4R76A

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
518
structure length
515
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 family aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
total genus 170
structure length 515
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r76A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r76A02
2ZEPA 2BOAA 4OC3A 2PJ8A 3ISZA 2PJ9A 5FSUA 3BI0A 4NGNA 1ARMA 2XEIA 2ZENA 3EWRA 1XFOA 4MCPA 4F9VA 5I4MA 1TKHA 4PXCA 3KHXA 2V8HA 4K3NA 3DLJA 3Q71A 2FAVA 5J1QA 2PJ3A 3NH8A 3TC8A 4UMLA 2CF4A 4O23A 1LCPA 3B35A 4H2KA 1TF8A 4EFDA 1IY7A 3TX8A 5HXDA 3GB0A 1VHUA 3MN8A 4B6ZA 4J4ZA 3EJGA 4JVVA 1Z8LA 3PBEA 3D66A 8CPAA 4NJQA 3WC7A 1SPVA 2ZEMA 3D67A 2FVGA 3VH9A 2ANPA 5FSXA 3LMSA 4FUUA 1CBXA 2BCOA 3IWWA 4P4JA 1RTQA 4MHNA 1QMUA 2CIJA 3BI1A 2RFHA 3NH5A 5LYLA 4NGTA 2V8VA 3SIHA 3PFEA 3FECA 3V45A 4EWTA 2V8DA 3HUVA 1VIXA 5CB3A 4MXUA 2ZEDA 3KR4A 3GPOA 5AILA 3NFZA 3BHXA 4DUKA 4ONWA 1ZG9A 1CPXA 2PJAA 2WZNA 4ETJA 2DEAA 5THWA 5K8MA 1VHOA 7CPAA 1HEEA 2C6PA 2ZOFA 1XRYA 2G9DA 3PEIA 2Q4ZA 2PJ5A 3H8GA 1ELLP 2AFOA 2GLFA 2IMOA 4JLLA 5CBMA 1LOKA 4TU0A 2DX6A 1ZG7A 4UEFA 3K2KA 4ZYQA 5D29A 2NYQA 1H8LA 3KHZA 2OOTA 2O4HA 2JBKA 2XEGA 4JCAA 2QYVA 3KQXA 5F09A 4ETKA 1R43A 1Z5RA 3K9TA 2OR4A 2X47A 1Z2LA 3GUXA 3KASA 4P45A 3EWQA 1AMPA 4P6YA 3T8WA 2BO9A 1YMEA 4CPAA 1ARLA 3VFQA 2PIZA 2V8GA 3CPAA 1LANA 5HVFA 2CTBA 1F2PA 2IQ6A 1CG2A 4GM5A 2PRQA 4OMEA 3PRTA 5FSZA 3D7DA 3RBUA 1LAPA 4IQYA 2PJ0A 2PJCA 3CDXA 2GREA 3CT9A 4MMOA 3WT4A 2V77A 4P4IA 3SI2A 2XD7A 1AYEA 3SJEA 5LYFA 3GPGA 4AXVA 4Z65A 1YD9A 3SJGA 3B3TA 4WWVA 1BPMA 4OC0A 3JRUA 4X3RA 4FAIA 3KQZA 4DYOA 1VGYA 4P4DA 1HDQA 1XMBA 4TNUA 1Y0RA 2ABZA 5HIHA 4MCRA 1LAMA 3D7HA 3KGQA 3S9LA 5LRKA 1YLOA 3DGVA 2PCUA 3FEDA 3RZAA 3EJFA 1YW6A 3KZWA 5D8NA 2QJ8A 3ISXA 4P44A 3IJ3A 5JH9A 2L8RA 2XEFA 2Q51A 4JZ0A 4MHYA 4UF4A 2PJ4A 1HJZA 2NSMA 2JEWA 2O53A 2PJ1A 2WYRA 5JM6A 4P4EA 4UIBA 3FEEA 3PB4X 5K8PA 2HB6A 4MCQA 1CP7A 1TXZA 2AFZA 3EWPA 5FSVA 2AFMA 2JBJA 4JYWA 1KWMA 2ACFA 1NJRA 3D7GA 4G1PA 4A38A 1BAVA 3IEHA 3D7FA 3V7ZA 1TXRA 3GPQA 1DTDA 1CP6A 4ZY2A 3IIDA 4GVVA 3KI9A 4IHMA 2ZELA 4PXBA 3PFOA 2HC9A 5JGFA 2C6CA 3IO1A 4NGPA 2PE3A 2ZEFA 1TF9A 4JGKA 4NFRA 2ZEHA 3H8EA 2BFRA 5K8NA 4PXDA 5DUSA 1VHEA 3PB9X 1ELMP 1DE4C 4LQGA 5HVGA 4R76A 5LRJA 3FJUA 3V2BA 1ZLIA 3WC6A 2J9AA 4NJRA 4PPZA 1FNOA 2PVWA 1OBRA 3RAMA 4X2TA 3B3CA 2VL1A 5K8OA 1LFWA 2PJBA 1M4LA 3IIFA 4UEZA 2AFXA 1ZR3A 4MRIA 4D86A 4R6TA 2GLJA 3PBBA 3PB6X 4MHPA 1FT7A 5LYDA 3D68A 3IIBA 3S9NA 4P10A 3PB8X 1EE3P 2EEEA 2EK9A 2IJZA 4PQAA 2ZEGA 2PIYA 1F2OA 1YSJA 3LWUA 3SI1A 1F57A 3VARA 5ELYA 4ZY1A 3BXMA 1ZG8A 2XEJA 4R7MA 2FXKA 1TKFA 3PB7X 2LGRA 3EW5A 3H8FA 3EKEA 4F8ZA 3SIIA 4GVWA 2GU2A 3WC5A 2ZOGA 1R3NA 4OC1A 5CMSA 3WABA 2AFCA 3JZTA 1IGBA 2VRIA 3KR5A 4IK2A 3B3VA 3ETIA 1PCAA 4OC4A 2ZEOA 4IAVA 4NGQA 2PJ6A 4KYBA 5FSYA 4P4BA 2C1CA 4NGSA 4K0CA 3GQEA 4Q7AA 1CPSA 3FX6A 4YU9A 4F9UA 5CPAA 3FF3A 4DJLA 2PVVA 3HLPA 4A94A 3FMCA 3Q6ZA 1ZR5A 2QVPA 2RB7A 4MCSA 4ZY0A 4NGRA 3N5FA 2EWBA 4UEEA 3B7IA 2F7VA 3B2YA 2CTCA 4EMEA 4RUHA 1XJOA 3SIGA 3EWOA 1JQGA 4FWUA 2ZEEA 2POKA 4J5RA 1Y7EA 1CX8A 3MRUA 4OIWA 4TWEA 4R8FA 3SIJA 4MHZA 4OP4A 1GYTA 4ABKA 5IB9A 3NA6A 4W9YA 3D4UA 4PXEA 4ABLA 4ZX9A 5HOLA 4BD9A 5LYIA 4GUAA 4ESSA 2C6GA 4OIDA 2AFSA 2FG1A 5DS0A 3FH4A 5LRGA 2PJ7A 1QQ9A 1UWYA 1ZLHA 3L2NA 4KSIA 3S9MA 1NSAA 4FBEA 4WJBA 2AFWA 3CPXA 4NGMA 2Q43A 3KL9A 4OKOA 1HDUA 2F8HA 3IFEA 5CB5A 1Y0YA 4A37A 6CPAA 1YW4A 1TKJA 5HVHA 4ZI6A 1Q7LA 3V38A 2BFQA 4J5SA 4P4FA 3B3WA 4UIAA 3VATA 3FVLA 4J5QA 3GLJA 1BPNA 4YWYA 3SJXA 3NH4A 4ZX8A 3IC1A 1PYTB 4A39A 3I1UA 3SJFA 3SI0A 2PJ2A 4OC5A 2I3CA 4OC2A 1TY8A 3B3SA 4X8IA 2AFUA 5E3BA 3GQOA 2EK8A 1XBUA 1BLLE 3QNVA
chains in the Genus database with same CATH superfamily
