4ZYQA

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10s
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
519
structure length
517
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 172
structure length 517
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zyqA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zyqA02
4UIAA 5HOLA 2PJ7A 2DX6A 4K0CA 3SI0A 4ABLA 1SPVA 3FEDA 2PJ3A 2AFSA 4MHPA 3B2YA 3WC6A 1ELMP 4NGNA 1Y0YA 4YU9A 3NFZA 5HVFA 4NGMA 2CF4A 2PRQA 2PVWA 2EEEA 4R7MA 3LMSA 3GPQA 2V8HA 3FEEA 4CPAA 3D7DA 2VRIA 4NJRA 3B3WA 1XMBA 3H8GA 4PXDA 4EMEA 3PBBA 3D67A 2EWBA 1NJRA 1LOKA 4GUAA 5D29A 4IQYA 4FAIA 4JYWA 2J9AA 1XFOA 3K2KA 3IFEA 2AFOA 3JZTA 1AMPA 5CBMA 2XEJA 3D7HA 4OMEA 2ZEMA 5JH9A 4OC4A 1VHEA 4EFDA 3K9TA 4P4FA 1ZR3A 5HIHA 4MRIA 7CPAA 3B3SA 4B6ZA 3IJ3A 4F8ZA 4K3NA 1PCAA 2FG1A 3Q71A 5AILA 2ZOFA 3V45A 3NH4A 5HVHA 3IWWA 5E3BA 3CPAA 3KQZA 1Y7EA 5LYLA 1DE4C 1UWYA 4P4IA 3VATA 3RZAA 1CX8A 1Z8LA 2JBKA 1HJZA 2BOAA 3PFOA 4X3RA 2POKA 3B7IA 3NH8A 2VL1A 4JVVA 3EW5A 2C6CA 2BFQA 4F9VA 2O4HA 4FUUA 2ZEGA 3TC8A 1M4LA 3BXMA 2PVVA 4MCPA 4A94A 4F9UA 4MXUA 4TNUA 1TKFA 2XEGA 3ISZA 3D7GA 2EK8A 2JEWA 2F7VA 4ZY1A 4A37A 3VFQA 4AXVA 2AFCA 3WABA 4TU0A 4EWTA 3FJUA 2GU2A 3LWUA 2ANPA 1ZG7A 4UEZA 4P6YA 3I1UA 1YMEA 1LANA 1QMUA 4OC1A 3SIHA 4J4ZA 3FVLA 3TX8A 1TXRA 4A39A 4PQAA 1FNOA 2ABZA 4MHYA 3IIFA 2FAVA 2XEIA 2BO9A 3ETIA 1QQ9A 4GVWA 1Y0RA 3B3TA 2DEAA 3B3VA 2C6PA 2ZEDA 2QYVA 1Z5RA 1LAMA 1CP7A 3FH4A 1AYEA 1KWMA 3GPGA 3IEHA 3PB9X 4JCAA 3V7ZA 4X8IA 3SI2A 5DUSA 1TKHA 1TKJA 1F2PA 2ZEHA 2BCOA 4NGQA 2XD7A 1R43A 4ETJA 3IO1A 2ZEFA 4JGKA 2NYQA 5LYFA 4Z65A 4JLLA 1TF9A 5CMSA 4P4JA 2HC9A 1RTQA 3SI1A 5K8MA 3CDXA 3PB7X 1IGBA 2CTBA 2ACFA 2Q43A 2CIJA 1ARLA 3H8FA 3B35A 3QNVA 4JZ0A 3GQEA 1LFWA 2PIZA 4NJQA 3KZWA 2PIYA 3GLJA 4FWUA 2L8RA 4LQGA 5HXDA 4D86A 3FECA 4WWVA 2LGRA 3NH5A 2RFHA 5FSZA 1XBUA 1BAVA 3B3CA 4DJLA 3WT4A 2AFUA 4PPZA 3GQOA 2PJ4A 3PRTA 1VHOA 2ZEOA 5JGFA 3NA6A 3KASA 1ZR5A 2V77A 2ZOGA 4OIWA 3GUXA 2C1CA 2ZELA 1PYTB 4MCRA 1BLLE 4ZX9A 5CB3A 2PJ0A 1ZG8A 3PFEA 2WYRA 4YWYA 1IY7A 4MHZA 2ZENA 8CPAA 1ZG9A 5K8NA 2NSMA 4OIDA 3IIDA 1OBRA 1R3NA 4MHNA 4KSIA 2PJ2A 4UEFA 3V2BA 4OC2A 4IHMA 3IC1A 4NFRA 2PJ1A 3Q6ZA 3N5FA 3EWRA 5THWA 4UEEA 3EJFA 5FSYA 2QJ8A 2OOTA 3PBEA 4X2TA 3SIJA 3BI0A 4OP4A 3SJEA 2PJBA 1ZLIA 3RBUA 2FXKA 3KQXA 4ONWA 2AFWA 5LRGA 2AFMA 1YLOA 2PJCA 3HUVA 1TY8A 1CPSA 4UF4A 4J5QA 5D8NA 5F09A 5HVGA 1ARMA 3T8WA 3BHXA 4A38A 4J5RA 1YSJA 2V8GA 1YW4A 3D66A 5ELYA 1EE3P 4OKOA 1CBXA 2GLFA 2OR4A 2PJ5A 5FSXA 4TWEA 5FSUA 4WJBA 5J1QA 4P4EA 1HDQA 3EWQA 5CB5A 3SIIA 5K8OA 4P45A 3D7FA 4OC5A 2V8VA 4R8FA 3PB8X 5DS0A 4NGPA 1TF8A 3SJXA 1VHUA 1NSAA 2CTCA 3D4UA 4BD9A 1VIXA 3BI1A 4MMOA 3SJFA 5IB9A 2F8HA 3CPXA 2EK9A 4OC0A 3V38A 3KGQA 1F57A 2PJAA 4P4DA 4NGTA 4IK2A 3MN8A 3EKEA 4PXEA 1Z2LA 1ELLP 2PJ6A 5FSVA 3DGVA 3CT9A 2ZEPA 2Q51A 3SJGA 4UIBA 3KHXA 4ABKA 1YD9A 4H2KA 3IIBA 1VGYA 3ISXA 4NGRA 4NGSA 2G9DA 2AFZA 2X47A 4P10A 4ESSA 4G1PA 3KL9A 1LAPA 1CP6A 3DLJA 2PJ9A 5LYIA 3L2NA 4ZY2A 3KI9A 4W9YA 1DTDA 4KYBA 4UMLA 2PCUA 4IAVA 3EWPA 2QVPA 3HLPA 4OC3A 2I3CA 5LRKA 4R76A 1HDUA 2HB6A 3MRUA 3GPOA 5I4MA 2O53A 2C6GA 2Q4ZA 3GB0A 3VH9A 1HEEA 4Q7AA 2GREA 3FF3A 3S9LA 3H8EA 4ZYQA 2GLJA 2PJ8A 1ZLHA 3KR5A 2FVGA 4ZY0A 1CPXA 1JQGA 3SIGA 1XRYA 2RB7A 3S9NA 2XEFA 1XJOA 3VARA 4P44A 3PEIA 1GYTA 2PE3A 3FMCA 5LYDA 3EJGA 3D68A 3JRUA 2WZNA 1LCPA 1H8LA 1CG2A 5K8PA 4PXCA 4GVVA 3KR4A 3EWOA 4ETKA 4DYOA 2BFRA 4MCSA 4ZI6A 3PB4X 1BPNA 4R6TA 1BPMA 4FBEA 4P4BA 2JBJA 2V8DA 4DUKA 4O23A 4J5SA 2AFXA 4RUHA 5LRJA 3RAMA 5JM6A 3KHZA 3WC7A 4ZX8A 2IMOA 3FX6A 1TXZA 3WC5A 1Q7LA 2ZEEA 2IJZA 2IQ6A 4MCQA 6CPAA 1FT7A 4GM5A 5CPAA 1YW6A 4PXBA 3PB6X 1F2OA 3S9MA
chains in the Genus database with same CATH superfamily
