4R76A

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
518
structure length
515
Chain Sequence
b'SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 family aminopeptidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum fcb1/columbia
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
total genus 170
structure length 515
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r76A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r76A02
3KR4A 5CB5A 1IY7A 4WWVA 3H8FA 3EJGA 4A37A 2ZEPA 2XD7A 5ELYA 3MRUA 2FAVA 1XBUA 4YU9A 3BHXA 3PFOA 1HDUA 2DEAA 3KR5A 3T8WA 5JH9A 4ZY2A 5HVHA 3EWRA 3IJ3A 1NJRA 4OC4A 4UMLA 3FH4A 3IEHA 4MCPA 2O53A 3RAMA 3D7DA 4PXBA 3N5FA 3IC1A 3Q71A 1ARLA 1TXRA 3SIHA 2ZEEA 2GU2A 3VH9A 2ZEDA 2BFQA 4EWTA 4IK2A 1YW6A 2PJ9A 2Q43A 2V8VA 4F9UA 4R7MA 4OC0A 1ELLP 4J5SA 3BI0A 2XEGA 2C1CA 1TF8A 1LANA 3KGQA 3SIGA 3DLJA 3SIJA 3SJFA 4GM5A 1CPSA 2V8HA 2WZNA 4MCQA 2HC9A 1AYEA 1BPMA 1SPVA 4KYBA 3WC5A 4K0CA 2ZOFA 5HOLA 5D29A 1OBRA 1Y0YA 3B3WA 3SIIA 3D7FA 2GLFA 4BD9A 1NSAA 3CPXA 5FSZA 3TX8A 1Y7EA 4DYOA 4P4FA 1FT7A 4PXCA 2QJ8A 5JM6A 3SI1A 3IIFA 4WJBA 2OR4A 4OC1A 3IO1A 4G1PA 3SI0A 3RBUA 3PBEA 4R8FA 4P6YA 1VHUA 2Q51A 5LRKA 4CPAA 2RFHA 3EW5A 2CTCA 4YWYA 3FEEA 2EK8A 1ZG9A 1LAMA 4PPZA 3VFQA 2JBJA 3SJGA 4MHZA 4MCSA 1CX8A 4NJRA 4P4BA 4UEEA 3GPQA 5CB3A 4P4DA 4EMEA 2WYRA 3EWPA 1LOKA 6CPAA 3HLPA 3L2NA 3MN8A 4NGQA 1HDQA 4PXDA 1VGYA 1ZLHA 4GVWA 4R76A 3GPGA 4IAVA 5I4MA 4MHNA 3H8GA 1YD9A 3CDXA 1YLOA 4NJQA 3D66A 5LYIA 2ZOGA 4JZ0A 4Q7AA 2XEFA 1PYTB 3ISXA 2PJCA 2EK9A 4TU0A 2AFCA 1TKFA 3CT9A 1ELMP 5FSUA 1BLLE 2OOTA 2BFRA 3GLJA 3PFEA 4LQGA 3FF3A 1IGBA 3D7HA 4F8ZA 2V8DA 3PBBA 3KQZA 1ZR5A 1M4LA 3KQXA 