2FIWA 2ZEPA 2BOAA 4OC3A 2PJ8A 1Q2DA 1JWQA 4PSWA 3ISZA 2PJ9A 4KOXA 3T9YA 5FSUA 2B3VA 5DWNA 2BUEA 3BI0A 1VHSA 1ARMA 2XEIA 2ZENA 4KOVA 4NGNA 2P6EA 3EWRA 4UA3A 1XFOA 4MCPA 4CGPA 4F9VA 5I4MA 4LUAA 1TKHA 2Z10A 4R3LA 2JDDA 4PXCA 3KHXA 2V8HA 4K3NA 3DLJA 2I79A 2I00A 4KUAA 3Q71A 2FAVA 1Y9KA 1M44A 1MJAA 2JDCA 5GCNA 5J1QA 5CNPA 4H6UA 2PJ3A 4JXRA 4L89A 4MBUA 2CY2A 2Z0ZA 3NH8A 3TC8A 4UMLA 2CF4A 4O23A 1LCPA 2D4OA 2O28A 4KOYA 1IOIA 2VQYA 2Z3PA 4IUSA 3B35A 1BO4A 5JPHA 1NMTA 2FE7A 4B10A 4H2KA 1TF8A 4UCNA 4EFDA 5G21A 1IY7A 3TX8A 5HXDA 3GB0A 1MK4A 4JLYA 3FYNA 1VHUA 4B5PA 3OWCA 3P2FA 3MN8A 3SXNA 4B6ZA 4J4ZA 2PDOA 4C2ZA 3TE4A 1QSMA 3EJGA 4JVVA 1Z8LA 2BSWA 3PBEA 4F0YA 3D66A 3GKRA 8CPAA 4NJQA 2ZPAA 1Z9UA 2RC4A 3WC7A 1SPVA 2ZEMA 3R9FA 3D67A 2FVGA 3VH9A 3ZJ0A 4A32A 2ANPA 5EMIA 4HPSA 4M3SA 5FSXA 3LMSA 4FUUA 4JJXA 1CBXA 2BCOA 4KSAA 3IWWA 4P4JA 5I0CA 1RTQA 4C7IA 4MHNA 1QMUA 4J3GA 4AG7A 3FBUA 2CIJA 4YFJA 3BI1A 1YVKA 2RFHA 3NH5A 1WWZA 4NF1A 5LYLA 4NGTA 2V8VA 3SIHA 3PFEA 3FECA 3V45A 1Z8TA 4EWTA 2V8DA 2R7HA 3HUVA 3FB3A 5C82A 1VKCA 2H5MA 1VIXA 5G1ZA 5CB3A 4MXUA 4HKFA 1P4NA 2A4NA 4HNYB 2ZEDA 3KR4A 3GPOA 5AILA 4CRZB 2EO8A 3NFZA 3BHXA 4XPDC 4PV6A 2PRBA 4DUKA 4ONWA 1ZG9A 1CJWA 1CPXA 2JZEA 2G3AA 5IX3A 2PJAA 2WZNA 4ETJA 1XEBA 4MFJA 4YGOA 2DEAA 5THWA 5K8MA 1VHOA 7CPAA 1HEEA 2C6PA 3S6KA 2DPTA 4JXQA 2ZOFA 1XRYA 2FL4A 2G9DA 4MY3A 4NSQA 5AGEA 2G3TA 3PEIA 2Q4ZA 2Q7SA 3IWEA 1LRZA 3FNCA 2PJ5A 3H8GA 1ELLP 2AFOA 2GLFA 2IMOA 3C26A 2Q04A 4JLLA 5CBMA 2C27A 4AVBA 5KTAA 1LOKA 4TU0A 3EC4A 1IU8A 2DX6A 1ZG7A 4UEFA 2B4DB 3K2KA 2FT0A 5F47A 4ZYQA 2CXAA 4KS9A 4L8AA 4QC6A 5D29A 2DPSA 1H8LA 2NYQA 3KHZA 3T90A 2OOTA 4RN7A 2O4HA 5DWMA 2JBKA 2PR8A 2XEGA 4KVXA 4JCAA 2QYVA 3KQXA 3BJ8A 5F09A 4ETKA 2VI7A 1R43A 2OB0A 1IICA 5F46A 1Z5RA 2YNDA 1RXTA 3K9TA 5F48A 1N71A 2OR4A 3R1KA 3P2HA 2X47A 1Z2LA 4B11A 2WPWA 3FRMA 3GUXA 2ARHA 3KASA 4P45A 4E8OA 3EWQA 3H4QA 1AMPA 3QAYA 4B5PB 4P6YA 3T8WA 3CXSA 5F49A 2VZZA 1S3ZA 2DXQA 2BO9A 1YMEA 3FIXA 4CPAA 1ARLA 1J4JA 4X5KA 3VFQA 2PIZA 2V8GA 3D2PA 1V0CA 3W6SA 5A27A 3VWDA 2EUIA 3CPAA 4NXYA 3QAHA 2OZUA 1LANA 4OLLA 2QMLA 2J8RA 2Q4YA 2CTBA 1F2PA 1A2ZA 1CG2A 1KUXA 2IQ6A 2PRQA 3EFAA 4GM5A 3PRTA 4OMEA 4XPLA 2Q7BA 5FSZA 3D7DA 4CYNA 2DF5A 3RBUA 1LAPA 2YNCA 4IQYA 2GFQA 2JLMA 3SHPA 2PJ0A 5A28A 4II9A 4B5OA 1S7NA 3SXOA 5JH9A 2PJCA 4FD4A 4B12A 1L0CA 3CDXA 2GREA 4CAWA 2VBQA 1YLEA 3CT9A 4MMOA 3WT4A 2V77A 2HUZA 1S7KA 4P4IA 4KOSA 3K9UA 2XD7A 1AYEA 4MFZA 3SI2A 3GPGA 3PP9A 3SJEA 4AXVA 5LYFA 4Z65A 2RNKA 1BOBA 1S7FA 3LODA 1YD9A 3SJGA 5BWAB 2Q4VA 3B3TA 4H89A 4Y49B 4WWVA 1BPMA 4OC0A 3JRUA 1K4JA 2PR1A 4PSXA 4X3RA 4FAIA 3KQZA 1QSTA 4DYOA 1VGYA 4JD6A 4A95A 4CGMA 4P4DA 1HDQA 4FD7A 1MJBA 1XMBA 4UFWA 1M4DA 3E0KA 1Y0RA 2ABZA 2QIRA 3EY5A 5HIHA 4KVOE 4TNUA 1XIXA 4MCRA 4UWJA 2QECA 3RYOA 2R1IA 3TOAA 1S7LA 1TIQA 1U6MA 1LAMA 3D7HA 3KGQA 4YRHA 3S9LA 5LRKA 1X10A 1YLOA 1YR0A 2PQ8A 2PCUA 3DGVA 3FEDA 3EJFA 3RZAA 4QBJA 2B4BA 4RS2A 2FCKA 4A33A 1YW6A 4UBRA 5JQ4A 3KZWA 5J8FA 5D8NA 2QJ8A 5H84A 1CM0A 3ISXA 4P44A 3IJ3A 2B58A 4DNCA 2L8RA 2XEFA 2Q51A 1KZFA 4JZ0A 4MHYA 4U9ZA 4UF4A 2PJ4A 1HJZA 2NSMA 2JEWA 2O53A 2PJ1A 5HMNA 1ON0A 2WYRA 2ZW6A 4P4EA 4UCPA 4UIBA 3FEEA 5JM6A 1NSLA 3PB4X 4JWPA 5K8PA 2KQVA 4A2ZA 2HB6A 1OZPA 4IF5A 1CP7A 4MCQA 3NE8A 1TXZA 2AFZA 4CAVA 3PZJA 2Z11A 2W2GA 2ODFA 4CYPA 3EWPA 5FSVA 5E96A 2AFMA 2JBJA 1Q2YA 4JYWA 1KWMA 2ACFA 1NJRA 3D7GA 4G1PA 4C2XA 4A38A 1BAVA 3GY9A 3IEHA 3D7FA 3H5ZA 4MY0A 3V7ZA 2J8NA 1TXRA 3GPQA 1DTDA 4UFXA 1CP6A 4ZY2A 2REFA 3IIDA 3TO7A 4GVVA 3CZXA 2YNEA 2Q0YA 3KI9A 2ZELA 4IHMA 4PXBA 3PFOA 2HC9A 2Z3LA 2ZW7A 5JGFA 2C6CA 2YGWA 3IO1A 2R8VA 4NGPA 2PE3A 2ZEFA 1TF9A 3FXTA 4JGKA 1XOVA 1Z8XA 4NFRA 2ZEHA 3H8EA 2PC1A 3JTKA 2BFRA 3S6HA 5K8NA 4PXDA 5DUSA 1VHEA 4ORFA 1IIDA 3PB9X 1ELMP 1DE4C 4LQGA 5HVGA 4R76A 2VZYA 4M85A 5LRJA 4CAEA 1XE4A 3FJUA 3UY5A 4GS4A 1KUVA 3V2BA 1ZLIA 3F5BA 2J9AA 4NEXA 5AG6A 3WC6A 4NJRA 3EO4A 4PPZA 1FNOA 2PVWA 5J8CA 1OBRA 4KORA 2FIAA 3RAMA 2WCTA 4X2TA 1XF8A 2VL1A 3B3CA 5K8OA 1LFWA 2PJBA 1M4LA 2OZGA 3TFYA 3IIFA 2Z3NA 4UEZA 2ZXVA 4UFVA 2AFXA 1ZR3A 3JVNA 4MRIA 5AG7A 4D86A 2ATRA 4E2AA 1ZO0A 4R6TA 4NCZA 5AG5A 2GLJA 4MFKA 3PBBA 5C88A 3PB6X 4XNHC 4MHPA 1FT7A 2CNSA 5LYDA 3BLNA 3D68A 3IIBA 3S9NA 4P10A 2WUUA 1Z4EA 3IU1A 3PB8X 5HVFA 1EE3P 2EEEA 2EK9A 1YGHA 2IJZA 4KOTA 4PQAA 2ZEGA 4XNHB 2D4PA 2NMTA 2X7BA 3F8KA 4K30A 2PIYA 5IB0A 1F2OA 2FSRA 4R87A 1YSJA 4OAEA 3LD2A 3R9GA 1PUAA 3LWUA 2P6FA 4MI4A 3SI1A 1F57A 3VARA 5ELYA 4ZY1A 3BXMA 1ZG8A 4ZBGA 2XEJA 2FXFA 4R7MA 4MFQA 3RNZA 2FXKA 1MJ9A 1TKFA 3TO6A 3PB7X 2LGRA 3EW5A 1B87A 3H8FA 3BJ7A 3EKEA 3CXPA 5EBVA 4F8ZA 3SIIA 4GVWA 2GU2A 3WC5A 2G0BA 2ZOGA 1R3NA 4OC1A 4B14A 3VWEA 4CGLA 3CXQA 5ISVA 5CMSA 2J8MA 3WABA 3A9LA 1IB1E 2AFCA 3JZTA 2VXKA 2GANA 1IGBA 2ZW5A 4KUBA 3D3SA 3NE7A 4PK2A 3TCVA 5IV0A 2VRIA 4H6ZA 3KR5A 4IK2A 1B6BA 4Y49C 3B3VA 3I3GA 3ETIA 1PCAA 4OC4A 4ZGYB 1PU9A 2ZEOA 4CGNA 4IAVA 1KUYA 4NGQA 2P0WA 4R9MA 2PJ6A 4U9YA 4KYBA 