3GQEA

Crystal structure of macro domain of venezuelan equine encephalitis virus
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
MKAPSYHVVRGDIATATEGVIINAANSKGQPGGGVCGALYKKFPESFDLQPIEVGKARLVKGAAKHIIHAVGPNFNKVSEVEGDKQLAEAYESIAKIVNDNNYKSVAIPLLSTGIFSGNKDRLTQSLNHLLTALDTTDADVAIYCRDKKWEMTLKEAVARRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title The crystal structures of Chikungunya and Venezuelan equine encephalitis virus nsP3 macro domains define a conserved adenosine binding pocket
pubmed doi rcsb
source organism Venezuelan equine encephalitis virus
molecule tags Viral protein
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3gqeA00
3H8GA 5D8NA 2X47A 2XD7A 4ESSA 3ETIA 3V2BA 2BFQA 4D86A 4TU0A 5AILA 4ZY2A 3IIFA 3EWPA 3KQXA 4ZY0A 4JLLA 4ZX9A 2EEEA 3EJGA 3GQOA 3T8WA 4ZY1A 4ABLA 3KR5A 4JGKA 4JVVA 5CB3A 4GVWA 2DX6A 1LAMA 3EWOA 5FSZA 4KSIA 3EKEA 4UMLA 1TXZA 3GPOA 5HIHA 3H8FA 5FSUA 2BFRA 1LAPA 1NJRA 4JCAA 1LCPA 1VHUA 4R7MA 4X2TA 3EWRA 2LGRA 3JZTA 4KYBA 5FSYA 1SPVA 4R76A 3VFQA 3KR4A 2FXKA 5HOLA 3IIDA 3V45A 4GVVA 4J5RA 3JRUA 2L8RA 1ZR5A 1LANA 1BLLE 3SIHA 3EW5A 3GPGA 2VRIA 4K3NA 3IJ3A 1YD9A 5CMSA 4ZYQA 4K0CA 4J5QA 3EJFA 5FSXA 5E3BA 4ZI6A 1GYTA 4R6TA 4IQYA 3Q71A 3Q6ZA 1ZR3A 1BPNA 2FG1A 3EWQA 3SIGA 2J9AA 4ABKA 2EWBA 4ETKA 3SIIA 4GUAA 1BPMA 4J4ZA 4ZX8A 3KQZA 3GQEA 3H8EA 3SIJA 2FAVA 5CBMA 1TY8A 3GPQA 1HJZA 4ETJA 5FSVA 5CB5A 2AFCA 5DUSA 3KZWA 3PEIA 2ACFA 4J5SA
chains in the Genus database with same CATH superfamily
3H8GA 5D8NA 2X47A 2XD7A 4ESSA 3ETIA 3V2BA 2BFQA 4D86A 4TU0A 5AILA 4ZY2A 3IIFA 3EWPA 3KQXA 4ZY0A 4JLLA 4ZX9A 2EEEA 3EJGA 3GQOA 3T8WA 4ZY1A 4ABLA 3KR5A 4JGKA 4JVVA 5CB3A 4GVWA 2DX6A 1LAMA 3EWOA 5FSZA 4KSIA 3EKEA 4UMLA 1TXZA 3GPOA 5HIHA 3H8FA 5FSUA 2BFRA 1LAPA 1NJRA 4JCAA 1LCPA 1VHUA 4R7MA 4X2TA 3EWRA 2LGRA 3JZTA 2JZDA 4KYBA 5FSYA 1SPVA 2W2GA 2WCTA 4R76A 3VFQA 3KR4A 2FXKA 5HOLA 3IIDA 3V45A 4GVVA 4J5RA 3JRUA 2L8RA 1ZR5A 2RNKA 1LANA 1BLLE 3SIHA 3EW5A 3GPGA 2VRIA 4K3NA 2JZFA 3IJ3A 1YD9A 5CMSA 4ZYQA 2JZEA 4K0CA 4J5QA 3EJFA 5FSXA 5E3BA 4ZI6A 1GYTA 4R6TA 4IQYA 3Q71A 3Q6ZA 1ZR3A 1BPNA 2FG1A 3EWQA 3SIGA 2J9AA 4ABKA 2EWBA 4ETKA 3SIIA 4GUAA 1BPMA 4J4ZA 4ZX8A 3KQZA 3GQEA 3H8EA 3SIJA 2FAVA 2KQVA 5CBMA 1TY8A 3GPQA 1HJZA 4ETJA 5FSVA 5CB5A 2AFCA 5DUSA 3KZWA 3PEIA 2ACFA 4J5SA
