;  4PSX A;  5CMS A;  1XMT A;  4NEX A;  4CGL A;  1IYK A;  2YNC A;  2B3U A;  1B6B A;  1CPS A;  1KWM A;  3PFO A;  4OP4 A;  1YVO A;  5CPA A;  1OBR A;  3EWO A;  3EC4 A;  5EC4 A;  4EME A;  1YGH A;  4NCZ A;  2BFR A;  5K8M A;  4KUB A;  3ISZ A;  1S7N A;  2VZZ A;  1Y0Y A;  2YNE A;  4ZX8 A;  4X2T A;  2CNM A;  3DLJ A;  3GLJ A;  3R9F A;  2F7V A;  3VWD A;  2FL4 A;  5IX3 A;  2PJ5 A;  1ZLH A;  3T8W A;  2REF A;  2Z3K A;  4XPD C;  4FAI A;  2QYV A;  4NGT A;  2ZOF A;  2HUZ A;  4ORF A;  5F47 A;  1NE9 A;  1HDQ A;  3SII A;  2ZEN A;  3PB9 X;  4WJB A;  1TXR A;  3BI1 A;  3DSB A;  3P2H A;  3EJF A;  4FD4 A;  3CDX A;  4BIN A;  4F6A A;  3TOA A;  3S6G A;  1R43 A;  4M6G A;  2JZD A;  3GPG A;  4NGM A;  3SHP A;  5E96 A;  4F0Y A;  1ZR3 A;  3CT9 A;  2EWB A;  2FVG A;  4UFX A;  3G3S A;  3RNZ A;  3CZX A;  4A37 A;  5FSU A;  4KSA A;  1LFW A;  1B87 A;  3JUW A;  4IUS A;  1YW6 A;  2XEG A;  4RUH A;  1ZG8 A;  1XEB A;  3VFQ A;  4KVO E;  1RO5 A;  2D4O A;  4ABK A;  2O53 A;  5K8P A;  1BO4 A;  4CYQ A;  2J8M A;  3EW5 A;  2Z0Z A;  2ZEF A;  4XPL A;  4KZT A;  5DWM A;  5FSV A;  3TO6 A;  4A32 A;  4MBU A;  1BPM A;  4OID A;  2JEW A;  5HXD A;  4UEE A;  5KTA A;  1MJB A;  4MXU A;  4J5R A;  1S7F A;  1IGB A;  1WWZ A;  4B10 A;  4B6Z A;  1YME A;  4C7I A;  5FSX A;  4WWV A;  3S6K A;  1R3N A;  4BD9 A;  3BJ8 A;  1MK4 A;  4KVX A;  2CTC A;  4YFJ A;  3K9U A;  4KVM E;  4MFK A;  2ZPA A;  2A4N A;  4UA3 A;  4TU0 A;  2C6C A;  2CXA A;  3IJ3 A;  1I21 A;  4UIA A;  5G20 A;  1PUA A;  1YR0 A;  3SIH A;  5DWN A;  2HV2 A;  1HDU A;  2I3C A;  4PSW A;  3GKR A;  4R3L A;  3V38 A;  4A33 A;  5JPH A;  3FIX A;  4MHY A;  4TWE A;  1I12 A;  2V8D A;  1S7L A;  3TC8 A;  2FIA A;  5DUS A;  3IFE A;  2EK9 A;  4PXE A;  3V45 A;  4JJX A;  2Z3M A; 
#chains in the Genus database with same CATH homology
 1CP6 A;  2PJ3 A;  1HEE A;  4JLL A;  3V2B A;  1XBU A;  1ARM A;  1NSA A;  3PB4 X;  3RBU A;  3MRU A;  4W9Y A;  2GRE A;  2FXK A;  1VGY A;  4NGQ A;  4NGS A;  4ZY1 A;  4FWU A;  2ZED A;  5I4M A;  2ABZ A;  4P6Y A;  2IQ6 A;  3SI1 A;  3D66 A;  1BPN A;  1RTQ A;  3PB8 X;  3K9T A;  4Z65 A;  4MCP A;  3NH8 A;  1XMB A;  4ESS A;  2IMO A;  2LGR A;  2AFX A;  1XRY A;  4OIW A;  3GB0 A;  3CPX A;  2JBK A;  1Z8L A;  5JGF A;  3GPO A;  2AFZ A;  3IWW A;  3L2N A;  1DTD A;  