5FSYA 1M1DA 3IWGA 4KLWA 4P4BA 2C1CA 4NGSA 4MFLA 4K0CA 3GQEA 2P6GA 4Q7AA 1Z4RA 1CPSA 2B4DA 3FX6A 2JEVA 2KCWA 4YU9A 4F9UA 3EXNA 3FF3A 5CPAA 4DJLA 1GHEA 2PVVA 1RO5A 3HLPA 3G3SA 4C2YA 3TO9A 2Y0MA 2Q44A 5AG4A 4F0XA 4A94A 3FMCA 2WSAA 3QB8A 4M6HA 4KOWA 3Q6ZA 2IL4A 4MHDA 1QSNA 3RO0A 1ZR5A 2OZHA 2QVPA 2RB7A 3G8WA 4ZY0A 4MCSA 4NGRA 1R57A 5FVJA 4B13A 4BBHA 3I9SA 3N5FA 2EWBA 4KLVA 3B7IA 1M4GA 4HNXB 4LX9A 4UEEA 4CYOA 2F7VA 1P0HA 2K5TA 2GE3A 3IU2A 1QSOA 2CTCA 3B2YA 4EMEA 3IGRA 1XJOA 4HNWB 4RUHA 4F6AA 4A30A 3SIGA 3EWOA 3DSBA 1JQGA 4FWUA 2ZEEA 4KOUA 5KTDA 2OU2A 4QVTA 3N7ZA 2POKA 3R9EA 3V8IA 1YK3A 2GIVA 2B5GA 4J5RA 1Y7EA 1XMTA 3WR7A 3TTHA 4U5YA 1CX8A 3MRUA 3DR8A 1X12A 4OIWA 4QUSA 1I21A 4TWEA 4BMHA 4R8FA 1SQHA 1Z8WA 1YQEA 3R96A 3SIJA 4MFPA 5KTCA 1YX0A 4MHZA 4OP4A 1GYTA 2EVNA 4ABKA 5G22A 5IB9A 2WPXA 3NA6A 4W9YA 3GIUA 3D4UA 4PXEA 4RI1A 3TOBA 4ABLA 4ZX9A 5HOLA 4BD9A 5LYIA 4GUAA 2BEIA 1IYLA 2YNCC 2ZW4A 2B3UA 4ESSA 4ONUA 3TT2A 4AVCA 2C6GA 4E0AA 2Z3KA 1I12A 4OIDA 3PGPA 4GXHA 2AFSA 2FG1A 5DS0A 1AUGA 2PSWA 3B8GA 4KVME 3S6GA 1UFHA 2VEZA 3D2MA 3FH4A 2AJ6A 3DR6A 5LRGA 2PJ7A 1I1DA 2BL1A 4CAXA 1QQ9A 1UWYA 1ZLHA 2OH1A 2Z3OA 4KSIA 3L2NA 4M6IA 4AG9A 4FD6A 5H86A 4XPDB 3S9MA 3DDDA 4XPKA 3KKWA 1NSAA 2CNMA 4FBEA 3LACA 4LQ6A 4WJBA 5HH1A 4AVAA 2AFWA 3CPXA 4NGMA 3GYAA 2Q43A 3F0AA 1NE9A 3KL9A 4MJ8A 4OADA 4OKOA 1HDUA 2F8HA 3IFEA 4KZTA 4KSFA 5CB5A 4C7HA 1WK4A 4CGOA 1Y0YA 4A37A 6CPAA 4CYQA 1YVOA 1YW4A 2FS5A 1TKJA 1M4IA 5HVHA 4C68A 2CNTA 4ZI6A 1Q7LA 4I49A 3V38A 1IOFA 2BFQA 4Q36A 4J5SA 2R98A 3W91A 1YREA 3ZZIA 4CRYB 4Q38A 4CS0B 4M6GA 4PK3A 4P4FA 4CAFA 3B3WA 4BINA 4QB9A 4UIAA 3VATA 4A31A 3JUWA 3FVLA 4J5QA 3GLJA 4R57A 2Z3MA 1BPNA 2HV2A 5G20A 4YWYA 2JZFA 3SJXA 2HQYA 3NH4A 4ZX8A 3IC1A 1PYTB 4A39A 3W6XA 3I1UA 3SJFA 3SI0A 1Q2CA 4UWIA 2PJ2A 2F5IA 4OC5A 2I3CA 1Y7RA 1Y9WA 1QSRA 4OC2A 3R95A 1IYKA 3S6FA 2B5GB 3MGDA 2EBJA 4UCMA 5EC4A 1S5KA 1TY8A 1FY7A 4FD5A 2REEA 3B3SA 4EVYA 4X8IA 2JZDA 1S60A 5E3BA 2AFUA 3GQOA 2EK8A 3D8PA 4R3KA 3DNSA 1XBUA 2AE6A 1BLLE 4AB7A 3QNVA
chains in the Genus database with same CATH topology
2ZEPA 2BOAA 4OC3A 2PJ8A 3ISZA 2PJ9A 5FSUA 3BI0A 4NGNA 1ARMA 2XEIA 2ZENA 3EWRA 1XFOA 4MCPA 4F9VA 5I4MA 1TKHA 4PXCA 3KHXA 2V8HA 4K3NA 3DLJA 3Q71A 2FAVA 5J1QA 2PJ3A 3NH8A 3TC8A 4UMLA 2CF4A 4O23A 1LCPA 3B35A 4H2KA 1TF8A 4EFDA 1IY7A 3TX8A 5HXDA 3GB0A 1VHUA 3MN8A 4B6ZA 4J4ZA 3EJGA 4JVVA 1Z8LA 3PBEA 3D66A 8CPAA 4NJQA 3WC7A 1SPVA 2ZEMA 3D67A 2FVGA 3VH9A 2ANPA 5FSXA 3LMSA 4FUUA 1CBXA 2BCOA 3IWWA 4P4JA 1RTQA 4MHNA 1QMUA 2CIJA 3BI1A 2RFHA 3NH5A 5LYLA 4NGTA 2V8VA 3SIHA 3PFEA 3FECA 3V45A 4EWTA 2V8DA 3HUVA 1VIXA 5CB3A 4MXUA 2ZEDA 3KR4A 3GPOA 5AILA 3NFZA 3BHXA 4DUKA 4ONWA 1ZG9A 1CPXA 2PJAA 2WZNA 4ETJA 2DEAA 5THWA 5K8MA 1VHOA 7CPAA 1HEEA 2C6PA 2ZOFA 1XRYA 2G9DA 3PEIA 2Q4ZA 2PJ5A 3H8GA 1ELLP 2AFOA 2GLFA 2IMOA 4JLLA 5CBMA 1LOKA 4TU0A 2DX6A 1ZG7A 4UEFA 3K2KA 4ZYQA 5D29A 2NYQA 1H8LA 3KHZA 2OOTA 2O4HA 2JBKA 2XEGA 4JCAA 2QYVA 3KQXA 5F09A 4ETKA 1R43A 1Z5RA 3K9TA 2OR4A 2X47A 1Z2LA 3GUXA 3KASA 4P45A 3EWQA 1AMPA 4P6YA 3T8WA 2BO9A 1YMEA 4CPAA 1ARLA 3VFQA 2PIZA 2V8GA 3CPAA 1LANA 5HVFA 2CTBA 1F2PA 2IQ6A 1CG2A 4GM5A 2PRQA 4OMEA 3PRTA 5FSZA 3D7DA 3RBUA 1LAPA 4IQYA 2PJ0A 2PJCA 3CDXA 2GREA 3CT9A 4MMOA 3WT4A 2V77A 4P4IA 3SI2A 2XD7A 1AYEA 3SJEA 5LYFA 3GPGA 4AXVA 4Z65A 1YD9A 3SJGA 3B3TA 4WWVA 1BPMA 4OC0A 3JRUA 4X3RA 4FAIA 3KQZA 4DYOA 1VGYA 4P4DA 1HDQA 1XMBA 4TNUA 1Y0RA 2ABZA 5HIHA 4MCRA 1LAMA 3D7HA 3KGQA 3S9LA 5LRKA 1YLOA 3DGVA 2PCUA 3FEDA 3RZAA 3EJFA 1YW6A 3KZWA 5D8NA 2QJ8A 3ISXA 4P44A 3IJ3A 5JH9A 2L8RA 2XEFA 2Q51A 4JZ0A 4MHYA 4UF4A 2PJ4A 1HJZA 2NSMA 2JEWA 2O53A 2PJ1A 2WYRA 5JM6A 4P4EA 4UIBA 3FEEA 3PB4X 5K8PA 2HB6A 4MCQA 1CP7A 1TXZA 2AFZA 3EWPA 5FSVA 2AFMA 2JBJA 4JYWA 1KWMA 2ACFA 1NJRA 3D7GA 4G1PA 4A38A 1BAVA 3IEHA 3D7FA 3V7ZA 1TXRA 3GPQA 1DTDA 1CP6A 4ZY2A 3IIDA 4GVVA 3KI9A 4IHMA 2ZELA 4PXBA 3PFOA 2HC9A 5JGFA 2C6CA 3IO1A 4NGPA 2PE3A 2ZEFA 1TF9A 4JGKA 4NFRA 2ZEHA 3H8EA 2BFRA 5K8NA 4PXDA 5DUSA 1VHEA 3PB9X 1ELMP 1DE4C 4LQGA 5HVGA 4R76A 5LRJA 3FJUA 3V2BA 1ZLIA 3WC6A 2J9AA 4NJRA 4PPZA 1FNOA 2PVWA 1OBRA 3RAMA 4X2TA 3B3CA 2VL1A 5K8OA 1LFWA 2PJBA 1M4LA 3IIFA 4UEZA 2AFXA 1ZR3A 4MRIA 4D86A 4R6TA 2GLJA 3PBBA 3PB6X 4MHPA 1FT7A 5LYDA 3D68A 3IIBA 3S9NA 4P10A 3PB8X 1EE3P 2EEEA 2EK9A 2IJZA 4PQAA 2ZEGA 2PIYA 1F2OA 1YSJA 3LWUA 3SI1A 1F57A 3VARA 5ELYA 4ZY1A 3BXMA 