4ZGYB 3DNSA 4UIAA 1U6MA 5HOLA 1KUXA 2PJ7A 2DX6A 4K0CA 1IB1E 4J3GA 3SI0A 4ABLA 4F6AA 1SPVA 4L89A 4M6GA 3IGRA 3S6GA 3RZAA 3FEDA 5F48A 3TCVA 2PJ3A 2AFSA 2D4PA 1IICA 4M6IA 4UCPA 4B5PA 2B4BA 4MHPA 3B2YA 3R9FA 2F5IA 3WC6A 1M4IA 4CGPA 4F0YA 1ELMP 1FY7A 1LRZA 4NGNA 2B3VA 1Y0YA 1VKCA 4YU9A 3P2FA 3NFZA 5AGEA 5G21A 5HVFA 2QMLA 4NGMA 4YRHA 1S7KA 2CF4A 2PRQA 4CAWA 3F8KA 2PVWA 2EEEA 4R7MA 3LMSA 3GPQA 4H6ZA 2V8HA 1YLEA 2Q4YA 3FEEA 3D7DA 2VRIA 2CXAA 4NJRA 5GCNA 3B3WA 4CPAA 1XMBA 5AG4A 4R3LA 3H8GA 2WPXA 4PXDA 4EMEA 3PBBA 2GANA 3D67A 1Q2CA 2Q04A 2FL4A 3V8IA 2EWBA 1NJRA 1LOKA 4GUAA 3B8GA 4NXYA 5D29A 4IQYA 4FAIA 1OZPA 4JYWA 1M4DA 2J9AA 1XFOA 2R8VA 1MJ9A 3K2KA 1B6BA 4MFLA 4UWIA 3EFAA 1NE9A 3IFEA 4EVYA 2AFOA 3JZTA 1AMPA 5CBMA 1Z9UA 2XEJA 3D7HA 1R57A 1XF8A 4OMEA 3CXPA 2JZDA 2ZEMA 3S6KA 5JH9A 1MK4A 4OC4A 1Y9KA 1VHEA 3R9EA 3VATA 4EFDA 3RNZA 4MFPA 3K9TA 3R1KA 2PRBA 4P4FA 1ZR3A 5HIHA 4MRIA 7CPAA 2Z11A 4NEXA 3I3GA 3A9LA 3B3SA 4MJ8A 4A2ZA 1Z4EA 4B6ZA 3IJ3A 2ZPAA 4B13A 4CAXA 4F8ZA 4K3NA 3DDDA 1PCAA 2FG1A 3Q71A 5AILA 2Z3PA 4FD7A 2ZOFA 3FNCA 1KUYA 3V45A 3NH4A 4A30A 2R7HA 5HVHA 1YVKA 2VBQA 4HNYB 4UFVA 4NCZA 3IWWA 5E3BA 4A33A 3CPAA 3KQZA 1Y7EA 4C7IA 5LYLA 1DE4C 1NSLA 1UWYA 4MFQA 1N71A 4P4IA 3UY5A 1IU8A 4KOSA 1CX8A 1Z8LA 1Y9WA 1HJZA 2JBKA 2WSAA 2BOAA 1Y7RA 2OZHA 3OWCA 3PFOA 4X3RA 2POKA 3B7IA 3NH8A 5FVJA 2VL1A 2D4OA 1CM0A 1I21A 4JVVA 3FRMA 4KVOE 5BWAB 4UWJA 4E8OA 3DR8A 4BBHA 3EW5A 2C6CA 2Z3MA 2BFQA 2Q4VA 2O4HA 4KVXA 4MHDA 4FUUA 4AG7A 4F9VA 2ZEGA 3TC8A 1M4LA 3BXMA 2PVVA 4MCPA 3D2PA 1QSRA 2G3AA 1QSNA 4A94A 4F9UA 2WPWA 4MXUA 5KTAA 4TNUA 2B3UA 1IYKA 1TKFA 2ZW5A 2XEGA 3ISZA 4CS0B 1X12A 1M44A 4A32A 4KVME 2ARHA 3H5ZA 4YFJA 3D7GA 1S3ZA 2EK8A 2JEWA 2F7VA 5C88A 1KUVA 4H6UA 4NF1A 4Y49B 4ZY1A 3JUWA 1QSMA 3VFQA 4A37A 5C82A 4AXVA 3S6HA 2AFCA 3WABA 3SXNA 4FD6A 1K4JA 4QC6A 4TU0A 4EWTA 3FJUA 3VWEA 3I9SA 3DSBA 2GU2A 3LWUA 2ANPA 3EC4A 1ZG7A 2PDOA 3W6SA 2ZW7A 2JZEA 2Y0MA 4UEZA 4KLWA 4M85A 4P6YA 4U9ZA 4B5OA 3I1UA 1YMEA 4C68A 1J4JA 1LANA 1QMUA 4OC1A 3SIHA 4B10A 4J4ZA 3FVLA 2NMTA 1TXRA 3TX8A 1PU9A 2Z3LA 4PQAA 4A39A 1FNOA 4R57A 1YK3A 2ABZA 3IU2A 4CYOA 4MHYA 4XPDC 3IIFA 2FAVA 3ETIA 1Y0RA 1MJAA 1S7NA 4GVWA 1QQ9A 2BO9A 2XEIA 3B3TA 3DR6A 1Q2YA 2DEAA 4KOVA 3B3VA 4PK3A 2C6PA 2ZEDA 5G1ZA 2QYVA 2BL1A 3P2HA 1Z5RA 1LAMA 1I12A 2QECA 1CP7A 3FB3A 4DNCA 3FH4A 3NE8A 4AVCA 1AYEA 2I00A 1KWMA 3GPGA 3RYOA 3IEHA 3PB9X 4JWPA 4JCAA 2HV2A 4CYPA 4UCMA 4LX9A 2ATRA 2KCWA 4X8IA 3SI2A 1YX0A 4ONUA 3V7ZA 3TFYA 1XE4A 5DUSA 3GYAA 2GIVA 3CXSA 1TKHA 1TKJA 4QVTA 2R98A 1F2PA 2ZEHA 2BCOA 2KQVA 2XD7A 2YNCA 1R43A 1RO5A 2O28A 4NGQA 4RN7A 4UBRA 5HMNA 4ETJA 3IO1A 2ZEFA 4JGKA 2NYQA 2WUUA 4Z65A 5LYFA 4JLLA 1TF9A 5CMSA 2FSRA 4KUAA 2BSWA 2OB0A 2OZGA 3FXTA 4LQ6A 2HC9A 1RTQA 3PZJA 4P4JA 2FXFA 3SI1A 3CDXA 5EMIA 3W6XA 4CRYB 5K8MA 2QIRA 3PB7X 1IGBA 1WWZA 2CTBA 4GS4A 4RS2A 4UFXA 2ACFA 2Q43A 3BJ8A 3TO6A 2CIJA 1ARLA 4KZTA 3H8FA 3B35A 3QNVA 4JZ0A 2OZUA 3GQEA 2IL4A 3TOAA 3BJ7A 4Q38A 4Y49C 4E2AA 4XNHB 2FIWA 4MFKA 1LFWA 1I1DA 2PIZA 4NJQA 4M6HA 3KZWA 2PIYA 3GLJA 2VZYA 2L8RA 4FWUA 4UFWA 2H5MA 4LQGA 1SQHA 3C26A 4C2YA 5HXDA 4D86A 3FECA 4WWVA 5DWMA 2LGRA 3NH5A 2RFHA 5FSZA 3H4QA 4L8AA 1XBUA 1BAVA 2YNCC 3B3CA 3WT4A 4BINA 4DJLA 2ZXVA 2AFUA 3MGDA 2BUEA 3EXNA 3GQOA 2PJ4A 4PPZA 5AG7A 3SHPA 4KOUA 4B12A 2Z10A 3PRTA 4R9MA 1VHOA 2ZEOA 3PGPA 5JGFA 5H86A 5ISVA 2B4DB 4KOWA 1XEBA 3NA6A 5A27A 3KASA 1ZR5A 3F0AA 4MBUA 4NSQA 5IV0A 2VEZA 2DPSA 2V77A 2ZOGA 5EC4A 2I79A 2A4NA 4FD4A 4OIWA 3GUXA 2C1CA 2EBJA 2ZELA 3RO0A 4GXHA 4A31A 1PYTB 4MCRA 1BLLE 4ZX9A 5CB3A 2PJ0A 1ZG8A 3PFEA 5EBVA 2WYRA 4YWYA 1IY7A 3T90A 2EUIA 4MHZA 4XPKA 2ZENA 4BMHA 8CPAA 4HPSA 4CYQA 1ZG9A 2G0BA 5K8NA 2ZW4A 2NSMA 4IF5A 3IWGA 2ZW6A 4OIDA 2G3TA 3W91A 5AG6A 3IIDA 1OBRA 2RNKA 1R3NA 4MHNA 4KSIA 4KUBA 2PJ2A 4JXRA 4UEFA 2JZFA 3V2BA 1Z4RA 4IHMA 4OC2A 3F5BA 3G8WA 3IC1A 4NFRA 1NMTA 2PJ1A 3Q6ZA 2P6GA 3N5FA 1JWQA 3GIUA 3EWRA 5THWA 4UEEA 3D3SA 3TTHA 4I49A 3EJFA 5FSYA 2P0WA 3JVNA 4HNWB 2B4DA 2QJ8A 2CNSA 1UFHA 1V0CA 3K9UA 2OOTA 3PBEA 2Z3OA 4X2TA 3SIJA 3BI0A 4JXQA 4OP4A 3SJEA 2PSWA 2DXQA 2PJBA 1ZLIA 2YGWA 2FXKA 3FYNA 4QB9A 4R3KA 3RBUA 3KQXA 4C2XA 5E96A 4ONWA 2AFWA 4JLYA 4MI4A 2AFMA 5G22A 1YLOA 2PJCA 3HUVA 5LRGA 4AB7A 1TY8A 1CPSA 4UF4A 4XNHC 4J5QA 5D8NA 5F09A 4ORFA 1QSTA 1ARMA 1WK4A 5HVGA 4B14A 3T8WA 2YNEA 3BHXA 3QAYA 4A38A 4J5RA 1YSJA 2V8GA 1Z8XA 2RC4A 1YW4A 3PP9A 1S7FA 3D66A 4KSAA 1EE3P 2Q44A 5ELYA 3IU1A 5AG5A 5H84A 2GFQA 2FT0A 4OKOA 4A95A 1CBXA 1X10A 1XOVA 2REFA 4RI1A 4CGMA 2GLFA 4CAEA 4AVAA 2OR4A 3ZJ0A 2J8RA 5FSXA 1BOBA 2PJ5A 4TWEA 5FSUA 4WJBA 4C7HA 4H89A 2EO8A 3LD2A 2HUZA 2B58A 5KTDA 5J1QA 2DPTA 1ZO0A 4KSFA 4P4EA 5DWNA 1HDQA 5JPHA 3EWQA 5CB5A 3S6FA 3SIIA 5K8OA 4CRZB 2PC1A 4P45A 2CY2A 4JJXA 3D7FA 2J8MA 4OC5A 1A2ZA 3VWDA 2V8VA 4R8FA 4KS9A 3EO4A 2FS5A 3PB8X 4NGPA 1TF8A 4QUSA 5DS0A 3E0KA 3SJXA 4AVBA 2R1IA 2JEVA 1VHUA 1NSAA 2CTCA 3D4UA 4BD9A 4ZBGA 1VIXA 3BI1A 4AG9A 4MMOA 3SJFA 4B11A 5IB9A 2F8HA 3CPXA 