3SIIA

The x-ray crystal structure of poly(adp-ribose) glycohydrolase bound to the inhibitor adp-hpd from thermomonospora curvata
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
274
structure length
265
Chain Sequence
RHSRRAIAAETVEILERGRYTAPSGRVVPIADHVAQAVRGTRLYRPEKLAVLLEGTRIEVTEETTLAAARRLTGAAGDQVACLNFASAEHPGGGFLSGAHAQEEGLARSSGLYASLRAVPQFYAFHHRQRDPLYSDHLIYSPGVPVFRDDAGRLLEEPYRVAFLTSPAPNRRAIGDLRTVEEIGRVLRGRAAKVLAAARHHGHRRLVLGAWGCGVFGNDPAQVAETFAGLLLDGGPFAGRFAHVVFAVWDTAPGAPRHAAFARRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords poly(ADP-ribose) glycohydrolase
publication title The structure and catalytic mechanism of a poly(ADP-ribose) glycohydrolase.
pubmed doi rcsb
source organism Thermomonospora curvata
total genus 97
structure length 265
sequence length 274
ec nomenclature ec 3.2.1.143: Poly(ADP-ribose) glycohydrolase.
pdb deposition date 2011-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3siiA00
1LAPA 1YD9A 1BLLE 5AILA 4ZYQA 5CBMA 3SIHA 5CB5A 4TU0A 3GPGA 4GUAA 1NJRA 4UMLA 2J9AA 4KYBA 4R7MA 3H8EA 5E3BA 4ESSA 2FAVA 4ZY2A 3ETIA 4ETKA 2LGRA 2EWBA 5HIHA 3KQZA 4J5QA 4ETJA 3EWRA 5FSYA 4IQYA 2VRIA 3VFQA 5FSXA 3EJGA 3KR4A 5FSVA 3PEIA 1SPVA 1GYTA 3SIIA 3H8FA 3IIFA 4ZY0A 3IJ3A 1HJZA 3EWOA 3SIJA 4GVVA 3EW5A 3EKEA 1ZR3A 4J4ZA 4D86A 5FSZA 2BFQA 2ACFA 4R6TA 3GPQA 3EJFA 4KSIA 1TXZA 4R76A 2FXKA 3GPOA 4ABLA 4J5RA 4JVVA 1TY8A 4JGKA 3JRUA 2AFCA 5CMSA 3Q71A 2BFRA 3GQEA 2L8RA 3H8GA 4K3NA 1LANA 4JCAA 3IIDA 1BPNA 3SIGA 4X2TA 1LCPA 3T8WA 4ZY1A 5CB3A 1LAMA 3V2BA 5HOLA 3EWQA 2EEEA 3V45A 3KZWA 3GQOA 5FSUA 4GVWA 2FG1A 3KR5A 4JLLA 3JZTA 3Q6ZA 4ZX9A 2DX6A 2XD7A 3KQXA 4ABKA 5D8NA 4ZI6A 1BPMA 4J5SA 2X47A 4K0CA 4ZX8A 3EWPA 5DUSA 1VHUA 1ZR5A
chains in the Genus database with same CATH superfamily
1LAPA 1YD9A 1BLLE 5AILA 4ZYQA 2RNKA 5CBMA 3SIHA 5CB5A 4TU0A 3GPGA 4GUAA 1NJRA 4UMLA 2J9AA 4KYBA 4R7MA 3H8EA 5E3BA 4ESSA 2FAVA 4ZY2A 3ETIA 4ETKA 2LGRA 2EWBA 5HIHA 3KQZA 4J5QA 4ETJA 3EWRA 5FSYA 4IQYA 2VRIA 3VFQA 5FSXA 3EJGA 3KR4A 5FSVA 3PEIA 1SPVA 1GYTA 2JZEA 3SIIA 3H8FA 3IIFA 4ZY0A 3IJ3A 1HJZA 3EWOA 3SIJA 4GVVA 3EW5A 3EKEA 1ZR3A 4J4ZA 4D86A 5FSZA 2JZFA 2BFQA 2ACFA 4R6TA 3GPQA 3EJFA 4KSIA 1TXZA 4R76A 2FXKA 3GPOA 4ABLA 4J5RA 4JVVA 1TY8A 4JGKA 3JRUA 2AFCA 5CMSA 3Q71A 2BFRA 3GQEA 2L8RA 3H8GA 4K3NA 1LANA 4JCAA 2W2GA 3IIDA 1BPNA 3SIGA 4X2TA 1LCPA 3T8WA 4ZY1A 5CB3A 1LAMA 2KQVA 3V2BA 5HOLA 3EWQA 2EEEA 3V45A 3KZWA 3GQOA 5FSUA 4GVWA 2FG1A 3KR5A 4JLLA 3JZTA 3Q6ZA 4ZX9A 2DX6A 2XD7A 3KQXA 4ABKA 2WCTA 5D8NA 4ZI6A 1BPMA 4J5SA 2X47A 4K0CA 4ZX8A 3EWPA 5DUSA 1VHUA 1ZR5A 2JZDA