3B3TA 2GLJA 2JEWA 2ABZA 1F2PA 4PQAA 4NFRA 1F57A 2PE3A 3JRUA 2NYQA 2EEEA 4TWEA 2PJ2A 2VL1A 2AFWA 1H8LA 3FVLA 4OC5A 4OP4A 3SJEA 1YW4A 1EE3P 2FG1A 4NGMA 2J9AA 2ZELA 2PJAA 4D86A 4AXVA 3RZAA 5CMSA 4W9YA 2C6CA 3PRTA 2DX6A 4ZYQA 2ZEGA 3IIDA 3EJFA 3LWUA 5LYFA 2C6PA 1VHEA 4PXEA 3PB7X 4KSIA 2VRIA 2IMOA 4IQYA 3WABA 1PCAA 3KI9A 1QMUA 2Q4ZA 1BAVA 1GYTA 3SI2A 1Z2LA 1TXZA 3S9MA 2BCOA 3H8EA 2CTBA 4OIDA 1ZLIA 5LYLA 2ZENA 3D67A 4MRIA 1CP6A 1DE4C 4MHPA 3K2KA 3S9NA 1TKJA 8CPAA 2X47A 4JVVA 3EWOA 2I3CA 2PJBA 2QVPA 4UEFA 2PVVA 4JYWA 2HB6A 3NH5A 4ABLA 3CPAA 2AFOA 3BI1A 5K8NA 5LRGA 1CP7A 5DUSA 3IIBA 4GUAA 4GVVA 3V2BA 3V38A 5CPAA 2GREA 1LFWA 3HUVA 4IHMA 2PJ7A 5K8MA 5CBMA 4JCAA 3PB8X 4ZX8A 1KWMA 4FUUA 2PJ8A 5HXDA 3GQEA 4OC2A 1DTDA 2XEIA 3NH4A 4O23A 4OIWA 4P45A 2G9DA 1Q7LA 5JGFA 1Y0RA 4NGRA 2NSMA 2XEJA 1CPXA 3PB9X 5THWA 3FEDA 5K8OA 5LRJA 1F2OA 2AFXA 2C6GA 3WC6A 2POKA 3DGVA 1R43A 1ARMA 2ZEHA 4DJLA 3VARA 3NFZA 3D68A 3JZTA 3K9TA 4J5RA 3PB6X 3FMCA 3EWQA 3Q6ZA 1XFOA 4J4ZA 1XMBA 4X3RA 1ZG8A 2BOAA 4ZX9A 4UIAA 4P4IA 4P10A 2PVWA 1UWYA 5HVGA 3ISZA 5D8NA 3ETIA 4F9VA 5J1QA 5AILA 3B2YA 2PJ0A 1XJOA 2O4HA 3NA6A 1FNOA 4NGTA 4ABKA 3SJXA 4UEZA 1CG2A 4TNUA 2L8RA 2CF4A 2EWBA 2PJ3A 3FJUA 4A38A 3IFEA 2PRQA 4A94A 4ZI6A 2PIZA 5FSYA 2ZEFA 2V77A 2PJ5A 3KHZA 4NGPA 4FBEA 4ETJA 2CIJA 3TC8A 4X2TA 1LAPA 1RTQA 3FECA 1Z8LA 4FWUA 3B3CA 5LYDA 4JGKA 3IWWA 2PJ6A 1HEEA 4UIBA 2ZEMA 2F7VA 3FX6A 5K8PA 2IQ6A 2FVGA 4ONWA 7CPAA 1XRYA 2BO9A 1LCPA 2LGRA 4MMOA 3I1UA 5FSVA 1ZG7A 3KL9A 4ZY1A 3VATA 3GPOA 4MCRA 4OC3A 4OKOA 4P44A 2ANPA 4DUKA 2ZEOA 2AFUA 4RUHA 1QQ9A 4H2KA 1HJZA 3PB4X 4ETKA 3B7IA 5IB9A 1CBXA 2ACFA 1VHOA 4JLLA 4EFDA 2PCUA 4Z65A 3PEIA 3V7ZA 5DS0A 2AFZA 