3Q71A

Human parp14 (artd8) - macro domain 2 in complex with adenosine-5-diphosphoribose
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
203
structure length
203
Chain Sequence
GTENLYFQSMGKTSWEKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 73
structure length 203
sequence length 203
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3q71A00
4R6TA 1LANA 4TU0A 2VRIA 1NJRA 3V2BA 3GQEA 1LCPA 2X47A 4X2TA 5CB5A 5FSXA 4ETJA 1TXZA 3ETIA 3IJ3A 4JCAA 4ZY2A 3SIIA 3EWRA 5HOLA 2BFRA 2L8RA 5AILA 3H8FA 4ESSA 3EJFA 1TY8A 3GQOA 5CB3A 4JGKA 4JLLA 3GPGA 3SIJA 3EJGA 3H8GA 4J4ZA 3PEIA 1YD9A 2FG1A 1LAPA 3EWOA 5E3BA 4J5RA 1HJZA 3T8WA 1VHUA 2XD7A 3JRUA 2J9AA 1ZR3A 3IIDA 4GVWA 4ZX9A 5HIHA 4KSIA 1GYTA 4ZX8A 5FSVA 4R76A 5FSYA 4KYBA 3V45A 3KQZA 4ETKA 4ZY1A 1SPVA 3Q6ZA 2LGRA 3JZTA 1BLLE 1BPMA 2ACFA 4D86A 3SIHA 3EW5A 2FAVA 1LAMA 4J5QA 5CBMA 3EWPA 3KZWA 4GVVA 4ABKA 5FSUA 2FXKA 1BPNA 3GPQA 4K0CA 4ABLA 2AFCA 4JVVA 4IQYA 3EKEA 3KR5A 4R7MA 1ZR5A 4J5SA 3EWQA 4GUAA 2EWBA 5D8NA 2EEEA 3GPOA 3VFQA 2BFQA 4ZYQA 3H8EA 3IIFA 3KR4A 2DX6A 5CMSA 4UMLA 4ZI6A 4ZY0A 4K3NA 3Q71A 3SIGA 3KQXA 5FSZA 5DUSA
chains in the Genus database with same CATH superfamily
4R6TA 1LANA 4TU0A 2VRIA 1NJRA 3V2BA 3GQEA 1LCPA 2X47A 4X2TA 5CB5A 5FSXA 4ETJA 1TXZA 3ETIA 3IJ3A 4JCAA 4ZY2A 3SIIA 3EWRA 5HOLA 2BFRA 2L8RA 5AILA 3H8FA 4ESSA 3EJFA 1TY8A 3GQOA 5CB3A 4JGKA 2JZEA 4JLLA 3GPGA 3SIJA 3EJGA 3H8GA 4J4ZA 3PEIA 1YD9A 2FG1A 1LAPA 3EWOA 5E3BA 4J5RA 1HJZA 3T8WA 1VHUA 2XD7A 3JRUA 2J9AA 1ZR3A 3IIDA 4GVWA 4ZX9A 5HIHA 4KSIA 1GYTA 4ZX8A 5FSVA 4R76A 5FSYA 4KYBA 3V45A 3KQZA 4ETKA 4ZY1A 1SPVA 3Q6ZA 2LGRA 3JZTA 1BLLE 1BPMA 2ACFA 4D86A 2JZFA 3SIHA 3EW5A 2FAVA 1LAMA 4J5QA 5CBMA 3EWPA 3KZWA 4GVVA 4ABKA 5FSUA 2FXKA 1BPNA 3GPQA 4K0CA 4ABLA 2AFCA 4JVVA 4IQYA 3EKEA 3KR5A 4R7MA 1ZR5A 4J5SA 3EWQA 4GUAA 2EWBA 5D8NA 2EEEA 2RNKA 3GPOA 3VFQA 2BFQA 4ZYQA 2W2GA 2WCTA 3H8EA 3IIFA 3KR4A 2DX6A 5CMSA 4UMLA 4ZI6A 4ZY0A 2JZDA 4K3NA 2KQVA 3Q71A 3KQXA 3SIGA 5FSZA 5DUSA
chains in the Genus database with same CATH topology