chains in the Genus database with same CATH topology
1LAPA 1YD9A 1BLLE 5AILA 4ZYQA 5CBMA 3SIHA 5CB5A 4TU0A 3GPGA 4GUAA 1NJRA 4UMLA 2J9AA 4KYBA 4R7MA 3H8EA 5E3BA 4ESSA 2FAVA 4ZY2A 3ETIA 4ETKA 2LGRA 2EWBA 5HIHA 3KQZA 4J5QA 4ETJA 3EWRA 5FSYA 4IQYA 2VRIA 3VFQA 5FSXA 3EJGA 3KR4A 5FSVA 3PEIA 1SPVA 1GYTA 3SIIA 3H8FA 3IIFA 4ZY0A 3IJ3A 1HJZA 3EWOA 3SIJA 4GVVA 3EW5A 3EKEA 1ZR3A 4J4ZA 4D86A 5FSZA 2BFQA 2ACFA 4R6TA 3GPQA 3EJFA 4KSIA 1TXZA 4R76A 2FXKA 3GPOA 4ABLA 4J5RA 4JVVA 1TY8A 4JGKA 3JRUA 2AFCA 5CMSA 3Q71A 2BFRA 3GQEA 2L8RA 3H8GA 4K3NA 1LANA 4JCAA 3IIDA 1BPNA 3SIGA 4X2TA 1LCPA 3T8WA 4ZY1A 5CB3A 1LAMA 3V2BA 5HOLA 3EWQA 2EEEA 3V45A 3KZWA 3GQOA 5FSUA 4GVWA 2FG1A 3KR5A 4JLLA 3JZTA 3Q6ZA 4ZX9A 2DX6A 2XD7A 3KQXA 4ABKA 5D8NA 4ZI6A 1BPMA 4J5SA 2X47A 4K0CA 4ZX8A 3EWPA 5DUSA 1VHUA 1ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAP A;  1YD9 A;  1BLL E;  5AIL A;  4ZYQ A;  5CBM A;  3SIH A;  5CB5 A;  4TU0 A;  3GPG A;  4GUA A;  1NJR A;  4UML A;  2J9A A;  4KYB A;  4R7M A;  3H8E A;  5E3B A;  4ESS A;  2FAV A;  4ZY2 A;  3ETI A;  4ETK A;  2LGR A;  2EWB A;  5HIH A;  3KQZ A;  4J5Q A;  4ETJ A;  3EWR A;  5FSY A;  4IQY A;  2VRI A;  3VFQ A;  5FSX A;  3EJG A;  3KR4 A;  5FSV A;  3PEI A;  1SPV A;  1GYT A;  3SII A;  3H8F A;  3IIF A;  4ZY0 A;  3IJ3 A;  1HJZ A;  3EWO A;  3SIJ A;  4GVV A;  3EW5 A;  3EKE A;  1ZR3 A;  4J4Z A;  4D86 A;  5FSZ A;  2BFQ A;  2ACF A;  4R6T A;  3GPQ A;  3EJF A;  4KSI A;  1TXZ A;  4R76 A;  2FXK A;  3GPO A;  4ABL A;  4J5R A;  4JVV A;  1TY8 A;  4JGK A;  3JRU A;  2AFC A;  5CMS A;  3Q71 A;  2BFR A;  3GQE A;  2L8R A;  3H8G A;  4K3N A;  1LAN A;  4JCA A;  3IID A;  1BPN A;  3SIG A;  4X2T A;  1LCP A;  3T8W A;  4ZY1 A;  5CB3 A;  1LAM A;  3V2B A;  5HOL A;  3EWQ A;  2EEE A;  3V45 A;  3KZW A;  3GQO A;  5FSU A;  4GVW A;  2FG1 A;  3KR5 A;  4JLL A;  3JZT A;  3Q6Z A;  4ZX9 A;  2DX6 A;  2XD7 A;  3KQX A;  4ABK A;  5D8N A;  4ZI6 A;  1BPM A;  4J5S A;  2X47 A;  4K0C A;  4ZX8 A;  3EWP A;  5DUS A;  1VHU A;  1ZR5 A; 
#chains in the Genus database with same CATH topology