5E3BA 2F8HA 4K3NA 1YSJA 2AFMA 1JQGA 3BXMA 4FAIA 3B3SA 1Z5RA 5HVFA 3B35A 1TY8A 4ZY0A 4UF4A 4NGNA 2PIYA 1YMEA 3D4UA 3KHXA 2IJZA 4MXUA 2V8GA 3D7GA 1ZR3A 2PJ4A 2JBKA 3KZWA 1R3NA 4X8IA 4P4JA 2AFSA 3KASA 3QNVA 1BPNA 4ESSA 5HIHA 2QYVA 3B3VA 4P4EA 4B6ZA 4OMEA 1TF9A 4R6TA 2FXKA 1AMPA 4MHYA 1VIXA 3WT4A 3EKEA 3S9LA 3GQOA 4J5QA 3V45A 3LMSA 3GUXA 4NGSA 3WC7A 2RB7A 3NH8A 4A39A 3GB0A 5F09A 1TKHA 5FSXA 2PJ1A
chains in the Genus database with same CATH superfamily
2OZUA 3TTHA 1M4DA 2C27A 3PP9A 1B6BA 2CNMA 3D2MA 3KR4A 3H5ZA 5CB5A 1IY7A 4WWVA 4C68A 3H8FA 3EJGA 1J4JA 2Q4YA 2ZXVA 4A37A 4CAVA 2B4BA 2Q0YA 2XD7A 2ZEPA 5ELYA 4YGOA 3LD2A 3MRUA 2FAVA 1S7KA 2I00A 5IX3A 2A4NA 1XBUA 4YU9A 2EO8A 3BHXA 3PFOA 2B4DA 4KOSA 4KORA 4U9YA 1HDUA 1S7LA 2DEAA 3KR5A 3T8WA 3VWDA 4BINA 5JH9A 4ZY2A 5HVHA 4MY0A 3EWRA 2Q7BA 3IJ3A 2ZW4A 1NJRA 1Y7RA 4OC4A 3WR7A 1S60A 4UMLA 3FH4A 4ZGYB 2PSWA 3IEHA 4MCPA 5EMIA 2O53A 2OU2A 1TIQA 3RAMA 1ZO0A 1Z4EA 2Z3LA 3A9LA 4UWJA 4RI1A 3V8IA 2RNKA 3D7DA 4LUAA 3H4QA 3N5FA 1XIXA 3IC1A 4PXBA 3Q71A 1ARLA 1TXRA 3SIHA 2GU2A 2ZEEA 3VH9A 3TO9A 4C7IA 2YNCA 2ZEDA 2BFQA 4EWTA 4IK2A 1YW6A 2PJ9A 2Q43A 2V8VA 4F9UA 3TFYA 4R7MA 4OC0A 5G1ZA 1ELLP 4J5SA 5J8FA 1I21A 3BI0A 4AVAA 4KS9A 1P4NA 2XEGA 3QB8A 1YR0A 2C1CA 1TF8A 1LANA 3KGQA 3SIGA 1KZFA 3DLJA 3SIJA 1QSTA 2Q04A 3SJFA 4GM5A 3GIUA 4Y49B 5AG4A 1RXTA 4NXYA 2VBQA 1CPSA 1XF8A 2V8HA 2YNCC 2WZNA 4MCQA 2YNEA 3KKWA 3I3GA 2HC9A 4AVCA 2H5MA 1NE9A 4F0YA 1AYEA 2FS5A 1BPMA 4CGMA 3FBUA 1SPVA 3EXNA 4KYBA 3BJ7A 2ARHA 3WC5A 4K0CA 2GFQA 2ZOFA 2J8RA 5HOLA 5D29A 1OBRA 1PUAA 4PSXA 1Y0YA 4CRYB 5JPHA 3N7ZA 4Q36A 4GS4A 2HQYA 2PRBA 3B3WA 3SIIA 3FNCA 3D7FA 3JTKA 2GLFA 4IF5A 4BD9A 1NSAA 3CPXA 