1ZG8A 2XEJA 4R7MA 2FXKA 1TKFA 3PB7X 2LGRA 3EW5A 3H8FA 3EKEA 4F8ZA 3SIIA 4GVWA 2GU2A 3WC5A 2ZOGA 1R3NA 4OC1A 5CMSA 3WABA 2AFCA 3JZTA 1IGBA 2VRIA 3KR5A 4IK2A 3B3VA 3ETIA 1PCAA 4OC4A 2ZEOA 4IAVA 4NGQA 2PJ6A 4KYBA 5FSYA 4P4BA 2C1CA 4NGSA 4K0CA 3GQEA 4Q7AA 1CPSA 3FX6A 4YU9A 4F9UA 5CPAA 3FF3A 4DJLA 2PVVA 3HLPA 4A94A 3FMCA 3Q6ZA 1ZR5A 2QVPA 2RB7A 4MCSA 4ZY0A 4NGRA 3N5FA 2EWBA 4UEEA 3B7IA 2F7VA 3B2YA 2CTCA 4EMEA 4RUHA 1XJOA 3SIGA 3EWOA 1JQGA 4FWUA 2ZEEA 2POKA 4J5RA 1Y7EA 1CX8A 3MRUA 4OIWA 4TWEA 4R8FA 3SIJA 4MHZA 4OP4A 1GYTA 4ABKA 5IB9A 3NA6A 4W9YA 3D4UA 4PXEA 4ABLA 4ZX9A 5HOLA 4BD9A 5LYIA 4GUAA 4ESSA 2C6GA 4OIDA 2AFSA 2FG1A 5DS0A 3FH4A 5LRGA 2PJ7A 1QQ9A 1UWYA 1ZLHA 3L2NA 4KSIA 3S9MA 1NSAA 4FBEA 4WJBA 2AFWA 3CPXA 4NGMA 2Q43A 3KL9A 4OKOA 1HDUA 2F8HA 3IFEA 5CB5A 1Y0YA 4A37A 6CPAA 1YW4A 1TKJA 5HVHA 4ZI6A 1Q7LA 3V38A 2BFQA 4J5SA 4P4FA 3B3WA 4UIAA 3VATA 3FVLA 4J5QA 3GLJA 1BPNA 4YWYA 3SJXA 3NH4A 4ZX8A 3IC1A 1PYTB 4A39A 3I1UA 3SJFA 3SI0A 2PJ2A 4OC5A 2I3CA 4OC2A 1TY8A 3B3SA 4X8IA 2AFUA 5E3BA 3GQOA 2EK8A 1XBUA 1BLLE 3QNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEP A;  2BOA A;  4OC3 A;  2PJ8 A;  3ISZ A;  2PJ9 A;  5FSU A;  3BI0 A;  4NGN A;  1ARM A;  2XEI A;  2ZEN A;  3EWR A;  1XFO A;  4MCP A;  4F9V A;  5I4M A;  1TKH A;  4PXC A;  3KHX A;  2V8H A;  4K3N A;  3DLJ A;  3Q71 A;  2FAV A;  5J1Q A;  2PJ3 A;  3NH8 A;  3TC8 A;  4UML A;  2CF4 A;  4O23 A;  1LCP A;  3B35 A;  4H2K A;  1TF8 A;  4EFD A;  1IY7 A;  3TX8 A;  5HXD A;  3GB0 A;  1VHU A;  3MN8 A;  4B6Z A;  4J4Z A;  3EJG A;  4JVV A;  1Z8L A;  3PBE A;  3D66 A;  8CPA A;  4NJQ A;  3WC7 A;  1SPV A;  2ZEM A;  3D67 A;  2FVG A;  3VH9 A;  2ANP A;  5FSX A;  3LMS A;  4FUU A;  1CBX A;  2BCO A;  3IWW A;  4P4J A;  1RTQ A;  4MHN A;  1QMU A;  2CIJ A;  3BI1 A;  2RFH A;  3NH5 A;  5LYL A;  4NGT A;  2V8V A;  3SIH A;  3PFE A;  3FEC A;  3V45 A;  4EWT A;  2V8D A;  3HUV A;  1VIX A;  5CB3 A;  4MXU A;  2ZED A;  3KR4 A;  3GPO A;  5AIL A;  3NFZ A;  3BHX A;  4DUK A;  4ONW A;  1ZG9 A;  1CPX A;  2PJA A;  2WZN A;  4ETJ A;  2DEA A;  5THW A;  5K8M A;  1VHO A;  7CPA A;  1HEE A;  2C6P A;  2ZOF A;  1XRY A;  2G9D A;  3PEI A;  2Q4Z A;  2PJ5 A;  3H8G A;  1ELL P;  2AFO A;  2GLF A;  2IMO A;  4JLL A;  5CBM A;  1LOK A;  4TU0 A;  2DX6 A;  1ZG7 A;  4UEF A;  3K2K A;  4ZYQ A;  5D29 A;  2NYQ A;  1H8L A;  3KHZ A;  2OOT A;  2O4H A;  2JBK A;  2XEG A;  4JCA A;  2QYV A;  3KQX A;  5F09 A;  4ETK A;  1R43 A;  1Z5R A;  3K9T A;  2OR4 A;  2X47 A;  1Z2L A;  3GUX A;  3KAS A;  4P45 A;  3EWQ A;  1AMP A;  4P6Y A;  3T8W A;  2BO9 A;  1YME A;  4CPA A;  1ARL A;  3VFQ A;  2PIZ A;  2V8G A;  3CPA A;  1LAN A;  5HVF A;  2CTB A;  1F2P A;  2IQ6 A;  1CG2 A;  4GM5 A;  2PRQ A;  4OME A;  3PRT A;  5FSZ A;  3D7D A;  3RBU A;  1LAP A;  4IQY A;  2PJ0 A;  2PJC A;  3CDX A;  2GRE A;  3CT9 A;  4MMO A;  3WT4 A;  2V77 A;  4P4I A;  3SI2 A;  2XD7 A;  1AYE A;  3SJE A;  5LYF A;  3GPG A;  4AXV A;  4Z65 A;  1YD9 A;  3SJG A;  3B3T A;  4WWV A;  1BPM A;  4OC0 A;  3JRU A;  4X3R A;  4FAI A;  3KQZ A;  4DYO A;  1VGY A;  4P4D A;  1HDQ A;  1XMB A;  4TNU A;  1Y0R A;  2ABZ A;  5HIH A;  4MCR A;  1LAM A;  3D7H A;  3KGQ A;  3S9L A;  5LRK A;  1YLO A;  3DGV A;  2PCU A;  3FED A;  3RZA A;  3EJF A;  1YW6 A;  3KZW A;  5D8N A;  2QJ8 A;  3ISX A;  4P44 A;  3IJ3 A;  5JH9 A;  2L8R A;  2XEF A;  2Q51 A;  4JZ0 A;  4MHY A;  4UF4 A;  2PJ4 A;  1HJZ A;  2NSM A;  2JEW A;  2O53 A;  2PJ1 A;  2WYR A;  5JM6 A;  4P4E A;  4UIB A;  3FEE A;  3PB4 X;  5K8P A;  2HB6 A;  4MCQ A;  1CP7 A;  1TXZ A;  2AFZ A;  3EWP A;  5FSV A;  2AFM A;  2JBJ A;  4JYW A;  1KWM A;  2ACF A;  1NJR A;  3D7G A;  4G1P A;  4A38 A;  1BAV A;  3IEH A;  3D7F A;  3V7Z A;  1TXR A;  3GPQ A;  1DTD A;  1CP6 A;  4ZY2 A;  3IID A;  4GVV A;  3KI9 A;  4IHM A;  2ZEL A;  4PXB A;  3PFO A;  2HC9 A;  5JGF A;  2C6C A;  3IO1 A;  4NGP A;  2PE3 A;  2ZEF A;  1TF9 A;  4JGK A;  4NFR A;  2ZEH A;  3H8E A;  2BFR A;  5K8N A;  4PXD A;  5DUS A;  1VHE A;  3PB9 X;  1ELM P;  1DE4 C;  4LQG A;  5HVG A;  4R76 A;  5LRJ A;  3FJU A;  3V2B A;  1ZLI A;  3WC6 A;  2J9A A;  4NJR A;  4PPZ A;  1FNO A;  2PVW A;  1OBR A;  3RAM A;  4X2T A;  3B3C A;  2VL1 A;  5K8O A;  1LFW A;  2PJB A;  1M4L A;  3IIF A;  4UEZ A;  2AFX A;  1ZR3 A;  4MRI A;  4D86 A;  4R6T A;  2GLJ A;  3PBB A;  3PB6 X;  4MHP A;  1FT7 A;  5LYD A;  3D68 A;  3IIB A;  3S9N A;  4P10 