4R6TA 1LANA 4TU0A 2VRIA 1NJRA 3V2BA 3GQEA 1LCPA 2X47A 4X2TA 5CB5A 5FSXA 4ETJA 1TXZA 3ETIA 3IJ3A 4JCAA 4ZY2A 3SIIA 3EWRA 5HOLA 2BFRA 2L8RA 5AILA 3H8FA 4ESSA 3EJFA 1TY8A 3GQOA 5CB3A 4JGKA 4JLLA 3GPGA 3SIJA 3EJGA 3H8GA 4J4ZA 3PEIA 1YD9A 2FG1A 1LAPA 3EWOA 5E3BA 4J5RA 1HJZA 3T8WA 1VHUA 2XD7A 3JRUA 2J9AA 1ZR3A 3IIDA 4GVWA 4ZX9A 5HIHA 4KSIA 1GYTA 4ZX8A 5FSVA 4R76A 5FSYA 4KYBA 3V45A 3KQZA 4ETKA 4ZY1A 1SPVA 3Q6ZA 2LGRA 3JZTA 1BLLE 1BPMA 2ACFA 4D86A 3SIHA 3EW5A 2FAVA 1LAMA 4J5QA 5CBMA 3EWPA 3KZWA 4GVVA 4ABKA 5FSUA 2FXKA 1BPNA 3GPQA 4K0CA 4ABLA 2AFCA 4JVVA 4IQYA 3EKEA 3KR5A 4R7MA 1ZR5A 4J5SA 3EWQA 4GUAA 2EWBA 5D8NA 2EEEA 3GPOA 3VFQA 2BFQA 4ZYQA 3H8EA 3IIFA 3KR4A 2DX6A 5CMSA 4UMLA 4ZI6A 4ZY0A 4K3NA 3Q71A 3SIGA 3KQXA 5FSZA 5DUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6T A;  1LAN A;  4TU0 A;  2VRI A;  1NJR A;  3V2B A;  3GQE A;  1LCP A;  2X47 A;  4X2T A;  5CB5 A;  5FSX A;  4ETJ A;  1TXZ A;  3ETI A;  3IJ3 A;  4JCA A;  4ZY2 A;  3SII A;  3EWR A;  5HOL A;  2BFR A;  2L8R A;  5AIL A;  3H8F A;  4ESS A;  3EJF A;  1TY8 A;  3GQO A;  5CB3 A;  4JGK A;  4JLL A;  3GPG A;  3SIJ A;  3EJG A;  3H8G A;  4J4Z A;  3PEI A;  1YD9 A;  2FG1 A;  1LAP A;  3EWO A;  5E3B A;  4J5R A;  1HJZ A;  3T8W A;  1VHU A;  2XD7 A;  3JRU A;  2J9A A;  1ZR3 A;  3IID A;  4GVW A;  4ZX9 A;  5HIH A;  4KSI A;  1GYT A;  4ZX8 A;  5FSV A;  4R76 A;  5FSY A;  4KYB A;  3V45 A;  3KQZ A;  4ETK A;  4ZY1 A;  1SPV A;  3Q6Z A;  2LGR A;  3JZT A;  1BLL E;  1BPM A;  2ACF A;  4D86 A;  3SIH A;  3EW5 A;  2FAV A;  1LAM A;  4J5Q A;  5CBM A;  3EWP A;  3KZW A;  4GVV A;  4ABK A;  5FSU A;  2FXK A;  1BPN A;  3GPQ A;  4K0C A;  4ABL A;  2AFC A;  4JVV A;  4IQY A;  3EKE A;  3KR5 A;  4R7M A;  1ZR5 A;  4J5S A;  3EWQ A;  4GUA A;  2EWB A;  5D8N A;  2EEE A;  3GPO A;  3VFQ A;  2BFQ A;  4ZYQ A;  3H8E A;  3IIF A;  3KR4 A;  2DX6 A;  5CMS A;  4UML A;  4ZI6 A;  4ZY0 A;  4K3N A;  3Q71 A;  3SIG A;  3KQX A;  5FSZ A;  5DUS A; 
#chains in the Genus database with same CATH topology