3TE4A 2EK9A 1IYLA 3LACA 4OC0A 3LODA 3V38A 2Z0ZA 3KGQA 4CGOA 1F57A 2PJAA 2PQ8A 4P4DA 3IWEA 4NGTA 4IK2A 3MN8A 3EKEA 4CAFA 3N7ZA 1S5KA 3QAHA 4PXEA 1Z2LA 3QB8A 1ELLP 1YGHA 2PJ6A 3D2MA 4CGLA 2C27A 5FSVA 2FE7A 2K5TA 4KOYA 3DGVA 5CNPA 1P4NA 1VHSA 3CT9A 3TO7A 2ZEPA 4CGNA 2Q51A 5J8FA 3SJGA 4UIBA 3KHXA 4U9YA 4ABKA 4C2ZA 1YD9A 2Z3KA 3WR7A 4H2KA 4MFJA 3IIBA 1VGYA 3ISXA 4PV6A 2B5GB 4NGRA 4NGSA 1CJWA 1QSOA 2G9DA 4OAEA 1Z8WA 2Z3NA 2AFZA 4UA3A 2X47A 2Q7SA 2AJ6A 3CXQA 4P10A 4ESSA 4G1PA 4OADA 4PSXA 2EVNA 3KL9A 1LAPA 1CP6A 1IOFA 3EY5A 5I0CA 3D8PA 3DLJA 2PJ9A 5LYIA 3R95A 1S7LA 2AE6A 3L2NA 5F47A 4ZY2A 3KI9A 4HKFA 1B87A 4W9YA 1DTDA 5A28A 4KYBA 4UMLA 1KZFA 2PCUA 2VI7A 4IAVA 3EWPA 2QVPA 3HLPA 1XMTA 3GY9A 4OC3A 2REEA 3FIXA 3TO9A 2I3CA 5LRKA 4R76A 1HDUA 2HB6A 2VZZA 3GPOA 3MRUA 5F46A 5I4MA 2O53A 3TOBA 1PUAA 2C6GA 2Q4ZA 4X5KA 4XPLA 3GB0A 3GKRA 2GE3A 2VXKA 1ON0A 4MFZA 3VH9A 1HEEA 3JTKA 4Q7AA 2GREA 2W2GA 3FF3A 5G20A 2BEIA 3H8EA 3R96A 4CYNA 3TT2A 3S9LA 4ZYQA 5KTCA 2GLJA 1MJBA 2B5GA 2PJ8A 4XPDB 2P6EA 1ZLHA 1XIXA 5IX3A 2DF5A 1RXTA 3KR5A 2FVGA 5JQ4A 3CZXA 4ZY0A 2Q7BA 3ZZIA 4FD5A 1GHEA 1CPXA 5HH1A 1YQEA 2PR8A 1JQGA 3SIGA 1XRYA 2CNTA 2HQYA 2RB7A 1IIDA 4JD6A 3BLNA 3T9YA 3S9NA 2XEFA 1XJOA 4K30A 3VARA 1AUGA 2FCKA 4P44A 3PEIA 1BO4A 3SXOA 1GYTA 2PE3A 2J8NA 2PR1A 3FBUA 3FMCA 4U5YA 1YREA 1IOIA 3EJGA 2FIAA 4MY0A 3D68A 5LYDA 4E0AA 4R87A 3JRUA 3KKWA 2WZNA 1LCPA 2JDCA 4Q36A 1H8LA 1CG2A 5K8PA 4PXCA 4GVVA 3KR4A 3EWOA 4HNXB 1P0HA 1TIQA 4ETKA 4DYOA 2WCTA 2BFRA 4MCSA 4M3SA 4ZI6A 2P6FA 3PB4X 2CNMA 4KORA 1BPNA 4R6TA 1BPMA 1M4GA 4FBEA 4P4BA 2JBJA 2V8DA 4DUKA 4O23A 5IB0A 1M1DA 4J5SA 2AFXA 4B5PB 4KLVA 4LUAA 4RUHA 5LRJA 4KOXA 4YGOA 3RAMA 5JM6A 2YNDA 4MY3A 1L0CA 2Q0YA 3KHZA 4PK2A 3WC7A 2VQYA 2X7BA 3NE7A 4CAVA 4ZX8A 1S60A 2IMOA 1TXZA 3FX6A 4UCNA 1Q7LA 2ZEEA 3WC5A 2OH1A 2IJZA 2IQ6A 4QBJA 4II9A 1YR0A 4IUSA 4MCQA 3G3SA 6CPAA 4F0XA 1FT7A 4GM5A 2JDDA 4PSWA 5J8CA 5CPAA 1YW6A 2JLMA 1Q2DA 1Z8TA 4OLLA 2OU2A 5F49A 4KOTA 1YVOA 3PB6X 4PXBA 1F2OA 3R9GA 2ODFA 3S9MA
chains in the Genus database with same CATH topology
4UIAA 5HOLA 2PJ7A 2DX6A 4K0CA 3SI0A 4ABLA 1SPVA 3FEDA 2PJ3A 2AFSA 4MHPA 3B2YA 3WC6A 1ELMP 4NGNA 1Y0YA 4YU9A 3NFZA 5HVFA 4NGMA 2CF4A 2PRQA 2PVWA 2EEEA 4R7MA 3LMSA 3GPQA 2V8HA 3FEEA 4CPAA 3D7DA 2VRIA 4NJRA 3B3WA 1XMBA 3H8GA 4PXDA 4EMEA 3PBBA 3D67A 2EWBA 1NJRA 1LOKA 4GUAA 5D29A 4IQYA 4FAIA 4JYWA 2J9AA 1XFOA 3K2KA 3IFEA 2AFOA 3JZTA 1AMPA 5CBMA 2XEJA 3D7HA 4OMEA 2ZEMA 5JH9A 4OC4A 1VHEA 4EFDA 3K9TA 4P4FA 1ZR3A 5HIHA 4MRIA 7CPAA 3B3SA 4B6ZA 3IJ3A 4F8ZA 4K3NA 1PCAA 2FG1A 3Q71A 5AILA 2ZOFA 3V45A 3NH4A 5HVHA 3IWWA 5E3BA 3CPAA 3KQZA 1Y7EA 5LYLA 1DE4C 1UWYA 4P4IA 3VATA 3RZAA 1CX8A 1Z8LA 2JBKA 1HJZA 2BOAA 3PFOA 4X3RA 2POKA 3B7IA 3NH8A 2VL1A 4JVVA 3EW5A 2C6CA 2BFQA 4F9VA 2O4HA 4FUUA 2ZEGA 3TC8A 1M4LA 3BXMA 2PVVA 4MCPA 4A94A 4F9UA 4MXUA 4TNUA 1TKFA 2XEGA 3ISZA 3D7GA 2EK8A 2JEWA 2F7VA 4ZY1A 4A37A 3VFQA 4AXVA 2AFCA 3WABA 4TU0A 4EWTA 3FJUA 2GU2A 3LWUA 2ANPA 1ZG7A 4UEZA 4P6YA 3I1UA 1YMEA 1LANA 1QMUA 4OC1A 3SIHA 4J4ZA 3FVLA 3TX8A 1TXRA 4A39A 4PQAA 1FNOA 2ABZA 4MHYA 3IIFA 2FAVA 2XEIA 2BO9A 3ETIA 1QQ9A 4GVWA 1Y0RA 3B3TA 2DEAA 3B3VA 2C6PA 2ZEDA 2QYVA 1Z5RA 1LAMA 1CP7A 3FH4A 1AYEA 1KWMA 3GPGA 3IEHA 3PB9X 4JCAA 3V7ZA 4X8IA 3SI2A 5DUSA 1TKHA 1TKJA 1F2PA 2ZEHA 2BCOA 4NGQA 2XD7A 1R43A 4ETJA 3IO1A 2ZEFA 4JGKA 2NYQA 5LYFA 4Z65A 4JLLA 1TF9A 5CMSA 4P4JA 2HC9A 1RTQA 3SI1A 5K8MA 3CDXA 3PB7X 1IGBA 2CTBA 2ACFA 2Q43A 2CIJA 1ARLA 3H8FA 3B35A 3QNVA 4JZ0A 3GQEA 1LFWA 2PIZA 4NJQA 3KZWA 2PIYA 3GLJA 4FWUA 2L8RA 4LQGA 5HXDA 4D86A 3FECA 4WWVA 2LGRA 3NH5A 2RFHA 5FSZA 1XBUA 1BAVA 3B3CA 4DJLA 3WT4A 2AFUA 4PPZA 3GQOA 2PJ4A 3PRTA 1VHOA 2ZEOA 5JGFA 3NA6A 3KASA 1ZR5A 2V77A 2ZOGA 4OIWA 3GUXA 2C1CA 2ZELA 1PYTB 4MCRA 1BLLE 4ZX9A 5CB3A 2PJ0A 1ZG8A 3PFEA 2WYRA 4YWYA 1IY7A 4MHZA 2ZENA 8CPAA 1ZG9A 5K8NA 2NSMA 4OIDA 3IIDA 1OBRA 1R3NA 4MHNA 4KSIA 2PJ2A 4UEFA 3V2BA 4OC2A 4IHMA 3IC1A 4NFRA 2PJ1A 3Q6ZA 3N5FA 3EWRA 5THWA 4UEEA 3EJFA 5FSYA 2QJ8A 2OOTA 3PBEA 4X2TA 3SIJA 3BI0A 4OP4A 3SJEA 2PJBA 1ZLIA 3RBUA 2FXKA 3KQXA 4ONWA 2AFWA 5LRGA 2AFMA 1YLOA 2PJCA 3HUVA 1TY8A 1CPSA 4UF4A 4J5QA 5D8NA 5F09A 5HVGA 1ARMA 3T8WA 3BHXA 4A38A 4J5RA 1YSJA 2V8GA 1YW4A 3D66A 5ELYA 1EE3P 4OKOA 1CBXA 2GLFA 2OR4A 2PJ5A 5FSXA 4TWEA 5FSUA 4WJBA 5J1QA 4P4EA 1HDQA 3EWQA 5CB5A 3SIIA 5K8OA 4P45A 3D7FA 4OC5A 2V8VA 