A;  3PB8 X;  1EE3 P;  2EEE A;  2EK9 A;  2IJZ A;  4PQA A;  2ZEG A;  2PIY A;  1F2O A;  1YSJ A;  3LWU A;  3SI1 A;  1F57 A;  3VAR A;  5ELY A;  4ZY1 A;  3BXM A;  1ZG8 A;  2XEJ A;  4R7M A;  2FXK A;  1TKF A;  3PB7 X;  2LGR A;  3EW5 A;  3H8F A;  3EKE A;  4F8Z A;  3SII A;  4GVW A;  2GU2 A;  3WC5 A;  2ZOG A;  1R3N A;  4OC1 A;  5CMS A;  3WAB A;  2AFC A;  3JZT A;  1IGB A;  2VRI A;  3KR5 A;  4IK2 A;  3B3V A;  3ETI A;  1PCA A;  4OC4 A;  2ZEO A;  4IAV A;  4NGQ A;  2PJ6 A;  4KYB A;  5FSY A;  4P4B A;  2C1C A;  4NGS A;  4K0C A;  3GQE A;  4Q7A A;  1CPS A;  3FX6 A;  4YU9 A;  4F9U A;  5CPA A;  3FF3 A;  4DJL A;  2PVV A;  3HLP A;  4A94 A;  3FMC A;  3Q6Z A;  1ZR5 A;  2QVP A;  2RB7 A;  4MCS A;  4ZY0 A;  4NGR A;  3N5F A;  2EWB A;  4UEE A;  3B7I A;  2F7V A;  3B2Y A;  2CTC A;  4EME A;  4RUH A;  1XJO A;  3SIG A;  3EWO A;  1JQG A;  4FWU A;  2ZEE A;  2POK A;  4J5R A;  1Y7E A;  1CX8 A;  3MRU A;  4OIW A;  4TWE A;  4R8F A;  3SIJ A;  4MHZ A;  4OP4 A;  1GYT A;  4ABK A;  5IB9 A;  3NA6 A;  4W9Y A;  3D4U A;  4PXE A;  4ABL A;  4ZX9 A;  5HOL A;  4BD9 A;  5LYI A;  4GUA A;  4ESS A;  2C6G A;  4OID A;  2AFS A;  2FG1 A;  5DS0 A;  3FH4 A;  5LRG A;  2PJ7 A;  1QQ9 A;  1UWY A;  1ZLH A;  3L2N A;  4KSI A;  3S9M A;  1NSA A;  4FBE A;  4WJB A;  2AFW A;  3CPX A;  4NGM A;  2Q43 A;  3KL9 A;  4OKO A;  1HDU A;  2F8H A;  3IFE A;  5CB5 A;  1Y0Y A;  4A37 A;  6CPA A;  1YW4 A;  1TKJ A;  5HVH A;  4ZI6 A;  1Q7L A;  3V38 A;  2BFQ A;  4J5S A;  4P4F A;  3B3W A;  4UIA A;  3VAT A;  3FVL A;  4J5Q A;  3GLJ A;  1BPN A;  4YWY A;  3SJX A;  3NH4 A;  4ZX8 A;  3IC1 A;  1PYT B;  4A39 A;  3I1U A;  3SJF A;  3SI0 A;  2PJ2 A;  4OC5 A;  2I3C A;  4OC2 A;  1TY8 A;  3B3S A;  4X8I A;  2AFU A;  5E3B A;  3GQO A;  2EK8 A;  1XBU A;  1BLL E;  3QNV A; 
#chains in the Genus database with same CATH topology
 2FIW A;  2ZEP A;  2BOA A;  4OC3 A;  2PJ8 A;  1Q2D A;  1JWQ A;  4PSW A;  3ISZ A;  2PJ9 A;  4KOX A;  3T9Y A;  5FSU A;  2B3V A;  5DWN A;  2BUE A;  3BI0 A;  1VHS A;  1ARM A;  2XEI A;  2ZEN A;  4KOV A;  4NGN A;  2P6E A;  3EWR A;  4UA3 A;  1XFO A;  4MCP A;  4CGP A;  4F9V A;  5I4M A;  4LUA A;  1TKH A;  2Z10 A;  4R3L A;  2JDD A;  4PXC A;  3KHX A;  2V8H A;  4K3N A;  3DLJ A;  2I79 A;  2I00 A;  4KUA A;  3Q71 A;  2FAV A;  1Y9K A;  1M44 A;  1MJA A;  2JDC A;  5GCN A;  5J1Q A;  5CNP A;  4H6U A;  2PJ3 A;  4JXR A;  4L89 A;  4MBU A;  2CY2 A;  2Z0Z A;  3NH8 A;  3TC8 A;  4UML A;  2CF4 A;  4O23 A;  1LCP A;  2D4O A;  2O28 A;  4KOY A;  1IOI A;  2VQY A;  2Z3P A;  4IUS A;  3B35 A;  1BO4 A;  5JPH A;  1NMT A;  2FE7 A;  4B10 A;  4H2K A;  1TF8 A;  4UCN A;  4EFD A;  5G21 A;  1IY7 A;  3TX8 A;  5HXD A;  3GB0 A;  1MK4 A;  4JLY A;  3FYN A;  1VHU A;  4B5P A;  3OWC A;  3P2F A;  3MN8 A;  3SXN A;  4B6Z A;  4J4Z A;  2PDO A;  4C2Z A;  3TE4 A;  1QSM A;  3EJG A;  4JVV A;  1Z8L A;  2BSW A;  3PBE A;  4F0Y A;  3D66 A;  3GKR A;  8CPA A;  4NJQ A;  2ZPA A;  1Z9U A;  2RC4 A;  3WC7 A;  1SPV A;  2ZEM A;  3R9F A;  3D67 A;  2FVG A;  3VH9 A;  3ZJ0 A;  4A32 A;  2ANP A;  5EMI A;  4HPS A;  4M3S A;  5FSX A;  3LMS A;  4FUU A;  4JJX A;  1CBX A;  2BCO A;  4KSA A;  3IWW A;  4P4J A;  5I0C A;  1RTQ A;  4C7I A;  4MHN A;  1QMU A;  4J3G A;  4AG7 A;  3FBU A;  2CIJ A;  4YFJ A;  3BI1 A;  1YVK A;  2RFH A;  3NH5 A;  1WWZ A;  4NF1 A;  5LYL A;  4NGT A;  2V8V A;  3SIH A;  3PFE A;  3FEC A;  3V45 A;  1Z8T A;  4EWT A;  2V8D A;  2R7H A;  3HUV A;  3FB3 A;  5C82 A;  1VKC A;  2H5M A;  1VIX A;  5G1Z A;  5CB3 A;  4MXU A;  4HKF A;  1P4N A;  2A4N A;  4HNY B;  2ZED A;  3KR4 A;  3GPO A;  5AIL A;  4CRZ B;  2EO8 A;  3NFZ A;  3BHX A;  4XPD C;  4PV6 A;  2PRB A;  4DUK A;  4ONW A;  1ZG9 A;  1CJW A;  1CPX A;  2JZE A;  2G3A A;  5IX3 A;  2PJA A;  2WZN A;  4ETJ A;  1XEB A;  4MFJ A;  4YGO A;  2DEA A;  5THW A;  5K8M A;  1VHO A;  7CPA A;  1HEE A;  2C6P A;  3S6K A;  2DPT A;  4JXQ A;  2ZOF A;  1XRY A;  2FL4 A;  2G9D A;  4MY3 A;  4NSQ A;  5AGE A;  2G3T A;  3PEI A;  2Q4Z A;  2Q7S A;  3IWE A;  1LRZ A;  3FNC A;  2PJ5 A;  3H8G A;  1ELL P;  2AFO A;  2GLF A;  2IMO A;  3C26 A;  2Q04 A;  4JLL A;  5CBM A;  2C27 A;  4AVB A;  5KTA A;  1LOK A;  4TU0 A;  3EC4 A;  1IU8 A;  2DX6 A;  1ZG7 A;  4UEF A;  2B4D B;  3K2K A;  2FT0 A;  5F47 A;  4ZYQ A;  2CXA A;  4KS9 A;  4L8A A;  4QC6 A;  5D29 A;  2DPS A;  1H8L A;  2NYQ A;  3KHZ A;  3T90 A;  2OOT A;  4RN7 A;  2O4H A;  5DWM