5FSZA 2NMTA 1Y7EA 2O28A 3TX8A 4DYOA 4M6HA 4P4FA 5KTCA 1FT7A 4PXCA 4UFWA 2QJ8A 5JM6A 1IIDA 3SI1A 4JD6A 3IIFA 4KUBA 4WJBA 4QBJA 1OZPA 2OR4A 4OC1A 3IO1A 4CYNA 4MFQA 3C26A 4G1PA 3SI0A 3VWEA 2VQYA 2FL4A 3PBEA 3EY5A 4KUAA 3RBUA 1Y9KA 2AE6A 4R8FA 4P6YA 1VHUA 1Q2DA 2Q51A 5C88A 1R57A 1PU9A 4UCPA 3F5BA 3TCVA 4CPAA 5LRKA 4CGNA 2RFHA 4L89A 3EW5A 2CTCA 4YWYA 3FEEA 2EK8A 1ZG9A 4XNHB 1LAMA 1M1DA 3FYNA 1YREA 3VFQA 4PPZA 2JBJA 4E2AA 3SJGA 4MHZA 4PK3A 4HPSA 4MCSA 1CX8A 4NJRA 4P4BA 4U5YA 4UEEA 3JVNA 3GPQA 5CB3A 3B8GA 4P4DA 1KUVA 4EMEA 1CM0A 4HNXB 3R9EA 2WYRA 2BSWA 1M4IA 4LX9A 3EWPA 1LOKA 1ON0A 3F0AA 6CPAA 4KOTA 3W91A 4JJXA 4HNWB 3IU2A 3HLPA 3L2NA 4NSQA 2P6EA 3MN8A 1HDQA 4NGQA 4PXDA 1VGYA 1YQEA 1ZLHA 4GVWA 2EUIA 4R76A 3GPGA 4XPDB 4IAVA 5I4MA 4MHNA 3T90A 3H8GA 1YD9A 3CDXA 1YLOA 4NJQA 2HUZA 2Z3KA 2CNTA 3D66A 3FB3A 1XEBA 4MBUA 5LYIA 5HMNA 2ZOGA 2PR1A 4JZ0A 4NCZA 2VZZA 4Q7AA 2XEFA 4KVOE 2GANA 4M3SA 1PYTB 5I0CA 3ISXA 4RS2A 3GY9A 4FD7A 2PJCA 2EK9A 4FD6A 1MK4A 4TU0A 2AFCA 2KQVA 1TKFA 3CT9A 1ELMP 5FSUA 1BLLE 2ZW6A 3CXSA 1A2ZA 2OOTA 3IU1A 4LQ6A 2BFRA 3GLJA 3PFEA 2FE7A 4LQGA 4B14A 3FF3A 1IGBA 2YNDA 1I12A 3D7HA 2WSAA 2V8DA 3PBBA 3KQZA 1ZR5A 1M4LA 3KQXA 3B3TA 2GLJA 1YVOA 2JEWA 3S6GA 3T9YA 3W6XA 2ABZA 1F2PA 4PQAA 2P6GA 4CAFA 1Q2CA 3GYAA 4NFRA 1UFHA 4NEXA 1BOBA 1F57A 2PE3A 3JRUA 2NYQA 2Z11A 2K5TA 2EEEA 4TWEA 1K4JA 4KOVA 2PJ2A 3TO7A 3BLNA 2VL1A 4IUSA 2D4PA 1XE4A 2AFWA 4DNCA 1H8LA 3EO4A 1XMTA 4PSWA 5HH1A 1B87A 2DPSA 3FVLA 4OC5A 4C7HA 2Z3MA 2VXKA 4OP4A 4FD4A 3SJEA 1YW4A 4Q38A 1EE3P 2FG1A 4B13A 2G3TA 4JWPA 4KLWA 4NGMA 2Z10A 2J9AA 4JLYA 4KOUA 2ZELA 3S6FA 2PJAA 4D86A 4MJ8A 4AXVA 4KSAA 4HNYB 3E0KA 3RZAA 4R57A 3TOAA 5CMSA 4W9YA 