3SIIA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase bound to the inhibitor adp-hpd from thermomonospora curvata
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords poly(ADP-ribose) glycohydrolase
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
molecule tags Hydrolase/hydrolase inhibitor
total genus 97
structure length 265
sequence length 274
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3siiA00
1YD9A 4J5SA 4R6TA 2AFCA 5FSYA 3H8GA 4ZY1A 2XD7A 4ZI6A 1BPMA 3SIGA 3EJFA 1TXZA 3KR5A 1TY8A 3PEIA 4JLLA 4IQYA 2VRIA 2BFRA 3GPOA 2DX6A 4ESSA 4GVWA 3SIIA 3IIFA 5D8NA 1LAPA 3KR4A 3Q6ZA 4ZX8A 4K3NA 3GPGA 4ZY0A 4ZX9A 3VFQA 4J5QA 4JGKA 5DUSA 4ZYQA 4ABLA 5HOLA 4ZY2A 4R7MA 3T8WA 3V2BA 3EW5A 3V45A 2EWBA 4KSIA 5CB5A 4TU0A 2FG1A 1SPVA 3ETIA 5CBMA 3EWOA 5AILA 4GUAA 4D86A 1BPNA 3H8EA 2L8RA 3EWQA 1NJRA 3EWPA 4J4ZA 5FSXA 2BFQA 3SIHA 2FAVA 4ETJA 5HIHA 2X47A 4ABKA 2ACFA 3KZWA 2EEEA 1VHUA 1BLLE 3JZTA 5FSVA 2LGRA 1LANA 1LAMA 2FXKA 4KYBA 1ZR3A 1ZR5A 5FSZA 1LCPA 4JCAA 5CB3A 5E3BA 4ETKA 5FSUA 5CMSA 3GQOA 3IJ3A 4JVVA 4GVVA 2J9AA 3EKEA 4UMLA 3SIJA 3GQEA 1HJZA 3GPQA 3EWRA 4X2TA 1GYTA 4R76A 3EJGA 3H8FA 4K0CA 3IIDA 3JRUA 3KQXA 3Q71A 4J5RA 3KQZA
chains in the Genus database with same CATH superfamily
1YD9A 4J5SA 4R6TA 2AFCA 5FSYA 3H8GA 4ZY1A 2XD7A 4ZI6A 1BPMA 3SIGA 3EJFA 1TXZA 3KR5A 1TY8A 3PEIA 4JLLA 4IQYA 2VRIA 2BFRA 3GPOA 2DX6A 2JZDA 4ESSA 4GVWA 3SIIA 3IIFA 5D8NA 2W2GA 1LAPA 3KR4A 3Q6ZA 4ZX8A 4K3NA 3GPGA 4ZY0A 4ZX9A 3VFQA 4J5QA 4JGKA 2WCTA 5DUSA 4ZYQA 4ABLA 5HOLA 4ZY2A 4R7MA 3T8WA 3V2BA 3EW5A 2JZEA 3V45A 2EWBA 4KSIA 5CB5A 4TU0A 2FG1A 1SPVA 3ETIA 5CBMA 3EWOA 5AILA 4GUAA 4D86A 1BPNA 3H8EA 2L8RA 3EWQA 1NJRA 3EWPA 4J4ZA 5FSXA 2BFQA 2KQVA 3SIHA 2FAVA 4ETJA 5HIHA 2X47A 4ABKA 2ACFA 3KZWA 2EEEA 1VHUA 1BLLE 2RNKA 3JZTA 2JZFA 5FSVA 2LGRA 1LANA 1LAMA 2FXKA 4KYBA 1ZR3A 1ZR5A 5FSZA 1LCPA 4JCAA 5CB3A 5E3BA 4ETKA 5FSUA 5CMSA 3GQOA 3IJ3A 4JVVA 4GVVA 2J9AA 3EKEA 4UMLA 3SIJA 3GQEA 1HJZA 3GPQA 3EWRA 4X2TA 1GYTA 4R76A 3EJGA 3H8FA 4K0CA 3IIDA 3JRUA 3KQXA 3Q71A 4J5RA 3KQZA
chains in the Genus database with same CATH topology