4R8FA 3PB8X 5DS0A 4NGPA 1TF8A 3SJXA 1VHUA 1NSAA 2CTCA 3D4UA 4BD9A 1VIXA 3BI1A 4MMOA 3SJFA 5IB9A 2F8HA 3CPXA 2EK9A 4OC0A 3V38A 3KGQA 1F57A 2PJAA 4P4DA 4NGTA 4IK2A 3MN8A 3EKEA 4PXEA 1Z2LA 1ELLP 2PJ6A 5FSVA 3DGVA 3CT9A 2ZEPA 2Q51A 3SJGA 4UIBA 3KHXA 4ABKA 1YD9A 4H2KA 3IIBA 1VGYA 3ISXA 4NGRA 4NGSA 2G9DA 2AFZA 2X47A 4P10A 4ESSA 4G1PA 3KL9A 1LAPA 1CP6A 3DLJA 2PJ9A 5LYIA 3L2NA 4ZY2A 3KI9A 4W9YA 1DTDA 4KYBA 4UMLA 2PCUA 4IAVA 3EWPA 2QVPA 3HLPA 4OC3A 2I3CA 5LRKA 4R76A 1HDUA 2HB6A 3MRUA 3GPOA 5I4MA 2O53A 2C6GA 2Q4ZA 3GB0A 3VH9A 1HEEA 4Q7AA 2GREA 3FF3A 3S9LA 3H8EA 4ZYQA 2GLJA 2PJ8A 1ZLHA 3KR5A 2FVGA 4ZY0A 1CPXA 1JQGA 3SIGA 1XRYA 2RB7A 3S9NA 2XEFA 1XJOA 3VARA 4P44A 3PEIA 1GYTA 2PE3A 3FMCA 5LYDA 3EJGA 3D68A 3JRUA 2WZNA 1LCPA 1H8LA 1CG2A 5K8PA 4PXCA 4GVVA 3KR4A 3EWOA 4ETKA 4DYOA 2BFRA 4MCSA 4ZI6A 3PB4X 1BPNA 4R6TA 1BPMA 4FBEA 4P4BA 2JBJA 2V8DA 4DUKA 4O23A 4J5SA 2AFXA 4RUHA 5LRJA 3RAMA 5JM6A 3KHZA 3WC7A 4ZX8A 2IMOA 3FX6A 1TXZA 3WC5A 1Q7LA 2ZEEA 2IJZA 2IQ6A 4MCQA 6CPAA 1FT7A 4GM5A 5CPAA 1YW6A 4PXBA 3PB6X 1F2OA 3S9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIA A;  5HOL A;  2PJ7 A;  2DX6 A;  4K0C A;  3SI0 A;  4ABL A;  1SPV A;  3FED A;  2PJ3 A;  2AFS A;  4MHP A;  3B2Y A;  3WC6 A;  1ELM P;  4NGN A;  1Y0Y A;  4YU9 A;  3NFZ A;  5HVF A;  4NGM A;  2CF4 A;  2PRQ A;  2PVW A;  2EEE A;  4R7M A;  3LMS A;  3GPQ A;  2V8H A;  3FEE A;  4CPA A;  3D7D A;  2VRI A;  4NJR A;  3B3W A;  1XMB A;  3H8G A;  4PXD A;  4EME A;  3PBB A;  3D67 A;  2EWB A;  1NJR A;  1LOK A;  4GUA A;  5D29 A;  4IQY A;  4FAI A;  4JYW A;  2J9A A;  1XFO A;  3K2K A;  3IFE A;  2AFO A;  3JZT A;  1AMP A;  5CBM A;  2XEJ A;  3D7H A;  4OME A;  2ZEM A;  5JH9 A;  4OC4 A;  1VHE A;  4EFD A;  3K9T A;  4P4F A;  1ZR3 A;  5HIH A;  4MRI A;  7CPA A;  3B3S A;  4B6Z A;  3IJ3 A;  4F8Z A;  4K3N A;  1PCA A;  2FG1 A;  3Q71 A;  5AIL A;  2ZOF A;  3V45 A;  3NH4 A;  5HVH A;  3IWW A;  5E3B A;  3CPA A;  3KQZ A;  1Y7E A;  5LYL A;  1DE4 C;  1UWY A;  4P4I A;  3VAT A;  3RZA A;  1CX8 A;  1Z8L A;  2JBK A;  1HJZ A;  2BOA A;  3PFO A;  4X3R A;  2POK A;  3B7I A;  3NH8 A;  2VL1 A;  4JVV A;  3EW5 A;  2C6C A;  2BFQ A;  4F9V A;  2O4H A;  4FUU A;  2ZEG A;  3TC8 A;  1M4L A;  3BXM A;  2PVV A;  4MCP A;  4A94 A;  4F9U A;  4MXU A;  4TNU A;  1TKF A;  2XEG A;  3ISZ A;  3D7G A;  2EK8 A;  2JEW A;  2F7V A;  4ZY1 A;  4A37 A;  3VFQ A;  4AXV A;  2AFC A;  3WAB A;  4TU0 A;  4EWT A;  3FJU A;  2GU2 A;  3LWU A;  2ANP A;  1ZG7 A;  4UEZ A;  4P6Y A;  3I1U A;  1YME A;  1LAN A;  1QMU A;  4OC1 A;  3SIH A;  4J4Z A;  3FVL A;  3TX8 A;  1TXR A;  4A39 A;  4PQA A;  1FNO A;  2ABZ A;  4MHY A;  3IIF A;  2FAV A;  2XEI A;  2BO9 A;  3ETI A;  1QQ9 A;  4GVW A;  1Y0R A;  3B3T A;  2DEA A;  3B3V A;  2C6P A;  2ZED A;  2QYV A;  1Z5R A;  1LAM A;  1CP7 A;  3FH4 A;  1AYE A;  1KWM A;  3GPG A;  3IEH A;  3PB9 X;  4JCA A;  3V7Z A;  4X8I A;  3SI2 A;  5DUS A;  1TKH A;  1TKJ A;  1F2P A;  2ZEH A;  2BCO A;  4NGQ A;  2XD7 A;  1R43 A;  4ETJ A;  3IO1 A;  2ZEF A;  4JGK A;  2NYQ A;  5LYF A;  4Z65 A;  4JLL A;  1TF9 A;  5CMS A;  4P4J A;  2HC9 A;  1RTQ A;  3SI1 A;  5K8M A;  3CDX A;  3PB7 X;  1IGB A;  2CTB A;  2ACF A;  2Q43 A;  2CIJ A;  1ARL A;  3H8F A;  3B35 A;  3QNV A;  4JZ0 A;  3GQE A;  1LFW A;  2PIZ A;  4NJQ A;  3KZW A;  2PIY A;  3GLJ A;  4FWU A;  2L8R A;  4LQG A;  5HXD A;  4D86 A;  3FEC A;  4WWV A;  2LGR A;  3NH5 A;  2RFH A;  5FSZ A;  1XBU A;  1BAV A;  3B3C A;  4DJL A;  3WT4 A;  2AFU A;  4PPZ A;  3GQO A;  2PJ4 A;  3PRT A;  1VHO A;  2ZEO A;  5JGF A;  3NA6 A;  3KAS A;  1ZR5 A;  2V77 A;  2ZOG A;  4OIW A;  3GUX A;  2C1C A;  2ZEL A;  1PYT B;  4MCR A;  1BLL E;  4ZX9 A;  5CB3 A;  2PJ0 A;  1ZG8 A;  3PFE A;  2WYR A;  4YWY A;  1IY7 A;  4MHZ A;  2ZEN A;  8CPA A;  1ZG9 A;  5K8N A;  2NSM A;  4OID A;  3IID A;  1OBR A;  1R3N A;  4MHN A;  4KSI A;  2PJ2 A;  4UEF A;  3V2B A;  4OC2 A;  4IHM A;  3IC1 A;  4NFR A;  2PJ1 A;  3Q6Z A;  3N5F A;  3EWR A;  5THW A;  4UEE A;  3EJF A;  5FSY A;  2QJ8 A;  2OOT A;  3PBE A;  4X2T A;  3SIJ A;  3BI0 A;  4OP4 A;  3SJE A;  2PJB A;  1ZLI A;  3RBU A;  2FXK A;  3KQX A;  4ONW A;  2AFW A;  5LRG A;  2AFM A;  1YLO A;  2PJC A;  3HUV A;  1TY8 A;  1CPS A;  4UF4 A;  4J5Q A;  5D8N A;  5F09 A;  5HVG A;  1ARM A;  3T8W A;  3BHX A;  4A38 A;  4J5R A;  1YSJ A;  2V8G A;  1YW4 A;  3D66 A;  5ELY A;  1EE3 P;  4OKO A;  1CBX A;  2GLF