chains in the Genus database with same CATH topology
3H8GA 5D8NA 2X47A 2XD7A 4ESSA 3ETIA 3V2BA 2BFQA 4D86A 4TU0A 5AILA 4ZY2A 3IIFA 3EWPA 3KQXA 4ZY0A 4JLLA 4ZX9A 2EEEA 3EJGA 3GQOA 3T8WA 4ZY1A 4ABLA 3KR5A 4JGKA 4JVVA 5CB3A 4GVWA 2DX6A 1LAMA 3EWOA 5FSZA 4KSIA 3EKEA 4UMLA 1TXZA 3GPOA 5HIHA 3H8FA 5FSUA 2BFRA 1LAPA 1NJRA 4JCAA 1LCPA 1VHUA 4R7MA 4X2TA 3EWRA 2LGRA 3JZTA 4KYBA 5FSYA 1SPVA 4R76A 3VFQA 3KR4A 2FXKA 5HOLA 3IIDA 3V45A 4GVVA 4J5RA 3JRUA 2L8RA 1ZR5A 1LANA 1BLLE 3SIHA 3EW5A 3GPGA 2VRIA 4K3NA 3IJ3A 1YD9A 5CMSA 4ZYQA 4K0CA 4J5QA 3EJFA 5FSXA 5E3BA 4ZI6A 1GYTA 4R6TA 4IQYA 3Q71A 3Q6ZA 1ZR3A 1BPNA 2FG1A 3EWQA 3SIGA 2J9AA 4ABKA 2EWBA 4ETKA 3SIIA 4GUAA 1BPMA 4J4ZA 4ZX8A 3KQZA 3GQEA 3H8EA 3SIJA 2FAVA 5CBMA 1TY8A 3GPQA 1HJZA 4ETJA 5FSVA 5CB5A 2AFCA 5DUSA 3KZWA 3PEIA 2ACFA 4J5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8G A;  5D8N A;  2X47 A;  2XD7 A;  4ESS A;  3ETI A;  3V2B A;  2BFQ A;  4D86 A;  4TU0 A;  5AIL A;  4ZY2 A;  3IIF A;  3EWP A;  3KQX A;  4ZY0 A;  4JLL A;  4ZX9 A;  2EEE A;  3EJG A;  3GQO A;  3T8W A;  4ZY1 A;  4ABL A;  3KR5 A;  4JGK A;  4JVV A;  5CB3 A;  4GVW A;  2DX6 A;  1LAM A;  3EWO A;  5FSZ A;  4KSI A;  3EKE A;  4UML A;  1TXZ A;  3GPO A;  5HIH A;  3H8F A;  5FSU A;  2BFR A;  1LAP A;  1NJR A;  4JCA A;  1LCP A;  1VHU A;  4R7M A;  4X2T A;  3EWR A;  2LGR A;  3JZT A;  4KYB A;  5FSY A;  1SPV A;  4R76 A;  3VFQ A;  3KR4 A;  2FXK A;  5HOL A;  3IID A;  3V45 A;  4GVV A;  4J5R A;  3JRU A;  2L8R A;  1ZR5 A;  1LAN A;  1BLL E;  3SIH A;  3EW5 A;  3GPG A;  2VRI A;  4K3N A;  3IJ3 A;  1YD9 A;  5CMS A;  4ZYQ A;  4K0C A;  4J5Q A;  3EJF A;  5FSX A;  5E3B A;  4ZI6 A;  1GYT A;  4R6T A;  4IQY A;  3Q71 A;  3Q6Z A;  1ZR3 A;  1BPN A;  2FG1 A;  3EWQ A;  3SIG A;  2J9A A;  4ABK A;  2EWB A;  4ETK A;  3SII A;  4GUA A;  1BPM A;  4J4Z A;  4ZX8 A;  3KQZ A;  3GQE A;  3H8E A;  3SIJ A;  2FAV A;  5CBM A;  1TY8 A;  3GPQ A;  1HJZ A;  4ETJ A;  5FSV A;  5CB5 A;  2AFC A;  5DUS A;  3KZW A;  3PEI A;  2ACF A;  4J5S A; 
#chains in the Genus database with same CATH topology
