2JZDA

Nmr structure of the domain 527-651 of the sars-cov nonstructural protein nsp3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzdA01
2WCTA 2JZEA 2KQVA 2JZDA 2RNKA 2W2GA 2JZFA
chains in the Genus database with same CATH superfamily
2LGRA 4IQYA 4GUAA 5D8NA 4KSIA 4ZY2A 1YD9A 5AILA 2JZEA 2BFQA 2JZDA 5FSUA 3Q6ZA 3JZTA 5CB5A 4JVVA 3GQOA 4GVVA 2BFRA 2DX6A 4ZI6A 1VHUA 5HOLA 4ETJA 1LCPA 3KZWA 2FG1A 1LAPA 3H8FA 4GVWA 2L8RA 4JGKA 5CB3A 3EWRA 3V2BA 4ZY0A 4ESSA 2WCTA 4R6TA 1TXZA 3EWQA 3KQXA 5FSZA 4JLLA 4J5QA 1BPNA 2JZFA 4TU0A 1GYTA 3PEIA 2FXKA 3SIHA 3SIJA 4ZYQA 1LAMA 2XD7A 2AFCA 3SIGA 5E3BA 4ZX9A 4ETKA 4J5SA 4J5RA 4ZY1A 4K0CA 3IJ3A 4R7MA 5HIHA 3EKEA 5DUSA 3EW5A 2J9AA 1ZR3A 1TY8A 3KR5A 5CMSA 3GPGA 4KYBA 1NJRA 3IIDA 2FAVA 3EWOA 4J4ZA 3T8WA 4D86A 3EJGA 1HJZA 3JRUA 4K3NA 1ZR5A 1BLLE 3Q71A 1BPMA 2RNKA 4R76A 4JCAA 3ETIA 2X47A 4ZX8A 4ABLA 1LANA 3KQZA 4UMLA 2EWBA 1SPVA 3EWPA 3KR4A 3H8GA 5FSVA 3IIFA 3VFQA 3GQEA 3GPQA 4ABKA 3V45A 4X2TA 5CBMA 2EEEA 2VRIA 3GPOA 5FSXA 2W2GA 2ACFA 5FSYA 2KQVA 3EJFA 3H8EA 3SIIA
chains in the Genus database with same CATH topology
2WCTA 2JZEA 2KQVA 2JZDA 2RNKA 2W2GA 2JZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WCT A;  2JZE A;  2KQV A;  2JZD A;  2RNK A;  2W2G A;  2JZF A; 
#chains in the Genus database with same CATH topology
 2LGR A;  4IQY A;  4GUA A;  5D8N A;  4KSI A;  4ZY2 A;  1YD9 A;  5AIL A;  2JZE A;  2BFQ A;  2JZD A;  5FSU A;  3Q6Z A;  3JZT A;  5CB5 A;  4JVV A;  3GQO A;  4GVV A;  2BFR A;  2DX6 A;  4ZI6 A;  1VHU A;  5HOL A;  4ETJ A;  1LCP A;  3KZW A;  2FG1 A;  1LAP A;  3H8F A;  4GVW A;  2L8R A;  4JGK A;  5CB3 A;  3EWR A;  3V2B A;  4ZY0 A;  4ESS A;  2WCT A;  4R6T A;  1TXZ A;  3EWQ A;  3KQX A;  5FSZ A;  4JLL A;  4J5Q A;  1BPN A;  2JZF A;  4TU0 A;  1GYT A;  3PEI A;  2FXK A;  3SIH A;  3SIJ A;  4ZYQ A;  1LAM A;  2XD7 A;  2AFC A;  3SIG A;  5E3B A;  4ZX9 A;  4ETK A;  4J5S A;  4J5R A;  4ZY1 A;  4K0C A;  3IJ3 A;  4R7M A;  5HIH A;  3EKE A;  5DUS A;  3EW5 A;  2J9A A;  1ZR3 A;  1TY8 A;  3KR5 A;  5CMS A;  3GPG A;  4KYB A;  1NJR A;  3IID A;  2FAV A;  3EWO A;  4J4Z A;  3T8W A;  4D86 A;  3EJG A;  1HJZ A;  3JRU A;  4K3N A;  1ZR5 A;  1BLL E;  3Q71 A;  1BPM A;  2RNK A;  4R76 A;  4JCA A;  3ETI A;  2X47 A;  4ZX8 A;  4ABL A;  1LAN A;  3KQZ A;  4UML A;  2EWB A;  1SPV A;  3EWP A;  3KR4 A;  3H8G A;  5FSV A;  3IIF A;  3VFQ A;  3GQE A;  3GPQ A;  4ABK A;  3V45 A;  4X2T A;  5CBM A;  2EEE A;  2VRI A;  3GPO A;  5FSX A;  2W2G A;  2ACF A;  5FSY A;  2KQV A;  3EJF A;  3H8E A;  3SII A; 
#chains in the Genus database with same CATH homology
 2WCT A;  2JZE A;  2KQV A;  2JZD A;  2RNK A;  2W2G A;  2JZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...