A;  2JBK A;  2PR8 A;  2XEG A;  4KVX A;  4JCA A;  2QYV A;  3KQX A;  3BJ8 A;  5F09 A;  4ETK A;  2VI7 A;  1R43 A;  2OB0 A;  1IIC A;  5F46 A;  1Z5R A;  2YND A;  1RXT A;  3K9T A;  5F48 A;  1N71 A;  2OR4 A;  3R1K A;  3P2H A;  2X47 A;  1Z2L A;  4B11 A;  2WPW A;  3FRM A;  3GUX A;  2ARH A;  3KAS A;  4P45 A;  4E8O A;  3EWQ A;  3H4Q A;  1AMP A;  3QAY A;  4B5P B;  4P6Y A;  3T8W A;  3CXS A;  5F49 A;  2VZZ A;  1S3Z A;  2DXQ A;  2BO9 A;  1YME A;  3FIX A;  4CPA A;  1ARL A;  1J4J A;  4X5K A;  3VFQ A;  2PIZ A;  2V8G A;  3D2P A;  1V0C A;  3W6S A;  5A27 A;  3VWD A;  2EUI A;  3CPA A;  4NXY A;  3QAH A;  2OZU A;  1LAN A;  4OLL A;  2QML A;  2J8R A;  2Q4Y A;  2CTB A;  1F2P A;  1A2Z A;  1CG2 A;  1KUX A;  2IQ6 A;  2PRQ A;  3EFA A;  4GM5 A;  3PRT A;  4OME A;  4XPL A;  2Q7B A;  5FSZ A;  3D7D A;  4CYN A;  2DF5 A;  3RBU A;  1LAP A;  2YNC A;  4IQY A;  2GFQ A;  2JLM A;  3SHP A;  2PJ0 A;  5A28 A;  4II9 A;  4B5O A;  1S7N A;  3SXO A;  5JH9 A;  2PJC A;  4FD4 A;  4B12 A;  1L0C A;  3CDX A;  2GRE A;  4CAW A;  2VBQ A;  1YLE A;  3CT9 A;  4MMO A;  3WT4 A;  2V77 A;  2HUZ A;  1S7K A;  4P4I A;  4KOS A;  3K9U A;  2XD7 A;  1AYE A;  4MFZ A;  3SI2 A;  3GPG A;  3PP9 A;  3SJE A;  4AXV A;  5LYF A;  4Z65 A;  2RNK A;  1BOB A;  1S7F A;  3LOD A;  1YD9 A;  3SJG A;  5BWA B;  2Q4V A;  3B3T A;  4H89 A;  4Y49 B;  4WWV A;  1BPM A;  4OC0 A;  3JRU A;  1K4J A;  2PR1 A;  4PSX A;  4X3R A;  4FAI A;  3KQZ A;  1QST A;  4DYO A;  1VGY A;  4JD6 A;  4A95 A;  4CGM A;  4P4D A;  1HDQ A;  4FD7 A;  1MJB A;  1XMB A;  4UFW A;  1M4D A;  3E0K A;  1Y0R A;  2ABZ A;  2QIR A;  3EY5 A;  5HIH A;  4KVO E;  4TNU A;  1XIX A;  4MCR A;  4UWJ A;  2QEC A;  3RYO A;  2R1I A;  3TOA A;  1S7L A;  1TIQ A;  1U6M A;  1LAM A;  3D7H A;  3KGQ A;  4YRH A;  3S9L A;  5LRK A;  1X10 A;  1YLO A;  1YR0 A;  2PQ8 A;  2PCU A;  3DGV A;  3FED A;  3EJF A;  3RZA A;  4QBJ A;  2B4B A;  4RS2 A;  2FCK A;  4A33 A;  1YW6 A;  4UBR A;  5JQ4 A;  3KZW A;  5J8F A;  5D8N A;  2QJ8 A;  5H84 A;  1CM0 A;  3ISX A;  4P44 A;  3IJ3 A;  2B58 A;  4DNC A;  2L8R A;  2XEF A;  2Q51 A;  1KZF A;  4JZ0 A;  4MHY A;  4U9Z A;  4UF4 A;  2PJ4 A;  1HJZ A;  2NSM A;  2JEW A;  2O53 A;  2PJ1 A;  5HMN A;  1ON0 A;  2WYR A;  2ZW6 A;  4P4E A;  4UCP A;  4UIB A;  3FEE A;  5JM6 A;  1NSL A;  3PB4 X;  4JWP A;  5K8P A;  2KQV A;  4A2Z A;  2HB6 A;  1OZP A;  4IF5 A;  1CP7 A;  4MCQ A;  3NE8 A;  1TXZ A;  2AFZ A;  4CAV A;  3PZJ A;  2Z11 A;  2W2G A;  2ODF A;  4CYP A;  3EWP A;  5FSV A;  5E96 A;  2AFM A;  2JBJ A;  1Q2Y A;  4JYW A;  1KWM A;  2ACF A;  1NJR A;  3D7G A;  4G1P A;  4C2X A;  4A38 A;  1BAV A;  3GY9 A;  3IEH A;  3D7F A;  3H5Z A;  4MY0 A;  3V7Z A;  2J8N A;  1TXR A;  3GPQ A;  1DTD A;  4UFX A;  1CP6 A;  4ZY2 A;  2REF A;  3IID A;  3TO7 A;  4GVV A;  3CZX A;  2YNE A;  2Q0Y A;  3KI9 A;  2ZEL A;  4IHM A;  4PXB A;  3PFO A;  2HC9 A;  2Z3L A;  2ZW7 A;  5JGF A;  2C6C A;  2YGW A;  3IO1 A;  2R8V A;  4NGP A;  2PE3 A;  2ZEF A;  1TF9 A;  3FXT A;  4JGK A;  1XOV A;  1Z8X A;  4NFR A;  2ZEH A;  3H8E A;  2PC1 A;  3JTK A;  2BFR A;  3S6H A;  5K8N A;  4PXD A;  5DUS A;  1VHE A;  4ORF A;  1IID A;  3PB9 X;  1ELM P;  1DE4 C;  4LQG A;  5HVG A;  4R76 A;  2VZY A;  4M85 A;  5LRJ A;  4CAE A;  1XE4 A;  3FJU A;  3UY5 A;  4GS4 A;  1KUV A;  3V2B A;  1ZLI A;  3F5B A;  2J9A A;  4NEX A;  5AG6 A;  3WC6 A;  4NJR A;  3EO4 A;  4PPZ A;  1FNO A;  2PVW A;  5J8C A;  1OBR A;  4KOR A;  2FIA A;  3RAM A;  2WCT A;  4X2T A;  1XF8 A;  2VL1 A;  3B3C A;  5K8O A;  1LFW A;  2PJB A;  1M4L A;  2OZG A;  3TFY A;  3IIF A;  2Z3N A;  4UEZ A;  2ZXV A;  4UFV A;  2AFX A;  1ZR3 A;  3JVN A;  4MRI A;  5AG7 A;  4D86 A;  2ATR A;  4E2A A;  1ZO0 A;  4R6T A;  4NCZ A;  5AG5 A;  2GLJ A;  4MFK A;  3PBB A;  5C88 A;  3PB6 X;  4XNH C;  4MHP A;  1FT7 A;  2CNS A;  5LYD A;  3BLN A;  3D68 A;  3IIB A;  3S9N A;  4P10 A;  2WUU A;  1Z4E A;  3IU1 A;  3PB8 X;  5HVF A;  1EE3 P;  2EEE A;  2EK9 A;  1YGH A;  2IJZ A;  4KOT A;  4PQA A;  2ZEG A;  4XNH B;  2D4P A;  2NMT A;  2X7B A;  3F8K A;  4K30 A;  2PIY A;  5IB0 A;  1F2O A;  2FSR A;  4R87 A;  1YSJ A;  4OAE A;  3LD2 A;  3R9G A;  1PUA A;  3LWU A;  2P6F A;  4MI4 A;  3SI1 A;  1F57 A;  3VAR A;  5ELY A;  4ZY1 A;  3BXM A;  1ZG8 A;  4ZBG A;  2XEJ A;  2FXF A;  4R7M A;  4MFQ A;  3RNZ A;  2FXK A;  1MJ9 A;  1TKF A;  3TO6 A;  3PB7 X;  2LGR A;  3EW5 A;  1B87 A;  3H8F A;  3BJ7 A;  3EKE A;  