3TX8 A;  1F2P A;  1TF8 A;  4MCR A;  3FEE A;  4R76 A;  3Q6Z A;  4PXD A;  3H8F A;  4X3R A;  5DS0 A;  2EK8 A;  3S9L A;  3I1U A;  3BHX A;  4F8Z A;  2CTB A;  1ELM P;  2IJZ A;  1Y7E A;  1YSJ A;  3IC1 A;  3GPQ A;  3SJX A;  3H8G A;  5D29 A;  4K0C A;  1TKH A;  6CPA A;  1CPX A;  1LAM A;  1ZR5 A;  4OC2 A;  2JBJ A;  3D68 A;  4NGN A;  2ZEE A;  3EWQ A;  2PJC A;  4OC4 A;  4A94 A;  1M4L A;  3RAM A;  2PE3 A;  1PYT B;  3NH5 A;  3S9N A;  4P4D A;  4ZYQ A;  1YD9 A;  2ZOG A;  2PRQ A;  2V77 A;  2AFW A;  3PB7 X;  2WYR A;  4J4Z A;  3IIF A;  1UWY A;  4P45 A;  4ETK A;  4G1P A;  4UML A;  2GU2 A;  4MCS A;  1Z2L A;  3SJE A;  3CPA A;  2FAV A;  3LWU A;  1LOK A;  4DYO A;  3ETI A;  1VIX A;  1CP7 A;  1TKF A;  1GYT A;  4P4E A;  2PJ1 A;  5CBM A;  2VL1 A;  5HOL A;  1IY7 A;  4PPZ A;  2RB7 A;  3SIG A;  4J5S A;  2PVW A;  4EFD A;  3JZT A;  2AFO A;  3FMC A;  3Q71 A;  4P4I A;  3SJF A;  1LAP A;  4R7M A;  2HC9 A;  4NJQ A;  3KR5 A;  3QNV A;  3NFZ A;  3NH4 A;  4DJL A;  3EKE A;  2O4H A;  4K3N A;  3IID A;  3B3T A;  2DEA A;  3HLP A;  3B3W A;  2AFU A;  3FJU A;  3WC7 A;  4P4F A;  1XJO A;  3SI0 A;  3SI2 A;  3KGQ A;  5AIL A;  2VRI A;  3K2K A;  2F8H A;  3PEI A;  4OKO A;  4P4J A;  4OC5 A;  2V8G A;  3WT4 A;  3EWP A;  3KI9 A;  2CIJ A;  1NJR A;  2PVV A;  3B7I A;  3D7H A;  3EJG A;  4YWY A;  1VHO A;  3D4U A;  3KQX A;  2G9D A;  3MN8 A;  2ANP A;  1ZLI A;  1H8L A;  4JCA A;  4IQY A;  2ZEH A;  4JVV A;  4MHN A;  4Q7A A;  1AMP A;  1HJZ A;  1YW4 A;  2Q51 A;  2RFH A;  4NJR A;  4UF4 A;  7CPA A;  2PCU A;  2PIZ A;  2BCO A;  4A39 A;  2ZEL A;  8CPA A;  2ZEM A;  3PB6 X;  2POK A;  5F09 A;  4MRI A;  2C6P A;  3D7D A;  4AXV A;  1TKJ A;  4JGK A;  4UEF A;  2X47 A;  1QMU A;  1SPV A;  4IHM A;  3HUV A;  5HVF A;  3D67 A;  3GUX A;  3KL9 A;  2PJB A;  2AFS A;  4OME A;  5LRG A;  5LYL A;  2WZN A;  3KHX A;  3D7F A;  4MHP A;  4IK2 A;  1LCP A;  3B3S A;  2EEE A;  2DX6 A;  3B3V A;  4MHZ A;  5HVH A;  4ZY2 A;  3KR4 A;  5E3B A;  4OC1 A;  5K8N A;  3RZA A;  5J1Q A;  3FEC A;  3GQO A;  4O23 A;  3VH9 A;  4PXC A;  4UEZ A;  4NFR A;  2GLJ A;  3WAB A;  2OOT A;  2ZEO A;  5D8N A;  1ELL P;  1PCA A;  1CBX A;  3VAT A;  5JH9 A;  2AFC A;  1FT7 A;  2AFM A;  1ARL A;  3LMS A;  1LAN A;  3GQE A;  4ETJ A;  1YLO A;  4JZ0 A;  3PRT A;  3KAS A;  3NA6 A;  1EE3 P;  