A;  2OR4 A;  2PJ5 A;  5FSX A;  4TWE A;  5FSU A;  4WJB A;  5J1Q A;  4P4E A;  1HDQ A;  3EWQ A;  5CB5 A;  3SII A;  5K8O A;  4P45 A;  3D7F A;  4OC5 A;  2V8V A;  4R8F A;  3PB8 X;  5DS0 A;  4NGP A;  1TF8 A;  3SJX A;  1VHU A;  1NSA A;  2CTC A;  3D4U A;  4BD9 A;  1VIX A;  3BI1 A;  4MMO A;  3SJF A;  5IB9 A;  2F8H A;  3CPX A;  2EK9 A;  4OC0 A;  3V38 A;  3KGQ A;  1F57 A;  2PJA A;  4P4D A;  4NGT A;  4IK2 A;  3MN8 A;  3EKE A;  4PXE A;  1Z2L A;  1ELL P;  2PJ6 A;  5FSV A;  3DGV A;  3CT9 A;  2ZEP A;  2Q51 A;  3SJG A;  4UIB A;  3KHX A;  4ABK A;  1YD9 A;  4H2K A;  3IIB A;  1VGY A;  3ISX A;  4NGR A;  4NGS A;  2G9D A;  2AFZ A;  2X47 A;  4P10 A;  4ESS A;  4G1P A;  3KL9 A;  1LAP A;  1CP6 A;  3DLJ A;  2PJ9 A;  5LYI A;  3L2N A;  4ZY2 A;  3KI9 A;  4W9Y A;  1DTD A;  4KYB A;  4UML A;  2PCU A;  4IAV A;  3EWP A;  2QVP A;  3HLP A;  4OC3 A;  2I3C A;  5LRK A;  4R76 A;  1HDU A;  2HB6 A;  3MRU A;  3GPO A;  5I4M A;  2O53 A;  2C6G A;  2Q4Z A;  3GB0 A;  3VH9 A;  1HEE A;  4Q7A A;  2GRE A;  3FF3 A;  3S9L A;  3H8E A;  4ZYQ A;  2GLJ A;  2PJ8 A;  1ZLH A;  3KR5 A;  2FVG A;  4ZY0 A;  1CPX A;  1JQG A;  3SIG A;  1XRY A;  2RB7 A;  3S9N A;  2XEF A;  1XJO A;  3VAR A;  4P44 A;  3PEI A;  1GYT A;  2PE3 A;  3FMC A;  5LYD A;  3EJG A;  3D68 A;  3JRU A;  2WZN A;  1LCP A;  1H8L A;  1CG2 A;  5K8P A;  4PXC A;  4GVV A;  3KR4 A;  3EWO A;  4ETK A;  4DYO A;  2BFR A;  4MCS A;  4ZI6 A;  3PB4 X;  1BPN A;  4R6T A;  1BPM A;  4FBE A;  4P4B A;  2JBJ A;  2V8D A;  4DUK A;  4O23 A;  4J5S A;  2AFX A;  4RUH A;  5LRJ A;  3RAM A;  5JM6 A;  3KHZ A;  3WC7 A;  4ZX8 A;  2IMO A;  3FX6 A;  1TXZ A;  3WC5 A;  1Q7L A;  2ZEE A;  2IJZ A;  2IQ6 A;  4MCQ A;  6CPA A;  1FT7 A;  4GM5 A;  5CPA A;  1YW6 A;  4PXB A;  3PB6 X;  1F2O A;  3S9M A; 
#chains in the Genus database with same CATH topology
 4ZGY B;  3DNS A;  4UIA A;  1U6M A;  5HOL A;  1KUX A;  2PJ7 A;  2DX6 A;  4K0C A;  1IB1 E;  4J3G A;  3SI0 A;  4ABL A;  4F6A A;  1SPV A;  4L89 A;  4M6G A;  3IGR A;  3S6G A;  3RZA A;  3FED A;  5F48 A;  3TCV A;  2PJ3 A;  2AFS A;  2D4P A;  1IIC A;  4M6I A;  4UCP A;  4B5P A;  2B4B A;  4MHP A;  3B2Y A;  3R9F A;  2F5I A;  3WC6 A;  1M4I A;  4CGP A;  4F0Y A;  1ELM P;  1FY7 A;  1LRZ A;  4NGN A;  2B3V A;  1Y0Y A;  1VKC A;  4YU9 A;  3P2F A;  3NFZ A;  5AGE A;  5G21 A;  5HVF A;  2QML A;  4NGM A;  4YRH A;  1S7K A;  2CF4 A;  2PRQ A;  4CAW A;  3F8K A;  2PVW A;  2EEE A;  4R7M A;  3LMS A;  3GPQ A;  4H6Z A;  2V8H A;  1YLE A;  2Q4Y A;  3FEE A;  3D7D A;  2VRI A;  2CXA A;  4NJR A;  5GCN A;  3B3W A;  4CPA A;  1XMB A;  5AG4 A;  4R3L A;  3H8G A;  2WPX A;  4PXD A;  4EME A;  3PBB A;  2GAN A;  3D67 A;  1Q2C A;  2Q04 A;  2FL4 A;  3V8I A;  2EWB A;  1NJR A;  1LOK A;  4GUA A;  3B8G A;  4NXY A;  5D29 A;  4IQY A;  4FAI A;  1OZP A;  4JYW A;  1M4D A;  2J9A A;  1XFO A;  2R8V A;  1MJ9 A;  3K2K A;  1B6B A;  4MFL A;  4UWI A;  3EFA A;  1NE9 A;  3IFE A;  4EVY A;  2AFO A;  3JZT A;  1AMP A;  5CBM A;  1Z9U A;  2XEJ A;  3D7H A;  1R57 A;  1XF8 A;  4OME A;  3CXP A;  2JZD A;  2ZEM A;  3S6K A;  5JH9 A;  1MK4 A;  4OC4 A;  1Y9K A;  1VHE A;  3R9E A;  3VAT A;  4EFD A;  3RNZ A;  4MFP A;  3K9T A;  3R1K A;  2PRB A;  4P4F A;  1ZR3 A;  5HIH A;  4MRI A;  7CPA A;  2Z11 A;  4NEX A;  3I3G A;  3A9L A;  3B3S A;  4MJ8 A;  4A2Z A;  1Z4E A;  4B6Z A;  3IJ3 A;  2ZPA A;  4B13 A;  4CAX A;  4F8Z A;  4K3N A;  3DDD A;  1PCA A;  2FG1 A;  3Q71 A;  5AIL A;  2Z3P A;  4FD7 A;  2ZOF A;  3FNC A;  1KUY A;  3V45 A;  3NH4 A;  4A30 A;  2R7H A;  5HVH A;  1YVK A;  2VBQ A;  4HNY B;  4UFV A;  4NCZ A;  3IWW A;  5E3B A;  4A33 A;  3CPA A;  3KQZ A;  1Y7E A;  4C7I A;  5LYL A;  1DE4 C;  1NSL A;  1UWY A;  4MFQ A;  1N71 A;  4P4I A;  3UY5 A;  1IU8 A;  4KOS A;  1CX8 A;  1Z8L A;  1Y9W A;  1HJZ A;  2JBK A;  2WSA A;  2BOA A;  1Y7R A;  2OZH A;  3OWC A;  3PFO A;  4X3R A;  2POK A;  3B7I A;  3NH8 A;  5FVJ A;  2VL1 A;  2D4O A;  1CM0 A;  1I21 A;  4JVV A;  3FRM A;  4KVO E;  5BWA B;  4UWJ A;  4E8O A;  3DR8 A;  4BBH A;  3EW5 A;  2C6C A;  2Z3M A;  2BFQ A;  2Q4V A;  2O4H A;  4KVX A;  4MHD A;  4FUU A;  4AG7 A;  4F9V A;  2ZEG A;  3TC8 A;  1M4L A;  3BXM A;  2PVV A;  4MCP A;  3D2P A;  1QSR A;  2G3A A;  1QSN A;  4A94 A;  4F9U A;  2WPW A;  4MXU A;  5KTA A;  4TNU A;  2B3U A;  1IYK A;  1TKF A;  2ZW5 A;  2XEG A;  3ISZ A;  4CS0 B;  1X12 A;  1M44 A;  4A32 A;  4KVM E;  2ARH A;  3H5Z