2JZDA

Nmr structure of the domain 527-651 of the sars-cov nonstructural protein nsp3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replicase polyprotein 1ab
publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzdA01
2KQVA 2JZDA 2JZFA 2RNKA 2JZEA 2W2GA 2WCTA
chains in the Genus database with same CATH superfamily
3SIHA 1HJZA 4ESSA 3IIDA 2JZDA 3SIIA 4GVVA 3V2BA 1NJRA 5D8NA 3KR4A 3EW5A 2X47A 1TY8A 4X2TA 4J5SA 5DUSA 3SIGA 3JRUA 5AILA 4JGKA 3KR5A 2JZEA 5CB3A 3EKEA 2BFRA 4K3NA 3GPOA 4R7MA 3H8EA 5FSUA 4ZX8A 2FAVA 1YD9A 3KQZA 4ABKA 1ZR3A 2JZFA 2RNKA 4ABLA 4UMLA 4ZY2A 4J4ZA 2J9AA 4J5RA 1TXZA 5FSVA 2EEEA 3JZTA 1VHUA 3GPGA 2AFCA 3IIFA 2BFQA 2WCTA 3EWRA 2XD7A 2KQVA 3ETIA 4ZYQA 4J5QA 3IJ3A 3SIJA 5FSXA 4D86A 5HIHA 4KSIA 3PEIA 5CMSA 4ZY1A 1GYTA 3GQOA 5E3BA 4ZX9A 3EWPA 2L8RA 4ETKA 4K0CA 4R6TA 2FG1A 4ZY0A 4R76A 2EWBA 4JCAA 3H8GA 1SPVA 3H8FA 1LCPA 1BPMA 5HOLA 4ZI6A 4KYBA 3GPQA 5FSYA 5FSZA 1ZR5A 2LGRA 4GVWA 1LANA 1BPNA 5CBMA 3KQXA 4JLLA 3GQEA 3EWQA 5CB5A 1BLLE 2ACFA 1LAPA 4JVVA 4GUAA 2DX6A 2VRIA 3Q71A 3VFQA 3EJFA 2FXKA 4ETJA 3EWOA 3Q6ZA 3V45A 4TU0A 3T8WA 1LAMA 3KZWA 4IQYA 3EJGA 2W2GA
chains in the Genus database with same CATH topology
2KQVA 2JZDA 2JZFA 2RNKA 2JZEA 2W2GA 2WCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQV A;  2JZD A;  2JZF A;  2RNK A;  2JZE A;  2W2G A;  2WCT A; 
#chains in the Genus database with same CATH topology
 3SIH A;  1HJZ A;  4ESS A;  3IID A;  2JZD A;  3SII A;  4GVV A;  3V2B A;  1NJR A;  5D8N A;  3KR4 A;  3EW5 A;  2X47 A;  1TY8 A;  4X2T A;  4J5S A;  5DUS A;  3SIG A;  3JRU A;  5AIL A;  4JGK A;  3KR5 A;  2JZE A;  5CB3 A;  3EKE A;  2BFR A;  4K3N A;  3GPO A;  4R7M A;  3H8E A;  5FSU A;  4ZX8 A;  2FAV A;  1YD9 A;  3KQZ A;  4ABK A;  1ZR3 A;  2JZF A;  2RNK A;  4ABL A;  4UML A;  4ZY2 A;  4J4Z A;  2J9A A;  4J5R A;  1TXZ A;  5FSV A;  2EEE A;  3JZT A;  1VHU A;  3GPG A;  2AFC A;  3IIF A;  2BFQ A;  2WCT A;  3EWR A;  2XD7 A;  2KQV A;  3ETI A;  4ZYQ A;  4J5Q A;  3IJ3 A;  3SIJ A;  5FSX A;  4D86 A;  5HIH A;  4KSI A;  3PEI A;  5CMS A;  4ZY1 A;  1GYT A;  3GQO A;  5E3B A;  4ZX9 A;  3EWP A;  2L8R A;  4ETK A;  4K0C A;  4R6T A;  2FG1 A;  4ZY0 A;  4R76 A;  2EWB A;  4JCA A;  3H8G A;  1SPV A;  3H8F A;  1LCP A;  1BPM A;  5HOL A;  4ZI6 A;  4KYB A;  3GPQ A;  5FSY A;  5FSZ A;  1ZR5 A;  2LGR A;  4GVW A;  1LAN A;  1BPN A;  5CBM A;  3KQX A;  4JLL A;  3GQE A;  3EWQ A;  5CB5 A;  1BLL E;  2ACF A;  1LAP A;  4JVV A;  4GUA A;  2DX6 A;  2VRI A;  3Q71 A;  3VFQ A;  3EJF A;  2FXK A;  4ETJ A;  3EWO A;  3Q6Z A;  3V45 A;  4TU0 A;  3T8W A;  1LAM A;  3KZW A;  4IQY A;  3EJG A;  2W2G A; 
#chains in the Genus database with same CATH homology
 2KQV A;  2JZD A;  2JZF A;  2RNK A;  2JZE A;  2W2G A;  2WCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...