 1LAP A;  1YD9 A;  1BLL E;  5AIL A;  4ZYQ A;  2RNK A;  5CBM A;  3SIH A;  5CB5 A;  4TU0 A;  3GPG A;  4GUA A;  1NJR A;  4UML A;  2J9A A;  4KYB A;  4R7M A;  3H8E A;  5E3B A;  4ESS A;  2FAV A;  4ZY2 A;  3ETI A;  4ETK A;  2LGR A;  2EWB A;  5HIH A;  3KQZ A;  4J5Q A;  4ETJ A;  3EWR A;  5FSY A;  4IQY A;  2VRI A;  3VFQ A;  5FSX A;  3EJG A;  3KR4 A;  5FSV A;  3PEI A;  1SPV A;  1GYT A;  2JZE A;  3SII A;  3H8F A;  3IIF A;  4ZY0 A;  3IJ3 A;  1HJZ A;  3EWO A;  3SIJ A;  4GVV A;  3EW5 A;  3EKE A;  1ZR3 A;  4J4Z A;  4D86 A;  5FSZ A;  2JZF A;  2BFQ A;  2ACF A;  4R6T A;  3GPQ A;  3EJF A;  4KSI A;  1TXZ A;  4R76 A;  2FXK A;  3GPO A;  4ABL A;  4J5R A;  4JVV A;  1TY8 A;  4JGK A;  3JRU A;  2AFC A;  5CMS A;  3Q71 A;  2BFR A;  3GQE A;  2L8R A;  3H8G A;  4K3N A;  1LAN A;  4JCA A;  2W2G A;  3IID A;  1BPN A;  3SIG A;  4X2T A;  1LCP A;  3T8W A;  4ZY1 A;  5CB3 A;  1LAM A;  2KQV A;  3V2B A;  5HOL A;  3EWQ A;  2EEE A;  3V45 A;  3KZW A;  3GQO A;  5FSU A;  4GVW A;  2FG1 A;  3KR5 A;  4JLL A;  3JZT A;  3Q6Z A;  4ZX9 A;  2DX6 A;  2XD7 A;  3KQX A;  4ABK A;  2WCT A;  5D8N A;  4ZI6 A;  1BPM A;  4J5S A;  2X47 A;  4K0C A;  4ZX8 A;  3EWP A;  5DUS A;  1VHU A;  1ZR5 A;  2JZD A; 
#chains in the Genus database with same CATH homology
 1LAP A;  1YD9 A;  1BLL E;  5AIL A;  4ZYQ A;  5CBM A;  3SIH A;  5CB5 A;  4TU0 A;  3GPG A;  4GUA A;  1NJR A;  4UML A;  2J9A A;  4KYB A;  4R7M A;  3H8E A;  5E3B A;  4ESS A;  2FAV A;  4ZY2 A;  3ETI A;  4ETK A;  2LGR A;  2EWB A;  5HIH A;  3KQZ A;  4J5Q A;  4ETJ A;  3EWR A;  5FSY A;  4IQY A;  2VRI A;  3VFQ A;  5FSX A;  3EJG A;  3KR4 A;  5FSV A;  3PEI A;  1SPV A;  1GYT A;  3SII A;  3H8F A;  3IIF A;  4ZY0 A;  3IJ3 A;  1HJZ A;  3EWO A;  3SIJ A;  4GVV A;  3EW5 A;  3EKE A;  1ZR3 A;  4J4Z A;  4D86 A;  5FSZ A;  2BFQ A;  2ACF A;  4R6T A;  3GPQ A;  3EJF A;  4KSI A;  1TXZ A;  4R76 A;  2FXK A;  3GPO A;  4ABL A;  4J5R A;  4JVV A;  1TY8 A;  4JGK A;  3JRU A;  2AFC A;  5CMS A;  3Q71 A;  2BFR A;  3GQE A;  2L8R A;  3H8G A;  4K3N A;  1LAN A;  4JCA A;  3IID A;  1BPN A;  3SIG A;  4X2T A;  1LCP A;  3T8W A;  4ZY1 A;  5CB3 A;  1LAM A;  3V2B A;  5HOL A;  3EWQ A;  2EEE A;  3V45 A;  3KZW A;  3GQO A;  5FSU A;  4GVW A;  2FG1 A;  3KR5 A;  4JLL A;  3JZT A;  3Q6Z A;  4ZX9 A;  2DX6 A;  2XD7 A;  3KQX A;  4ABK A;  5D8N A;  4ZI6 A;  1BPM A;  4J5S A;  2X47 A;  4K0C A;  4ZX8 A;  3EWP A;  5DUS A;  1VHU A;  1ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...