A;  4YFJ A;  3D7G A;  1S3Z A;  2EK8 A;  2JEW A;  2F7V A;  5C88 A;  1KUV A;  4H6U A;  4NF1 A;  4Y49 B;  4ZY1 A;  3JUW A;  1QSM A;  3VFQ A;  4A37 A;  5C82 A;  4AXV A;  3S6H A;  2AFC A;  3WAB A;  3SXN A;  4FD6 A;  1K4J A;  4QC6 A;  4TU0 A;  4EWT A;  3FJU A;  3VWE A;  3I9S A;  3DSB A;  2GU2 A;  3LWU A;  2ANP A;  3EC4 A;  1ZG7 A;  2PDO A;  3W6S A;  2ZW7 A;  2JZE A;  2Y0M A;  4UEZ A;  4KLW A;  4M85 A;  4P6Y A;  4U9Z A;  4B5O A;  3I1U A;  1YME A;  4C68 A;  1J4J A;  1LAN A;  1QMU A;  4OC1 A;  3SIH A;  4B10 A;  4J4Z A;  3FVL A;  2NMT A;  1TXR A;  3TX8 A;  1PU9 A;  2Z3L A;  4PQA A;  4A39 A;  1FNO A;  4R57 A;  1YK3 A;  2ABZ A;  3IU2 A;  4CYO A;  4MHY A;  4XPD C;  3IIF A;  2FAV A;  3ETI A;  1Y0R A;  1MJA A;  1S7N A;  4GVW A;  1QQ9 A;  2BO9 A;  2XEI A;  3B3T A;  3DR6 A;  1Q2Y A;  2DEA A;  4KOV A;  3B3V A;  4PK3 A;  2C6P A;  2ZED A;  5G1Z A;  2QYV A;  2BL1 A;  3P2H A;  1Z5R A;  1LAM A;  1I12 A;  2QEC A;  1CP7 A;  3FB3 A;  4DNC A;  3FH4 A;  3NE8 A;  4AVC A;  1AYE A;  2I00 A;  1KWM A;  3GPG A;  3RYO A;  3IEH A;  3PB9 X;  4JWP A;  4JCA A;  2HV2 A;  4CYP A;  4UCM A;  4LX9 A;  2ATR A;  2KCW A;  4X8I A;  3SI2 A;  1YX0 A;  4ONU A;  3V7Z A;  3TFY A;  1XE4 A;  5DUS A;  3GYA A;  2GIV A;  3CXS A;  1TKH A;  1TKJ A;  4QVT A;  2R98 A;  1F2P A;  2ZEH A;  2BCO A;  2KQV A;  2XD7 A;  2YNC A;  1R43 A;  1RO5 A;  2O28 A;  4NGQ A;  4RN7 A;  4UBR A;  5HMN A;  4ETJ A;  3IO1 A;  2ZEF A;  4JGK A;  2NYQ A;  2WUU A;  4Z65 A;  5LYF A;  4JLL A;  1TF9 A;  5CMS A;  2FSR A;  4KUA A;  2BSW A;  2OB0 A;  2OZG A;  3FXT A;  4LQ6 A;  2HC9 A;  1RTQ A;  3PZJ A;  4P4J A;  2FXF A;  3SI1 A;  3CDX A;  5EMI A;  3W6X A;  4CRY B;  5K8M A;  2QIR A;  3PB7 X;  1IGB A;  1WWZ A;  2CTB A;  4GS4 A;  4RS2 A;  4UFX A;  2ACF A;  2Q43 A;  3BJ8 A;  3TO6 A;  2CIJ A;  1ARL A;  4KZT A;  3H8F A;  3B35 A;  3QNV A;  4JZ0 A;  2OZU A;  3GQE A;  2IL4 A;  3TOA A;  3BJ7 A;  4Q38 A;  4Y49 C;  4E2A A;  4XNH B;  2FIW A;  4MFK A;  1LFW A;  1I1D A;  2PIZ A;  4NJQ A;  4M6H A;  3KZW A;  2PIY A;  3GLJ A;  2VZY A;  2L8R A;  4FWU A;  4UFW A;  2H5M A;  4LQG A;  1SQH A;  3C26 A;  4C2Y A;  5HXD A;  4D86 A;  3FEC A;  4WWV A;  5DWM A;  2LGR A;  3NH5 A;  2RFH A;  5FSZ A;  3H4Q A;  4L8A A;  1XBU A;  1BAV A;  2YNC C;  3B3C A;  3WT4 A;  4BIN A;  4DJL A;  2ZXV A;  2AFU A;  3MGD A;  2BUE A;  3EXN A;  3GQO A;  2PJ4 A;  4PPZ A;  5AG7 A;  3SHP A;  4KOU A;  4B12 A;  2Z10 A;  3PRT A;  4R9M A;  1VHO A;  2ZEO A;  3PGP A;  5JGF A;  5H86 A;  5ISV A;  2B4D B;  4KOW A;  1XEB A;  3NA6 A;  5A27 A;  3KAS A;  1ZR5 A;  3F0A A;  4MBU A;  4NSQ A;  5IV0 A;  2VEZ A;  2DPS A;  2V77 A;  2ZOG A;  5EC4 A;  2I79 A;  2A4N A;  4FD4 A;  4OIW A;  3GUX A;  2C1C A;  2EBJ A;  2ZEL A;  3RO0 A;  4GXH A;  4A31 A;  1PYT B;  4MCR A;  1BLL E;  4ZX9 A;  5CB3 A;  2PJ0 A;  1ZG8 A;  3PFE A;  5EBV A;  2WYR A;  4YWY A;  1IY7 A;  3T90 A;  2EUI A;  4MHZ A;  4XPK A;  2ZEN A;  4BMH A;  8CPA A;  4HPS A;  4CYQ A;  1ZG9 A;  2G0B A;  5K8N A;  2ZW4 A;  2NSM A;  4IF5 A;  3IWG A;  2ZW6 A;  4OID A;  2G3T A;  3W91 A;  5AG6 A;  3IID A;  1OBR A;  2RNK A;  1R3N A;  4MHN A;  4KSI A;  4KUB A;  2PJ2 A;  4JXR A;  4UEF A;  2JZF A;  3V2B A;  1Z4R A;  4IHM A;  4OC2 A;  3F5B A;  3G8W A;  3IC1 A;  4NFR A;  1NMT A;  2PJ1 A;  3Q6Z A;  2P6G A;  3N5F A;  1JWQ A;  3GIU A;  3EWR A;  5THW A;  4UEE A;  3D3S A;  3TTH A;  4I49 A;  3EJF A;  5FSY A;  2P0W A;  3JVN A;  4HNW B;  2B4D A;  2QJ8 A;  2CNS A;  1UFH A;  1V0C A;  3K9U A;  2OOT A;  3PBE A;  2Z3O A;  4X2T A;  3SIJ A;  3BI0 A;  4JXQ A;  4OP4 A;  3SJE A;  2PSW A;  2DXQ A;  2PJB A;  1ZLI A;  2YGW A;  2FXK A;  3FYN A;  4QB9 A;  4R3K A;  3RBU A;  3KQX A;  4C2X A;  5E96 A;  4ONW A;  2AFW A;  4JLY A;  4MI4 A;  2AFM A;  5G22 A;  1YLO A;  2PJC A;  3HUV A;  5LRG A;  4AB7 A;  1TY8 A;  1CPS A;  4UF4 A;  4XNH C;  4J5Q A;  5D8N A;  5F09 A;  4ORF A;  1QST A;  1ARM A;  1WK4 A;  5HVG A;  4B14 A;  3T8W A;  2YNE A;  3BHX A;  3QAY A;  4A38 A;  4J5R A;  1YSJ A;  2V8G A;  1Z8X A;  2RC4 A;  1YW4 A;  3PP9 A;  1S7F A;  3D66 A;  4KSA A;  1EE3 P;  2Q44 A;  5ELY A;  3IU1 A;  5AG5 A;  5H84 A;  2GFQ A;  2FT0 A;  4OKO A;  4A95 A;  1CBX A;  1X10 A;  1XOV A;  2REF A;  4RI1 A;  4CGM A;  2GLF A;  4CAE A;  4AVA A;  2OR4 A;  3ZJ0 A;  2J8R A;  5FSX A;  1BOB A;  2PJ5 A;  4TWE A;  5FSU A;  4WJB A;  4C7H A;  4H89 A;  2EO8 