3CXP A;  5EBV A;  4F8Z A;  3SII A;  4GVW A;  2GU2 A;  3WC5 A;  2G0B A;  2ZOG A;  1R3N A;  4OC1 A;  4B14 A;  3VWE A;  4CGL A;  3CXQ A;  5ISV A;  5CMS A;  2J8M A;  3WAB A;  3A9L A;  1IB1 E;  2AFC A;  3JZT A;  2VXK A;  2GAN A;  1IGB A;  2ZW5 A;  4KUB A;  3D3S A;  3NE7 A;  4PK2 A;  3TCV A;  5IV0 A;  2VRI A;  4H6Z A;  3KR5 A;  4IK2 A;  1B6B A;  4Y49 C;  3B3V A;  3I3G A;  3ETI A;  1PCA A;  4OC4 A;  4ZGY B;  1PU9 A;  2ZEO A;  4CGN A;  4IAV A;  1KUY A;  4NGQ A;  2P0W A;  4R9M A;  2PJ6 A;  4U9Y A;  4KYB A;  5FSY A;  1M1D A;  3IWG A;  4KLW A;  4P4B A;  2C1C A;  4NGS A;  4MFL A;  4K0C A;  3GQE A;  2P6G A;  4Q7A A;  1Z4R A;  1CPS A;  2B4D A;  3FX6 A;  2JEV A;  2KCW A;  4YU9 A;  4F9U A;  3EXN A;  3FF3 A;  5CPA A;  4DJL A;  1GHE A;  2PVV A;  1RO5 A;  3HLP A;  3G3S A;  4C2Y A;  3TO9 A;  2Y0M A;  2Q44 A;  5AG4 A;  4F0X A;  4A94 A;  3FMC A;  2WSA A;  3QB8 A;  4M6H A;  4KOW A;  3Q6Z A;  2IL4 A;  4MHD A;  1QSN A;  3RO0 A;  1ZR5 A;  2OZH A;  2QVP A;  2RB7 A;  3G8W A;  4ZY0 A;  4MCS A;  4NGR A;  1R57 A;  5FVJ A;  4B13 A;  4BBH A;  3I9S A;  3N5F A;  2EWB A;  4KLV A;  3B7I A;  1M4G A;  4HNX B;  4LX9 A;  4UEE A;  4CYO A;  2F7V A;  1P0H A;  2K5T A;  2GE3 A;  3IU2 A;  1QSO A;  2CTC A;  3B2Y A;  4EME A;  3IGR A;  1XJO A;  4HNW B;  4RUH A;  4F6A A;  4A30 A;  3SIG A;  3EWO A;  3DSB A;  1JQG A;  4FWU A;  2ZEE A;  4KOU A;  5KTD A;  2OU2 A;  4QVT A;  3N7Z A;  2POK A;  3R9E A;  3V8I A;  1YK3 A;  2GIV A;  2B5G A;  4J5R A;  1Y7E A;  1XMT A;  3WR7 A;  3TTH A;  4U5Y A;  1CX8 A;  3MRU A;  3DR8 A;  1X12 A;  4OIW A;  4QUS A;  1I21 A;  4TWE A;  4BMH A;  4R8F A;  1SQH A;  1Z8W A;  1YQE A;  3R96 A;  3SIJ A;  4MFP A;  5KTC A;  1YX0 A;  4MHZ A;  4OP4 A;  1GYT A;  2EVN A;  4ABK A;  5G22 A;  5IB9 A;  2WPX A;  3NA6 A;  4W9Y A;  3GIU A;  3D4U A;  4PXE A;  4RI1 A;  3TOB A;  4ABL A;  4ZX9 A;  5HOL A;  4BD9 A;  5LYI A;  4GUA A;  2BEI A;  1IYL A;  2YNC C;  2ZW4 A;  2B3U A;  4ESS A;  4ONU A;  3TT2 A;  4AVC A;  2C6G A;  4E0A A;  2Z3K A;  1I12 A;  4OID A;  3PGP A;  4GXH A;  2AFS A;  2FG1 A;  5DS0 A;  1AUG A;  2PSW A;  3B8G A;  4KVM E;  3S6G A;  1UFH A;  2VEZ A;  3D2M A;  3FH4 A;  2AJ6 A;  3DR6 A;  5LRG A;  2PJ7 A;  1I1D A;  2BL1 A;  4CAX A;  1QQ9 A;  1UWY A;  1ZLH A;  2OH1 A;  2Z3O A;  4KSI A;  3L2N A;  4M6I A;  4AG9 A;  4FD6 A;  5H86 A;  4XPD B;  3S9M A;  3DDD A;  4XPK A;  3KKW A;  1NSA A;  2CNM A;  4FBE A;  3LAC A;  4LQ6 A;  4WJB A;  5HH1 A;  4AVA A;  2AFW A;  3CPX A;  4NGM A;  3GYA A;  2Q43 A;  3F0A A;  1NE9 A;  3KL9 A;  4MJ8 A;  4OAD A;  4OKO A;  1HDU A;  2F8H A;  3IFE A;  4KZT A;  4KSF A;  5CB5 A;  4C7H A;  1WK4 A;  4CGO A;  1Y0Y A;  4A37 A;  6CPA A;  4CYQ A;  1YVO A;  1YW4 A;  2FS5 A;  1TKJ A;  1M4I A;  5HVH A;  4C68 A;  2CNT A;  4ZI6 A;  1Q7L A;  4I49 A;  3V38 A;  1IOF A;  2BFQ A;  4Q36 A;  4J5S A;  2R98 A;  3W91 A;  1YRE A;  3ZZI A;  4CRY B;  4Q38 A;  4CS0 B;  4M6G A;  4PK3 A;  4P4F A;  4CAF A;  3B3W A;  4BIN A;  4QB9 A;  4UIA A;  3VAT A;  4A31 A;  3JUW A;  3FVL A;  4J5Q A;  3GLJ A;  4R57 A;  2Z3M A;  1BPN A;  2HV2 A;  5G20 A;  4YWY A;  2JZF A;  3SJX A;  2HQY A;  3NH4 A;  4ZX8 A;  3IC1 A;  1PYT B;  4A39 A;  3W6X A;  3I1U A;  3SJF A;  3SI0 A;  1Q2C A;  4UWI A;  2PJ2 A;  2F5I A;  4OC5 A;  2I3C A;  1Y7R A;  1Y9W A;  1QSR A;  4OC2 A;  3R95 A;  1IYK A;  3S6F A;  2B5G B;  3MGD A;  2EBJ A;  4UCM A;  5EC4 A;  1S5K A;  1TY8 A;  1FY7 A;  4FD5 A;  2REE A;  3B3S A;  4EVY A;  4X8I A;  2JZD A;  1S60 A;  5E3B A;  2AFU A;  3GQO A;  2EK8 A;  3D8P A;  4R3K A;  3DNS A;  1XBU A;  2AE6 A;  1BLL E;  4AB7 A;  3QNV A; 
#chains in the Genus database with same CATH homology
 2ZEP A;  2BOA A;  4OC3 A;  2PJ8 A;  3ISZ A;  2PJ9 A;  5FSU A;  3BI0 A;  4NGN A;  1ARM A;  2XEI A;  2ZEN A;  3EWR A;  1XFO A;  4MCP A;  4F9V A;  5I4M A;  1TKH A;  4PXC A;  3KHX A;  2V8H A;  4K3N A;  3DLJ A;  3Q71 A;  2FAV A;  5J1Q A;  2PJ3 A;  3NH8 A;  3TC8 A;  4UML A;  2CF4 A;  4O23 A;  1LCP A;  3B35 A;  4H2K A;  1TF8 A;  4EFD A;  1IY7 A;  3TX8 A;  5HXD A;  3GB0 A;  1VHU A;  3MN8 A;  4B6Z A;  4J4Z A;  3EJG A;  4JVV A;  1Z8L A;  3PBE A;  3D66 A;  8CPA A;  4NJQ A;  3WC7 A;  1SPV A;  2ZEM A;  3D67 A;  2FVG A;  3VH9 A;  2ANP A;  5FSX A;  3LMS A;  4FUU A;  1CBX A;  2BCO A;  3IWW A;  4P4J A;  1RTQ A;  4MHN A;  1QMU A;  2CIJ A;  3BI1 A;  2RFH A;  3NH5 A;  5LYL A;  