2C6CA 2ODFA 3PRTA 2CNSA 4MY3A 4R87A 4CS0B 2DX6A 4RN7A 3P2FA 4UFXA 4MFKA 4ZYQA 3R1KA 1YVKA 2JLMA 2ZEGA 4BBHA 3IIDA 3RO0A 3EJFA 3LWUA 5LYFA 4L8AA 4H6ZA 2C6PA 5GCNA 2DF5A 4F6AA 1VHEA 4XPKA 2IL4A 1M44A 4PXEA 2Q44A 1WK4A 3PB7X 1Y9WA 2J8MA 4KSIA 2VRIA 4C2XA 2IMOA 4IQYA 2JZEA 3WABA 1PCAA 3KI9A 1FY7A 1QMUA 1BO4A 2Q4ZA 1BAVA 1S3ZA 1GYTA 3SI2A 1Z2LA 1IYLA 1TXZA 3QAYA 4B5PA 3CXPA 1IYKA 3TO6A 3S9MA 4X5KA 2BCOA 3H8EA 2CTBA 4OIDA 1ZLIA 5LYLA 1AUGA 2ZENA 3D67A 4MRIA 1CP6A 5AG5A 3IWEA 1S5KA 4KZTA 1DE4C 4MHPA 3DDDA 4EVYA 5IV0A 3K2KA 3S9NA 1TKJA 8CPAA 2X47A 4JVVA 2OZGA 2DPTA 3EWOA 2I3CA 2PJBA 2QVPA 4UEFA 2PVVA 4KLVA 4YRHA 4JYWA 2HB6A 3NH5A 4UA3A 4HKFA 4ABLA 3CPAA 5A28A 3FXTA 1VHSA 5FVJA 2AFOA 3BI1A 4UCNA 5K8NA 3G3SA 5LRGA 3S6HA 4M6GA 3SXNA 1CP7A 1WWZA 1Z8TA 5DUSA 2FXFA 4GUAA 4GVVA 3FIXA 3IIBA 5G22A 3V2BA 3V38A 1S7FA 3TE4A 1VKCA 5CPAA 2GREA 1LFWA 3HUVA 4IHMA 4QUSA 3FRMA 4UWIA 2PJ7A 4B5OA 5F46A 5K8MA 5CBMA 4JCAA 3PB8X 2CXAA 1QSMA 4UCMA 4ZX8A 1KWMA 4FUUA 2PJ8A 3W6SA 3P2HA 5C82A 5HXDA 3GQEA 4OC2A 1DTDA 2VI7A 2XEIA 3NH4A 4O23A 4OIWA 4PV6A 4C2ZA 1NSLA 4P45A 2KCWA 2G9DA 4GXHA 4BMHA 4CRZB 5ISVA 1Q7LA 2WPWA 2X7BA 4B11A 5A27A 4KOXA 2FIWA 3D2PA 1Y0RA 4A33A 5JGFA 4NGRA 2R7HA 2NSMA 2XEJA 1IU8A 2DXQA 1CPXA 3PB9X 5THWA 3FEDA 4R3KA 5K8OA 2R8VA 1NMTA 5LRJA 2BEIA 1I1DA 1P0HA 2Y0MA 1F2OA 5JQ4A 2AFXA 2C6GA 3DNSA 3WC6A 2POKA 2B58A 4B12A 4B10A 3DGVA 1R43A 3I9SA 4JXQA 1ARMA 2ZEHA 4DJLA 4AG9A 2OB0A 4QVTA 3VARA 3NFZA 2Q4VA 4A31A 4CGPA 3CZXA 3D68A 3JZTA 2YGWA 1IOFA 3K9TA 4XPLA 4J5RA 3PB6X 3FMCA 3EWQA 3Q6ZA 4Y49C 1XFOA 1JWQA 4CGLA 1IOIA 4J4ZA 2EBJA 1XMBA 4NF1A 4X3RA 4XNHC 3DSBA 4YFJA 1ZG8A 2BOAA 2FSRA 4ZX9A 4UIAA 4P4IA 4P10A 2PVWA 