A;  3LD2 A;  2HUZ A;  2B58 A;  5KTD A;  5J1Q A;  2DPT A;  1ZO0 A;  4KSF A;  4P4E A;  5DWN A;  1HDQ A;  5JPH A;  3EWQ A;  5CB5 A;  3S6F A;  3SII A;  5K8O A;  4CRZ B;  2PC1 A;  4P45 A;  2CY2 A;  4JJX A;  3D7F A;  2J8M A;  4OC5 A;  1A2Z A;  3VWD A;  2V8V A;  4R8F A;  4KS9 A;  3EO4 A;  2FS5 A;  3PB8 X;  4NGP A;  1TF8 A;  4QUS A;  5DS0 A;  3E0K A;  3SJX A;  4AVB A;  2R1I A;  2JEV A;  1VHU A;  1NSA A;  2CTC A;  3D4U A;  4BD9 A;  4ZBG A;  1VIX A;  3BI1 A;  4AG9 A;  4MMO A;  3SJF A;  4B11 A;  5IB9 A;  2F8H A;  3CPX A;  3TE4 A;  2EK9 A;  1IYL A;  3LAC A;  4OC0 A;  3LOD A;  3V38 A;  2Z0Z A;  3KGQ A;  4CGO A;  1F57 A;  2PJA A;  2PQ8 A;  4P4D A;  3IWE A;  4NGT A;  4IK2 A;  3MN8 A;  3EKE A;  4CAF A;  3N7Z A;  1S5K A;  3QAH A;  4PXE A;  1Z2L A;  3QB8 A;  1ELL P;  1YGH A;  2PJ6 A;  3D2M A;  4CGL A;  2C27 A;  5FSV A;  2FE7 A;  2K5T A;  4KOY A;  3DGV A;  5CNP A;  1P4N A;  1VHS A;  3CT9 A;  3TO7 A;  2ZEP A;  4CGN A;  2Q51 A;  5J8F A;  3SJG A;  4UIB A;  3KHX A;  4U9Y A;  4ABK A;  4C2Z A;  1YD9 A;  2Z3K A;  3WR7 A;  4H2K A;  4MFJ A;  3IIB A;  1VGY A;  3ISX A;  4PV6 A;  2B5G B;  4NGR A;  4NGS A;  1CJW A;  1QSO A;  2G9D A;  4OAE A;  1Z8W A;  2Z3N A;  2AFZ A;  4UA3 A;  2X47 A;  2Q7S A;  2AJ6 A;  3CXQ A;  4P10 A;  4ESS A;  4G1P A;  4OAD A;  4PSX A;  2EVN A;  3KL9 A;  1LAP A;  1CP6 A;  1IOF A;  3EY5 A;  5I0C A;  3D8P A;  3DLJ A;  2PJ9 A;  5LYI A;  3R95 A;  1S7L A;  2AE6 A;  3L2N A;  5F47 A;  4ZY2 A;  3KI9 A;  4HKF A;  1B87 A;  4W9Y A;  1DTD A;  5A28 A;  4KYB A;  4UML A;  1KZF A;  2PCU A;  2VI7 A;  4IAV A;  3EWP A;  2QVP A;  3HLP A;  1XMT A;  3GY9 A;  4OC3 A;  2REE A;  3FIX A;  3TO9 A;  2I3C A;  5LRK A;  4R76 A;  1HDU A;  2HB6 A;  2VZZ A;  3GPO A;  3MRU A;  5F46 A;  5I4M A;  2O53 A;  3TOB A;  1PUA A;  2C6G A;  2Q4Z A;  4X5K A;  4XPL A;  3GB0 A;  3GKR A;  2GE3 A;  2VXK A;  1ON0 A;  4MFZ A;  3VH9 A;  1HEE A;  3JTK A;  4Q7A A;  2GRE A;  2W2G A;  3FF3 A;  5G20 A;  2BEI A;  3H8E A;  3R96 A;  4CYN A;  3TT2 A;  3S9L A;  4ZYQ A;  5KTC A;  2GLJ A;  1MJB A;  2B5G A;  2PJ8 A;  4XPD B;  2P6E A;  1ZLH A;  1XIX A;  5IX3 A;  2DF5 A;  1RXT A;  3KR5 A;  2FVG A;  5JQ4 A;  3CZX A;  4ZY0 A;  2Q7B A;  3ZZI A;  4FD5 A;  1GHE A;  1CPX A;  5HH1 A;  1YQE A;  2PR8 A;  1JQG A;  3SIG A;  1XRY A;  2CNT A;  2HQY A;  2RB7 A;  1IID A;  4JD6 A;  3BLN A;  3T9Y A;  3S9N A;  2XEF A;  1XJO A;  4K30 A;  3VAR A;  1AUG A;  2FCK A;  4P44 A;  3PEI A;  1BO4 A;  3SXO A;  1GYT A;  2PE3 A;  2J8N A;  2PR1 A;  3FBU A;  3FMC A;  4U5Y A;  1YRE A;  1IOI A;  3EJG A;  2FIA A;  4MY0 A;  3D68 A;  5LYD A;  4E0A A;  4R87 A;  3JRU A;  3KKW A;  2WZN A;  1LCP A;  2JDC A;  4Q36 A;  1H8L A;  1CG2 A;  5K8P A;  4PXC A;  4GVV A;  3KR4 A;  3EWO A;  4HNX B;  1P0H A;  1TIQ A;  4ETK A;  4DYO A;  2WCT A;  2BFR A;  4MCS A;  4M3S A;  4ZI6 A;  2P6F A;  3PB4 X;  2CNM A;  4KOR A;  1BPN A;  4R6T A;  1BPM A;  1M4G A;  4FBE A;  4P4B A;  2JBJ A;  2V8D A;  4DUK A;  4O23 A;  5IB0 A;  1M1D A;  4J5S A;  2AFX A;  4B5P B;  4KLV A;  4LUA A;  4RUH A;  5LRJ A;  4KOX A;  4YGO A;  3RAM A;  5JM6 A;  2YND A;  4MY3 A;  1L0C A;  2Q0Y A;  3KHZ A;  4PK2 A;  3WC7 A;  2VQY A;  2X7B A;  3NE7 A;  4CAV A;  4ZX8 A;  1S60 A;  2IMO A;  1TXZ A;  3FX6 A;  4UCN A;  1Q7L A;  2ZEE A;  3WC5 A;  2OH1 A;  2IJZ A;  2IQ6 A;  4QBJ A;  4II9 A;  1YR0 A;  4IUS A;  4MCQ A;  3G3S A;  6CPA A;  4F0X A;  1FT7 A;  4GM5 A;  2JDD A;  4PSW A;  5J8C A;  5CPA A;  1YW6 A;  2JLM A;  1Q2D A;  1Z8T A;  4OLL A;  2OU2 A;  5F49 A;  4KOT A;  1YVO A;  3PB6 X;  4PXB A;  1F2O A;  3R9G A;  2ODF A;  3S9M A; 
#chains in the Genus database with same CATH homology
 4UIA A;  5HOL A;  2PJ7 A;  2DX6 A;  4K0C A;  3SI0 A;  4ABL A;  1SPV A;  3FED A;  2PJ3 A;  2AFS A;  4MHP A;  3B2Y A;  3WC6 A;  1ELM P;  4NGN A;  1Y0Y A;  4YU9 A;  3NFZ A;  5HVF A;  4NGM A;  2CF4 A;  2PRQ A;  2PVW A;  2EEE A;  4R7M A;  3LMS A;  3GPQ A;  2V8H A;  3FEE A;  4CPA A;  3D7D A;  2VRI A;  4NJR A;  3B3W A;  1XMB A;  3H8G A;  4PXD A;  4EME A;  3PBB A;  3D67 A;  2EWB A;  1NJR A;  1LOK A;  4GUA A;  5D29 A;  4IQY A;  4FAI A;  4JYW A;  2J9A A;  1XFO A;  3K2K A;  3IFE A;  2AFO A;  3JZT A;  1AMP A;  5CBM A;  2XEJ A;  3D7H A;  4OME A;  2ZEM A;  5JH9 A;  4OC4 A;  1VHE A;  4EFD A;  3K9T A;  4P4F A;  1ZR3 A;  5HIH A;  4MRI A;  7CPA A;  3B3S A;  4B6Z A;  3IJ3 A;  4F8Z