1YD9A 4J5SA 4R6TA 2AFCA 5FSYA 3H8GA 4ZY1A 2XD7A 4ZI6A 1BPMA 3SIGA 3EJFA 1TXZA 3KR5A 1TY8A 3PEIA 4JLLA 4IQYA 2VRIA 2BFRA 3GPOA 2DX6A 4ESSA 4GVWA 3SIIA 3IIFA 5D8NA 1LAPA 3KR4A 3Q6ZA 4ZX8A 4K3NA 3GPGA 4ZY0A 4ZX9A 3VFQA 4J5QA 4JGKA 5DUSA 4ZYQA 4ABLA 5HOLA 4ZY2A 4R7MA 3T8WA 3V2BA 3EW5A 3V45A 2EWBA 4KSIA 5CB5A 4TU0A 2FG1A 1SPVA 3ETIA 5CBMA 3EWOA 5AILA 4GUAA 4D86A 1BPNA 3H8EA 2L8RA 3EWQA 1NJRA 3EWPA 4J4ZA 5FSXA 2BFQA 3SIHA 2FAVA 4ETJA 5HIHA 2X47A 4ABKA 2ACFA 3KZWA 2EEEA 1VHUA 1BLLE 3JZTA 5FSVA 2LGRA 1LANA 1LAMA 2FXKA 4KYBA 1ZR3A 1ZR5A 5FSZA 1LCPA 4JCAA 5CB3A 5E3BA 4ETKA 5FSUA 5CMSA 3GQOA 3IJ3A 4JVVA 4GVVA 2J9AA 3EKEA 4UMLA 3SIJA 3GQEA 1HJZA 3GPQA 3EWRA 4X2TA 1GYTA 4R76A 3EJGA 3H8FA 4K0CA 3IIDA 3JRUA 3KQXA 3Q71A 4J5RA 3KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD9 A;  4J5S A;  4R6T A;  2AFC A;  5FSY A;  3H8G A;  4ZY1 A;  2XD7 A;  4ZI6 A;  1BPM A;  3SIG A;  3EJF A;  1TXZ A;  3KR5 A;  1TY8 A;  3PEI A;  4JLL A;  4IQY A;  2VRI A;  2BFR A;  3GPO A;  2DX6 A;  4ESS A;  4GVW A;  3SII A;  3IIF A;  5D8N A;  1LAP A;  3KR4 A;  3Q6Z A;  4ZX8 A;  4K3N A;  3GPG A;  4ZY0 A;  4ZX9 A;  3VFQ A;  4J5Q A;  4JGK A;  5DUS A;  4ZYQ A;  4ABL A;  5HOL A;  4ZY2 A;  4R7M A;  3T8W A;  3V2B A;  3EW5 A;  3V45 A;  2EWB A;  4KSI A;  5CB5 A;  4TU0 A;  2FG1 A;  1SPV A;  3ETI A;  5CBM A;  3EWO A;  5AIL A;  4GUA A;  4D86 A;  1BPN A;  3H8E A;  2L8R A;  3EWQ A;  1NJR A;  3EWP A;  4J4Z A;  5FSX A;  2BFQ A;  3SIH A;  2FAV A;  4ETJ A;  5HIH A;  2X47 A;  4ABK A;  2ACF A;  3KZW A;  2EEE A;  1VHU A;  1BLL E;  3JZT A;  5FSV A;  2LGR A;  1LAN A;  1LAM A;  2FXK A;  4KYB A;  1ZR3 A;  1ZR5 A;  5FSZ A;  1LCP A;  4JCA A;  5CB3 A;  5E3B A;  4ETK A;  5FSU A;  5CMS A;  3GQO A;  3IJ3 A;  4JVV A;  4GVV A;  2J9A A;  3EKE A;  4UML A;  3SIJ A;  3GQE A;  1HJZ A;  3GPQ A;  3EWR A;  4X2T A;  1GYT A;  4R76 A;  3EJG A;  3H8F A;  4K0C A;  3IID A;  3JRU A;  3KQX A;  3Q71 A;  4J5R A;  3KQZ A; 
#chains in the Genus database with same CATH topology
