2JZDA

Nmr structure of the domain 527-651 of the sars-cov nonstructural protein nsp3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
GSHMGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Replicase polyprotein 1ab
publication title Nuclear magnetic resonance structure shows that the severe acute respiratory syndrome coronavirus-unique domain contains a macrodomain fold.
pubmed doi rcsb
source organism Sars coronavirus
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.20 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E; domain 1 2jzdA01
2RNKA 2JZFA 2JZDA 2WCTA 2W2GA 2JZEA 2KQVA
chains in the Genus database with same CATH superfamily
3T8WA 3IIDA 4R7MA 3EWQA 1SPVA 3KR5A 2BFRA 3KZWA 3Q6ZA 4ZY2A 3IIFA 4ETKA 2L8RA 4R6TA 2WCTA 2LGRA 1NJRA 3SIIA 3H8FA 3GQEA 4ZY0A 5FSYA 3VFQA 2JZDA 1TXZA 4IQYA 1ZR5A 4ZI6A 1ZR3A 5DUSA 3SIJA 5CB3A 2W2GA 2EEEA 2ACFA 4GUAA 4ZYQA 3KR4A 3JRUA 3GPOA 5FSXA 4KYBA 3EJGA 3EW5A 5FSVA 1TY8A 3Q71A 4ABKA 3EWOA 5HOLA 3IJ3A 2J9AA 4J4ZA 2EWBA 4JCAA 1LAPA 5D8NA 4GVWA 4R76A 3ETIA 2JZEA 2X47A 3GPQA 3EKEA 2FG1A 4D86A 1YD9A 3PEIA 2DX6A 4J5QA 5HIHA 4ABLA 3JZTA 3V2BA 4ZX8A 2JZFA 4GVVA 1LCPA 2FXKA 3SIHA 1HJZA 4K3NA 2BFQA 5AILA 2FAVA 3GPGA 4X2TA 3H8EA 1BPMA 1VHUA 4TU0A 3EWRA 2RNKA 4J5SA 2AFCA 4JLLA 1LAMA 3KQXA 1BLLE 2KQVA 2VRIA 3V45A 3GQOA 1GYTA 5CBMA 3SIGA 3EWPA 1BPNA 2XD7A 5FSUA 4ESSA 5FSZA 4ZX9A 3H8GA 3KQZA 4ETJA 4ZY1A 5E3BA 4K0CA 1LANA 3EJFA 4JGKA 4UMLA 5CMSA 4J5RA 4JVVA 5CB5A 4KSIA
chains in the Genus database with same CATH topology
2RNKA 2JZFA 2JZDA 2WCTA 2W2GA 2JZEA 2KQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RNK A;  2JZF A;  2JZD A;  2WCT A;  2W2G A;  2JZE A;  2KQV A; 
#chains in the Genus database with same CATH topology
 3T8W A;  3IID A;  4R7M A;  3EWQ A;  1SPV A;  3KR5 A;  2BFR A;  3KZW A;  3Q6Z A;  4ZY2 A;  3IIF A;  4ETK A;  2L8R A;  4R6T A;  2WCT A;  2LGR A;  1NJR A;  3SII A;  3H8F A;  3GQE A;  4ZY0 A;  5FSY A;  3VFQ A;  2JZD A;  1TXZ A;  4IQY A;  1ZR5 A;  4ZI6 A;  1ZR3 A;  5DUS A;  3SIJ A;  5CB3 A;  2W2G A;  2EEE A;  2ACF A;  4GUA A;  4ZYQ A;  3KR4 A;  3JRU A;  3GPO A;  5FSX A;  4KYB A;  3EJG A;  3EW5 A;  5FSV A;  1TY8 A;  3Q71 A;  4ABK A;  3EWO A;  5HOL A;  3IJ3 A;  2J9A A;  4J4Z A;  2EWB A;  4JCA A;  1LAP A;  5D8N A;  4GVW A;  4R76 A;  3ETI A;  2JZE A;  2X47 A;  3GPQ A;  3EKE A;  2FG1 A;  4D86 A;  1YD9 A;  3PEI A;  2DX6 A;  4J5Q A;  5HIH A;  4ABL A;  3JZT A;  3V2B A;  4ZX8 A;  2JZF A;  4GVV A;  1LCP A;  2FXK A;  3SIH A;  1HJZ A;  4K3N A;  2BFQ A;  5AIL A;  2FAV A;  3GPG A;  4X2T A;  3H8E A;  1BPM A;  1VHU A;  4TU0 A;  3EWR A;  2RNK A;  4J5S A;  2AFC A;  4JLL A;  1LAM A;  3KQX A;  1BLL E;  2KQV A;  2VRI A;  3V45 A;  3GQO A;  1GYT A;  5CBM A;  3SIG A;  3EWP A;  1BPN A;  2XD7 A;  5FSU A;  4ESS A;  5FSZ A;  4ZX9 A;  3H8G A;  3KQZ A;  4ETJ A;  4ZY1 A;  5E3B A;  4K0C A;  1LAN A;  3EJF A;  4JGK A;  4UML A;  5CMS A;  4J5R A;  4JVV A;  5CB5 A;  4KSI A; 
#chains in the Genus database with same CATH homology
 2RNK A;  2JZF A;  2JZD A;  2WCT A;  2W2G A;  2JZE A;  2KQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...