4NGT A;  2V8V A;  3SIH A;  3PFE A;  3FEC A;  3V45 A;  4EWT A;  2V8D A;  3HUV A;  1VIX A;  5CB3 A;  4MXU A;  2ZED A;  3KR4 A;  3GPO A;  5AIL A;  3NFZ A;  3BHX A;  4DUK A;  4ONW A;  1ZG9 A;  1CPX A;  2PJA A;  2WZN A;  4ETJ A;  2DEA A;  5THW A;  5K8M A;  1VHO A;  7CPA A;  1HEE A;  2C6P A;  2ZOF A;  1XRY A;  2G9D A;  3PEI A;  2Q4Z A;  2PJ5 A;  3H8G A;  1ELL P;  2AFO A;  2GLF A;  2IMO A;  4JLL A;  5CBM A;  1LOK A;  4TU0 A;  2DX6 A;  1ZG7 A;  4UEF A;  3K2K A;  4ZYQ A;  5D29 A;  2NYQ A;  1H8L A;  3KHZ A;  2OOT A;  2O4H A;  2JBK A;  2XEG A;  4JCA A;  2QYV A;  3KQX A;  5F09 A;  4ETK A;  1R43 A;  1Z5R A;  3K9T A;  2OR4 A;  2X47 A;  1Z2L A;  3GUX A;  3KAS A;  4P45 A;  3EWQ A;  1AMP A;  4P6Y A;  3T8W A;  2BO9 A;  1YME A;  4CPA A;  1ARL A;  3VFQ A;  2PIZ A;  2V8G A;  3CPA A;  1LAN A;  5HVF A;  2CTB A;  1F2P A;  2IQ6 A;  1CG2 A;  4GM5 A;  2PRQ A;  4OME A;  3PRT A;  5FSZ A;  3D7D A;  3RBU A;  1LAP A;  4IQY A;  2PJ0 A;  2PJC A;  3CDX A;  2GRE A;  3CT9 A;  4MMO A;  3WT4 A;  2V77 A;  4P4I A;  3SI2 A;  2XD7 A;  1AYE A;  3SJE A;  5LYF A;  3GPG A;  4AXV A;  4Z65 A;  1YD9 A;  3SJG A;  3B3T A;  4WWV A;  1BPM A;  4OC0 A;  3JRU A;  4X3R A;  4FAI A;  3KQZ A;  4DYO A;  1VGY A;  4P4D A;  1HDQ A;  1XMB A;  4TNU A;  1Y0R A;  2ABZ A;  5HIH A;  4MCR A;  1LAM A;  3D7H A;  3KGQ A;  3S9L A;  5LRK A;  1YLO A;  3DGV A;  2PCU A;  3FED A;  3RZA A;  3EJF A;  1YW6 A;  3KZW A;  5D8N A;  2QJ8 A;  3ISX A;  4P44 A;  3IJ3 A;  5JH9 A;  2L8R A;  2XEF A;  2Q51 A;  4JZ0 A;  4MHY A;  4UF4 A;  2PJ4 A;  1HJZ A;  2NSM A;  2JEW A;  2O53 A;  2PJ1 A;  2WYR A;  5JM6 A;  4P4E A;  4UIB A;  3FEE A;  3PB4 X;  5K8P A;  2HB6 A;  4MCQ A;  1CP7 A;  1TXZ A;  2AFZ A;  3EWP A;  5FSV A;  2AFM A;  2JBJ A;  4JYW A;  1KWM A;  2ACF A;  1NJR A;  3D7G A;  4G1P A;  4A38 A;  1BAV A;  3IEH A;  3D7F A;  3V7Z A;  1TXR A;  3GPQ A;  1DTD A;  1CP6 A;  4ZY2 A;  3IID A;  4GVV A;  3KI9 A;  4IHM A;  2ZEL A;  4PXB A;  3PFO A;  2HC9 A;  5JGF A;  2C6C A;  3IO1 A;  4NGP A;  2PE3 A;  2ZEF A;  1TF9 A;  4JGK A;  4NFR A;  2ZEH A;  3H8E A;  2BFR A;  5K8N A;  4PXD A;  5DUS A;  1VHE A;  3PB9 X;  1ELM P;  1DE4 C;  4LQG A;  5HVG A;  4R76 A;  5LRJ A;  3FJU A;  3V2B A;  1ZLI A;  3WC6 A;  2J9A A;  4NJR A;  4PPZ A;  1FNO A;  2PVW A;  1OBR A;  3RAM A;  4X2T A;  3B3C A;  2VL1 A;  5K8O A;  1LFW A;  2PJB A;  1M4L A;  3IIF A;  4UEZ A;  2AFX A;  1ZR3 A;  4MRI A;  4D86 A;  4R6T A;  2GLJ A;  3PBB A;  3PB6 X;  4MHP A;  1FT7 A;  5LYD A;  3D68 A;  3IIB A;  3S9N A;  4P10 A;  3PB8 X;  1EE3 P;  2EEE A;  2EK9 A;  2IJZ A;  4PQA A;  2ZEG A;  2PIY A;  1F2O A;  1YSJ A;  3LWU A;  3SI1 A;  1F57 A;  3VAR A;  5ELY A;  4ZY1 A;  3BXM A;  1ZG8 A;  2XEJ A;  4R7M A;  2FXK A;  1TKF A;  3PB7 X;  2LGR A;  3EW5 A;  3H8F A;  3EKE A;  4F8Z A;  3SII A;  4GVW A;  2GU2 A;  3WC5 A;  2ZOG A;  1R3N A;  4OC1 A;  5CMS A;  3WAB A;  2AFC A;  3JZT A;  1IGB A;  2VRI A;  3KR5 A;  4IK2 A;  3B3V A;  3ETI A;  1PCA A;  4OC4 A;  2ZEO A;  4IAV A;  4NGQ A;  2PJ6 A;  4KYB A;  5FSY A;  4P4B A;  2C1C A;  4NGS A;  4K0C A;  3GQE A;  4Q7A A;  1CPS A;  3FX6 A;  4YU9 A;  4F9U A;  5CPA A;  3FF3 A;  4DJL A;  2PVV A;  3HLP A;  4A94 A;  3FMC A;  3Q6Z A;  1ZR5 A;  2QVP A;  2RB7 A;  4MCS A;  4ZY0 A;  4NGR A;  3N5F A;  2EWB A;  4UEE A;  3B7I A;  2F7V A;  3B2Y A;  2CTC A;  4EME A;  4RUH A;  1XJO A;  3SIG A;  3EWO A;  1JQG A;  4FWU A;  2ZEE A;  2POK A;  4J5R A;  1Y7E A;  1CX8 A;  3MRU A;  4OIW A;  4TWE A;  4R8F A;  3SIJ A;  4MHZ A;  4OP4 A;  1GYT A;  4ABK A;  5IB9 A;  3NA6 A;  4W9Y A;  3D4U A;  4PXE A;  4ABL A;  4ZX9 A;  5HOL A;  4BD9 A;  5LYI A;  4GUA A;  4ESS A;  2C6G A;  4OID A;  2AFS A;  2FG1 A;  5DS0 A;  3FH4 A;  5LRG A;  2PJ7 A;  1QQ9 A;  1UWY A;  1ZLH A;  3L2N A;  4KSI A;  3S9M A;  1NSA A;  4FBE A;  4WJB A;  2AFW A;  3CPX A;  4NGM A;  2Q43 A;  3KL9 A;  4OKO A;  1HDU A;  2F8H A;  3IFE A;  5CB5 A;  1Y0Y A;  4A37 A;  6CPA A;  1YW4 A;  1TKJ A;  5HVH A;  4ZI6 A;  1Q7L A;  3V38 A;  2BFQ A;  4J5S A;  4P4F A;  3B3W A;  4UIA A;  3VAT A;  3FVL A;  4J5Q A;  3GLJ A;  1BPN A;  4YWY A;  3SJX A;  3NH4 A;  4ZX8 A;  3IC1 A;  1PYT B;  4A39 A;  3I1U A;  3SJF A;  3SI0 A;  2PJ2 A;  4OC5 A;  2I3C A;  4OC2 A;  1TY8 A;  3B3S A;  4X8I A;  2AFU A;  5E3B A;  3GQO A;  2EK8 A;  1XBU A;  1BLL E;  3QNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...