 3H8G A;  5D8N A;  2X47 A;  2XD7 A;  4ESS A;  3ETI A;  3V2B A;  2BFQ A;  4D86 A;  4TU0 A;  5AIL A;  4ZY2 A;  3IIF A;  3EWP A;  3KQX A;  4ZY0 A;  4JLL A;  4ZX9 A;  2EEE A;  3EJG A;  3GQO A;  3T8W A;  4ZY1 A;  4ABL A;  3KR5 A;  4JGK A;  4JVV A;  5CB3 A;  4GVW A;  2DX6 A;  1LAM A;  3EWO A;  5FSZ A;  4KSI A;  3EKE A;  4UML A;  1TXZ A;  3GPO A;  5HIH A;  3H8F A;  5FSU A;  2BFR A;  1LAP A;  1NJR A;  4JCA A;  1LCP A;  1VHU A;  4R7M A;  4X2T A;  3EWR A;  2LGR A;  3JZT A;  2JZD A;  4KYB A;  5FSY A;  1SPV A;  2W2G A;  2WCT A;  4R76 A;  3VFQ A;  3KR4 A;  2FXK A;  5HOL A;  3IID A;  3V45 A;  4GVV A;  4J5R A;  3JRU A;  2L8R A;  1ZR5 A;  2RNK A;  1LAN A;  1BLL E;  3SIH A;  3EW5 A;  3GPG A;  2VRI A;  4K3N A;  2JZF A;  3IJ3 A;  1YD9 A;  5CMS A;  4ZYQ A;  2JZE A;  4K0C A;  4J5Q A;  3EJF A;  5FSX A;  5E3B A;  4ZI6 A;  1GYT A;  4R6T A;  4IQY A;  3Q71 A;  3Q6Z A;  1ZR3 A;  1BPN A;  2FG1 A;  3EWQ A;  3SIG A;  2J9A A;  4ABK A;  2EWB A;  4ETK A;  3SII A;  4GUA A;  1BPM A;  4J4Z A;  4ZX8 A;  3KQZ A;  3GQE A;  3H8E A;  3SIJ A;  2FAV A;  2KQV A;  5CBM A;  1TY8 A;  3GPQ A;  1HJZ A;  4ETJ A;  5FSV A;  5CB5 A;  2AFC A;  5DUS A;  3KZW A;  3PEI A;  2ACF A;  4J5S A; 
#chains in the Genus database with same CATH homology
 3H8G A;  5D8N A;  2X47 A;  2XD7 A;  4ESS A;  3ETI A;  3V2B A;  2BFQ A;  4D86 A;  4TU0 A;  5AIL A;  4ZY2 A;  3IIF A;  3EWP A;  3KQX A;  4ZY0 A;  4JLL A;  4ZX9 A;  2EEE A;  3EJG A;  3GQO A;  3T8W A;  4ZY1 A;  4ABL A;  3KR5 A;  4JGK A;  4JVV A;  5CB3 A;  4GVW A;  2DX6 A;  1LAM A;  3EWO A;  5FSZ A;  4KSI A;  3EKE A;  4UML A;  1TXZ A;  3GPO A;  5HIH A;  3H8F A;  5FSU A;  2BFR A;  1LAP A;  1NJR A;  4JCA A;  1LCP A;  1VHU A;  4R7M A;  4X2T A;  3EWR A;  2LGR A;  3JZT A;  4KYB A;  5FSY A;  1SPV A;  4R76 A;  3VFQ A;  3KR4 A;  2FXK A;  5HOL A;  3IID A;  3V45 A;  4GVV A;  4J5R A;  3JRU A;  2L8R A;  1ZR5 A;  1LAN A;  1BLL E;  3SIH A;  3EW5 A;  3GPG A;  2VRI A;  4K3N A;  3IJ3 A;  1YD9 A;  5CMS A;  4ZYQ A;  4K0C A;  4J5Q A;  3EJF A;  5FSX A;  5E3B A;  4ZI6 A;  1GYT A;  4R6T A;  4IQY A;  3Q71 A;  3Q6Z A;  1ZR3 A;  1BPN A;  2FG1 A;  3EWQ A;  3SIG A;  2J9A A;  4ABK A;  2EWB A;  4ETK A;  3SII A;  4GUA A;  1BPM A;  4J4Z A;  4ZX8 A;  3KQZ A;  3GQE A;  3H8E A;  3SIJ A;  2FAV A;  5CBM A;  1TY8 A;  3GPQ A;  1HJZ A;  4ETJ A;  5FSV A;  5CB5 A;  2AFC A;  5DUS A;  3KZW A;  3PEI A;  2ACF A;  4J5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...