A;  4K3N A;  1PCA A;  2FG1 A;  3Q71 A;  5AIL A;  2ZOF A;  3V45 A;  3NH4 A;  5HVH A;  3IWW A;  5E3B A;  3CPA A;  3KQZ A;  1Y7E A;  5LYL A;  1DE4 C;  1UWY A;  4P4I A;  3VAT A;  3RZA A;  1CX8 A;  1Z8L A;  2JBK A;  1HJZ A;  2BOA A;  3PFO A;  4X3R A;  2POK A;  3B7I A;  3NH8 A;  2VL1 A;  4JVV A;  3EW5 A;  2C6C A;  2BFQ A;  4F9V A;  2O4H A;  4FUU A;  2ZEG A;  3TC8 A;  1M4L A;  3BXM A;  2PVV A;  4MCP A;  4A94 A;  4F9U A;  4MXU A;  4TNU A;  1TKF A;  2XEG A;  3ISZ A;  3D7G A;  2EK8 A;  2JEW A;  2F7V A;  4ZY1 A;  4A37 A;  3VFQ A;  4AXV A;  2AFC A;  3WAB A;  4TU0 A;  4EWT A;  3FJU A;  2GU2 A;  3LWU A;  2ANP A;  1ZG7 A;  4UEZ A;  4P6Y A;  3I1U A;  1YME A;  1LAN A;  1QMU A;  4OC1 A;  3SIH A;  4J4Z A;  3FVL A;  3TX8 A;  1TXR A;  4A39 A;  4PQA A;  1FNO A;  2ABZ A;  4MHY A;  3IIF A;  2FAV A;  2XEI A;  2BO9 A;  3ETI A;  1QQ9 A;  4GVW A;  1Y0R A;  3B3T A;  2DEA A;  3B3V A;  2C6P A;  2ZED A;  2QYV A;  1Z5R A;  1LAM A;  1CP7 A;  3FH4 A;  1AYE A;  1KWM A;  3GPG A;  3IEH A;  3PB9 X;  4JCA A;  3V7Z A;  4X8I A;  3SI2 A;  5DUS A;  1TKH A;  1TKJ A;  1F2P A;  2ZEH A;  2BCO A;  4NGQ A;  2XD7 A;  1R43 A;  4ETJ A;  3IO1 A;  2ZEF A;  4JGK A;  2NYQ A;  5LYF A;  4Z65 A;  4JLL A;  1TF9 A;  5CMS A;  4P4J A;  2HC9 A;  1RTQ A;  3SI1 A;  5K8M A;  3CDX A;  3PB7 X;  1IGB A;  2CTB A;  2ACF A;  2Q43 A;  2CIJ A;  1ARL A;  3H8F A;  3B35 A;  3QNV A;  4JZ0 A;  3GQE A;  1LFW A;  2PIZ A;  4NJQ A;  3KZW A;  2PIY A;  3GLJ A;  4FWU A;  2L8R A;  4LQG A;  5HXD A;  4D86 A;  3FEC A;  4WWV A;  2LGR A;  3NH5 A;  2RFH A;  5FSZ A;  1XBU A;  1BAV A;  3B3C A;  4DJL A;  3WT4 A;  2AFU A;  4PPZ A;  3GQO A;  2PJ4 A;  3PRT A;  1VHO A;  2ZEO A;  5JGF A;  3NA6 A;  3KAS A;  1ZR5 A;  2V77 A;  2ZOG A;  4OIW A;  3GUX A;  2C1C A;  2ZEL A;  1PYT B;  4MCR A;  1BLL E;  4ZX9 A;  5CB3 A;  2PJ0 A;  1ZG8 A;  3PFE A;  2WYR A;  4YWY A;  1IY7 A;  4MHZ A;  2ZEN A;  8CPA A;  1ZG9 A;  5K8N A;  2NSM A;  4OID A;  3IID A;  1OBR A;  1R3N A;  4MHN A;  4KSI A;  2PJ2 A;  4UEF A;  3V2B A;  4OC2 A;  4IHM A;  3IC1 A;  4NFR A;  2PJ1 A;  3Q6Z A;  3N5F A;  3EWR A;  5THW A;  4UEE A;  3EJF A;  5FSY A;  2QJ8 A;  2OOT A;  3PBE A;  4X2T A;  3SIJ A;  3BI0 A;  4OP4 A;  3SJE A;  2PJB A;  1ZLI A;  3RBU A;  2FXK A;  3KQX A;  4ONW A;  2AFW A;  5LRG A;  2AFM A;  1YLO A;  2PJC A;  3HUV A;  1TY8 A;  1CPS A;  4UF4 A;  4J5Q A;  5D8N A;  5F09 A;  5HVG A;  1ARM A;  3T8W A;  3BHX A;  4A38 A;  4J5R A;  1YSJ A;  2V8G A;  1YW4 A;  3D66 A;  5ELY A;  1EE3 P;  4OKO A;  1CBX A;  2GLF A;  2OR4 A;  2PJ5 A;  5FSX A;  4TWE A;  5FSU A;  4WJB A;  5J1Q A;  4P4E A;  1HDQ A;  3EWQ A;  5CB5 A;  3SII A;  5K8O A;  4P45 A;  3D7F A;  4OC5 A;  2V8V A;  4R8F A;  3PB8 X;  5DS0 A;  4NGP A;  1TF8 A;  3SJX A;  1VHU A;  1NSA A;  2CTC A;  3D4U A;  4BD9 A;  1VIX A;  3BI1 A;  4MMO A;  3SJF A;  5IB9 A;  2F8H A;  3CPX A;  2EK9 A;  4OC0 A;  3V38 A;  3KGQ A;  1F57 A;  2PJA A;  4P4D A;  4NGT A;  4IK2 A;  3MN8 A;  3EKE A;  4PXE A;  1Z2L A;  1ELL P;  2PJ6 A;  5FSV A;  3DGV A;  3CT9 A;  2ZEP A;  2Q51 A;  3SJG A;  4UIB A;  3KHX A;  4ABK A;  1YD9 A;  4H2K A;  3IIB A;  1VGY A;  3ISX A;  4NGR A;  4NGS A;  2G9D A;  2AFZ A;  2X47 A;  4P10 A;  4ESS A;  4G1P A;  3KL9 A;  1LAP A;  1CP6 A;  3DLJ A;  2PJ9 A;  5LYI A;  3L2N A;  4ZY2 A;  3KI9 A;  4W9Y A;  1DTD A;  4KYB A;  4UML A;  2PCU A;  4IAV A;  3EWP A;  2QVP A;  3HLP A;  4OC3 A;  2I3C A;  5LRK A;  4R76 A;  1HDU A;  2HB6 A;  3MRU A;  3GPO A;  5I4M A;  2O53 A;  2C6G A;  2Q4Z A;  3GB0 A;  3VH9 A;  1HEE A;  4Q7A A;  2GRE A;  3FF3 A;  3S9L A;  3H8E A;  4ZYQ A;  2GLJ A;  2PJ8 A;  1ZLH A;  3KR5 A;  2FVG A;  4ZY0 A;  1CPX A;  1JQG A;  3SIG A;  1XRY A;  2RB7 A;  3S9N A;  2XEF A;  1XJO A;  3VAR A;  4P44 A;  3PEI A;  1GYT A;  2PE3 A;  3FMC A;  5LYD A;  3EJG A;  3D68 A;  3JRU A;  2WZN A;  1LCP A;  1H8L A;  1CG2 A;  5K8P A;  4PXC A;  4GVV A;  3KR4 A;  3EWO A;  4ETK A;  4DYO A;  2BFR A;  4MCS A;  4ZI6 A;  3PB4 X;  1BPN A;  4R6T A;  1BPM A;  4FBE A;  4P4B A;  2JBJ A;  2V8D A;  4DUK A;  4O23 A;  4J5S A;  2AFX A;  4RUH A;  5LRJ A;  3RAM A;  5JM6 A;  3KHZ A;  3WC7 A;  4ZX8 A;  2IMO A;  3FX6 A;  1TXZ A;  3WC5 A;  1Q7L A;  2ZEE A;  2IJZ A;  2IQ6 A;  4MCQ A;  6CPA A;  1FT7 A;  4GM5 A;  5CPA A;  1YW6 A;  4PXB A;  3PB6 X;  1F2O A;  3S9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...