 1YD9 A;  4J5S A;  4R6T A;  2AFC A;  5FSY A;  3H8G A;  4ZY1 A;  2XD7 A;  4ZI6 A;  1BPM A;  3SIG A;  3EJF A;  1TXZ A;  3KR5 A;  1TY8 A;  3PEI A;  4JLL A;  4IQY A;  2VRI A;  2BFR A;  3GPO A;  2DX6 A;  2JZD A;  4ESS A;  4GVW A;  3SII A;  3IIF A;  5D8N A;  2W2G A;  1LAP A;  3KR4 A;  3Q6Z A;  4ZX8 A;  4K3N A;  3GPG A;  4ZY0 A;  4ZX9 A;  3VFQ A;  4J5Q A;  4JGK A;  2WCT A;  5DUS A;  4ZYQ A;  4ABL A;  5HOL A;  4ZY2 A;  4R7M A;  3T8W A;  3V2B A;  3EW5 A;  2JZE A;  3V45 A;  2EWB A;  4KSI A;  5CB5 A;  4TU0 A;  2FG1 A;  1SPV A;  3ETI A;  5CBM A;  3EWO A;  5AIL A;  4GUA A;  4D86 A;  1BPN A;  3H8E A;  2L8R A;  3EWQ A;  1NJR A;  3EWP A;  4J4Z A;  5FSX A;  2BFQ A;  2KQV A;  3SIH A;  2FAV A;  4ETJ A;  5HIH A;  2X47 A;  4ABK A;  2ACF A;  3KZW A;  2EEE A;  1VHU A;  1BLL E;  2RNK A;  3JZT A;  2JZF A;  5FSV A;  2LGR A;  1LAN A;  1LAM A;  2FXK A;  4KYB A;  1ZR3 A;  1ZR5 A;  5FSZ A;  1LCP A;  4JCA A;  5CB3 A;  5E3B A;  4ETK A;  5FSU A;  5CMS A;  3GQO A;  3IJ3 A;  4JVV A;  4GVV A;  2J9A A;  3EKE A;  4UML A;  3SIJ A;  3GQE A;  1HJZ A;  3GPQ A;  3EWR A;  4X2T A;  1GYT A;  4R76 A;  3EJG A;  3H8F A;  4K0C A;  3IID A;  3JRU A;  3KQX A;  3Q71 A;  4J5R A;  3KQZ A; 
#chains in the Genus database with same CATH homology
 1YD9 A;  4J5S A;  4R6T A;  2AFC A;  5FSY A;  3H8G A;  4ZY1 A;  2XD7 A;  4ZI6 A;  1BPM A;  3SIG A;  3EJF A;  1TXZ A;  3KR5 A;  1TY8 A;  3PEI A;  4JLL A;  4IQY A;  2VRI A;  2BFR A;  3GPO A;  2DX6 A;  4ESS A;  4GVW A;  3SII A;  3IIF A;  5D8N A;  1LAP A;  3KR4 A;  3Q6Z A;  4ZX8 A;  4K3N A;  3GPG A;  4ZY0 A;  4ZX9 A;  3VFQ A;  4J5Q A;  4JGK A;  5DUS A;  4ZYQ A;  4ABL A;  5HOL A;  4ZY2 A;  4R7M A;  3T8W A;  3V2B A;  3EW5 A;  3V45 A;  2EWB A;  4KSI A;  5CB5 A;  4TU0 A;  2FG1 A;  1SPV A;  3ETI A;  5CBM A;  3EWO A;  5AIL A;  4GUA A;  4D86 A;  1BPN A;  3H8E A;  2L8R A;  3EWQ A;  1NJR A;  3EWP A;  4J4Z A;  5FSX A;  2BFQ A;  3SIH A;  2FAV A;  4ETJ A;  5HIH A;  2X47 A;  4ABK A;  2ACF A;  3KZW A;  2EEE A;  1VHU A;  1BLL E;  3JZT A;  5FSV A;  2LGR A;  1LAN A;  1LAM A;  2FXK A;  4KYB A;  1ZR3 A;  1ZR5 A;  5FSZ A;  1LCP A;  4JCA A;  5CB3 A;  5E3B A;  4ETK A;  5FSU A;  5CMS A;  3GQO A;  3IJ3 A;  4JVV A;  4GVV A;  2J9A A;  3EKE A;  4UML A;  3SIJ A;  3GQE A;  1HJZ A;  3GPQ A;  3EWR A;  4X2T A;  1GYT A;  4R76 A;  3EJG A;  3H8F A;  4K0C A;  3IID A;  3JRU A;  3KQX A;  3Q71 A;  4J5R A;  3KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...