4PQA A;  3BXM A;  4UIB A;  5LRK A;  2CF4 A;  3V7Z A;  2HB6 A;  2J9A A;  3IO1 A;  4ZY0 A;  4FBE A;  1Y0R A;  4P4B A;  2PIY A;  3WC6 A;  5IB9 A;  2Q43 A;  2Q4Z A;  3H8E A;  2QVP A;  3S9M A;  2OR4 A;  5LYI A;  4P10 A;  3FVL A;  3SIJ A;  2V8V A;  1BAV A;  5K8O A;  1TY8 A;  4KYB A;  4CPA A;  4R6T A;  3B35 A;  3PBB A;  4IAV A;  5LYD A;  3B3C A;  3N5F A;  1F57 A;  2ACF A;  5LYF A;  4D86 A;  4F9U A;  3EWR A;  2PJ8 A;  4TNU A;  3IEH A;  4OC0 A;  1CX8 A;  1DE4 C;  2V8H A;  3VAR A;  1ZG9 A;  4DUK A;  4NGP A;  3FH4 A;  1VHE A;  1F2O A;  4MCQ A;  4ZX9 A;  1Q7L A;  3KQZ A;  4GUA A;  1QQ9 A;  2C6G A;  3ISX A;  4ONW A;  3WC5 A;  2GLF A;  5FSY A;  4H2K A;  2ZEG A;  5JM6 A;  2L8R A;  5ELY A;  1TXZ A;  3KHZ A;  2XEF A;  1CG2 A;  2PJ9 A;  2XEJ A;  1XFO A;  4JYW A;  3KZW A;  3PBE A;  2PJ7 A;  2FG1 A;  1Z5R A;  4YU9 A;  3SJG A;  4FUU A;  4NGR A;  2C1C A;  4P44 A;  1BLL E;  1AYE A;  4ZI6 A;  4A38 A;  5HIH A;  2XEI A;  3FED A;  5CB5 A;  1ZG7 A;  2ZEP A;  2BO9 A;  4ABL A;  2BFQ A;  1TF9 A;  3JRU A;  3B2Y A;  1JQG A;  2XD7 A;  4GVW A;  2PJA A;  3PFE A;  4PXB A;  3IIB A;  2PJ6 A;  2QJ8 A;  2PJ0 A;  3D7G A;  4GM5 A;  2BOA A;  3DGV A;  4MMO A;  4OC3 A;  3FF3 A;  5CB3 A;  4EWT A;  5LRJ A;  2PJ2 A;  4LQG A;  4J5Q A;  3FX6 A;  4R8F A;  1VHU A;  2NSM A;  5THW A;  2NYQ A;  4KSI A;  4X8I A;  4F9V A;  2PJ4 A;  4GVV A;  5FSZ A;  1FNO A;  3BI0 A;  5HVG A;  5CMS A;  1CPS A;  1KWM A;  3PFO A;  4OP4 A;  5CPA A;  1OBR A;  3EWO A;  4EME A;  2BFR A;  5K8M A;  3ISZ A;  3DLJ A;  1Y0Y A;  4ZX8 A;  4X2T A;  3GLJ A;  2F7V A;  2PJ5 A;  1ZLH A;  3T8W A;  4FAI A;  2QYV A;  4NGT A;  2ZOF A;  1HDQ A;  3SII A;  2ZEN A;  3PB9 X;  4WJB A;  1TXR A;  3BI1 A;  3EJF A;  3CDX A;  1R43 A;  4NGM A;  3GPG A;  1ZR3 A;  3CT9 A;  2EWB A;  2FVG A;  4A37 A;  5FSU A;  1LFW A;  1YW6 A;  2XEG A;  4RUH A;  1ZG8 A;  3VFQ A;  4ABK A;  2O53 A;  5K8P A;  3EW5 A;  2ZEF A;  5FSV A;  1BPM A;  4OID A;  2JEW A;  5HXD A;  4UEE A;  4MXU A;  4J5R A;  4B6Z A;  1IGB A;  1YME A;  5FSX A;  4WWV A;  1R3N A;  4BD9 A;  2CTC A;  4UIA A;  4TU0 A;  2C6C A;  3IJ3 A;  3SIH A;  1HDU A;  2I3C A;  3V38 A;  4MHY A;  4TWE A;  2V8D A;  3TC8 A;  5DUS A;  3IFE A;  2EK9 A;  4PXE A;  3V45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...