 4R6T A;  1LAN A;  4TU0 A;  2VRI A;  1NJR A;  3V2B A;  3GQE A;  1LCP A;  2X47 A;  4X2T A;  5CB5 A;  5FSX A;  4ETJ A;  1TXZ A;  3ETI A;  3IJ3 A;  4JCA A;  4ZY2 A;  3SII A;  3EWR A;  5HOL A;  2BFR A;  2L8R A;  5AIL A;  3H8F A;  4ESS A;  3EJF A;  1TY8 A;  3GQO A;  5CB3 A;  4JGK A;  2JZE A;  4JLL A;  3GPG A;  3SIJ A;  3EJG A;  3H8G A;  4J4Z A;  3PEI A;  1YD9 A;  2FG1 A;  1LAP A;  3EWO A;  5E3B A;  4J5R A;  1HJZ A;  3T8W A;  1VHU A;  2XD7 A;  3JRU A;  2J9A A;  1ZR3 A;  3IID A;  4GVW A;  4ZX9 A;  5HIH A;  4KSI A;  1GYT A;  4ZX8 A;  5FSV A;  4R76 A;  5FSY A;  4KYB A;  3V45 A;  3KQZ A;  4ETK A;  4ZY1 A;  1SPV A;  3Q6Z A;  2LGR A;  3JZT A;  1BLL E;  1BPM A;  2ACF A;  4D86 A;  2JZF A;  3SIH A;  3EW5 A;  2FAV A;  1LAM A;  4J5Q A;  5CBM A;  3EWP A;  3KZW A;  4GVV A;  4ABK A;  5FSU A;  2FXK A;  1BPN A;  3GPQ A;  4K0C A;  4ABL A;  2AFC A;  4JVV A;  4IQY A;  3EKE A;  3KR5 A;  4R7M A;  1ZR5 A;  4J5S A;  3EWQ A;  4GUA A;  2EWB A;  5D8N A;  2EEE A;  2RNK A;  3GPO A;  3VFQ A;  2BFQ A;  4ZYQ A;  2W2G A;  2WCT A;  3H8E A;  3IIF A;  3KR4 A;  2DX6 A;  5CMS A;  4UML A;  4ZI6 A;  4ZY0 A;  2JZD A;  4K3N A;  2KQV A;  3Q71 A;  3KQX A;  3SIG A;  5FSZ A;  5DUS A; 
#chains in the Genus database with same CATH homology
 4R6T A;  1LAN A;  4TU0 A;  2VRI A;  1NJR A;  3V2B A;  3GQE A;  1LCP A;  2X47 A;  4X2T A;  5CB5 A;  5FSX A;  4ETJ A;  1TXZ A;  3ETI A;  3IJ3 A;  4JCA A;  4ZY2 A;  3SII A;  3EWR A;  5HOL A;  2BFR A;  2L8R A;  5AIL A;  3H8F A;  4ESS A;  3EJF A;  1TY8 A;  3GQO A;  5CB3 A;  4JGK A;  4JLL A;  3GPG A;  3SIJ A;  3EJG A;  3H8G A;  4J4Z A;  3PEI A;  1YD9 A;  2FG1 A;  1LAP A;  3EWO A;  5E3B A;  4J5R A;  1HJZ A;  3T8W A;  1VHU A;  2XD7 A;  3JRU A;  2J9A A;  1ZR3 A;  3IID A;  4GVW A;  4ZX9 A;  5HIH A;  4KSI A;  1GYT A;  4ZX8 A;  5FSV A;  4R76 A;  5FSY A;  4KYB A;  3V45 A;  3KQZ A;  4ETK A;  4ZY1 A;  1SPV A;  3Q6Z A;  2LGR A;  3JZT A;  1BLL E;  1BPM A;  2ACF A;  4D86 A;  3SIH A;  3EW5 A;  2FAV A;  1LAM A;  4J5Q A;  5CBM A;  3EWP A;  3KZW A;  4GVV A;  4ABK A;  5FSU A;  2FXK A;  1BPN A;  3GPQ A;  4K0C A;  4ABL A;  2AFC A;  4JVV A;  4IQY A;  3EKE A;  3KR5 A;  4R7M A;  1ZR5 A;  4J5S A;  3EWQ A;  4GUA A;  2EWB A;  5D8N A;  2EEE A;  3GPO A;  3VFQ A;  2BFQ A;  4ZYQ A;  3H8E A;  3IIF A;  3KR4 A;  2DX6 A;  5CMS A;  4UML A;  4ZI6 A;  4ZY0 A;  4K3N A;  3Q71 A;  3SIG A;  3KQX A;  5FSZ A;  5DUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...