2I79A 2B3VA 3F8KA 5F47A 1UWYA 4ONUA 1QSRA 4AVBA 4F0XA 5HVGA 3ISZA 2WUUA 3GKRA 4CYOA 5D8NA 3ETIA 3NE8A 4R3LA 4F9VA 1N71A 5IB0A 3RNZA 5J1QA 1KUXA 3R95A 4JXRA 5AILA 1Z8WA 3B2YA 2PJ0A 3MGDA 1XJOA 4H6UA 4CAEA 2O4HA 2ZW7A 3NA6A 2B4DB 2PDOA 1FNOA 1YLEA 2PR8A 1LRZA 4UBRA 4NGTA 4ABKA 1KUYA 3R9GA 3SJXA 2W2GA 1M4GA 4UEZA 2PC1A 1CG2A 1RO5A 3D3SA 4TNUA 2B5GB 2L8RA 2CF4A 2EWBA 1U6MA 4ORFA 2JEVA 4H89A 1XOVA 1IICA 1GHEA 2PJ3A 3FJUA 2WPXA 4QC6A 4MHDA 2JDDA 2VZYA 3TOBA 3IFEA 4A38A 1SQHA 3QAHA 3LODA 4UFVA 4F8ZA 4CGOA 3JUWA 1YGHA 2PRQA 4A94A 4ZI6A 3IGRA 2OH1A 2PIZA 3OWCA 5F48A 5FSYA 2ZEFA 2V77A 2PJ5A 3KHZA 4NGPA 4KOYA 1YK3A 4FBEA 4ETJA 2CIJA 4PK2A 3S6KA 3TC8A 4A2ZA 3K9UA 2G0BA 4OADA 3NE7A 4X2TA 1LAPA 1MJ9A 1RTQA 3UY5A 3FECA 2ZPAA 4ZBGA 4A30A 1Z8LA 4KVME 4II9A 2JZDA 1IB1E 4FWUA 4AB7A 3B3CA 1YX0A 5K8PA 5LYDA 4JGKA 1Z4RA 2F5IA 2QECA 3IWWA 2PJ6A 2R1IA 1HEEA 4UIBA 2ZEMA 3IWGA 2F7VA 5DWNA 3FX6A 1V0CA 3RYOA 4C2YA 2IQ6A 2JZFA 4M85A 2FVGA 4ONWA 3SXOA 7CPAA 4A95A 3EFAA 1XRYA 2BO9A 4CAXA 2Z3NA 1LCPA 2LGRA 4MMOA 2Z0ZA 3I1UA 5AGEA 5FSVA 1ZG7A 2P6FA 4I49A 4KVXA 3TT2A 3KL9A 4ZY1A 3VATA 4CYPA 3GPOA 1S7NA 2HV2A 4KSFA 1Q2YA 4MCRA 4OC3A 4OKOA 5E96A 2ATRA 5KTDA 4P44A 2ANPA 4DUKA 1QSOA 1X12A 2AFUA 1MJBA 2ZEOA 5DWMA 3PGPA 2EVNA 2QMLA 3PZJA 4J3GA 3R96A 2OZHA 4RUHA 4E0AA 3LACA 1QQ9A 2QIRA 1HJZA 4H2KA 4OAEA 2GE3A 1X10A 2FT0A 3D8PA 4U9ZA 3PB4X 4ETKA 3B7IA 5IB9A 1CBXA 2ACFA 1VHOA 4E8OA 4JLLA 3BJ8A 3CXQA 5H84A 4EFDA 2PCUA 5G20A 4AG7A 4Z65A 3PEIA 3V7ZA 2B3UA 5AG7A 2AFZA 5DS0A 5E3BA 2F8HA 4CAWA 1Z8XA 4MFLA 4B5PB 4K3NA 2PQ8A 1YSJA 2AFMA 1JQGA 1MJAA 3BXMA 4MI4A 5G21A 5H86A 4FAIA 2FIAA 3B3SA 4MFZA 2REEA 1Z5RA 5HVFA 2RC4A 4A32A 3B35A 2B5GA 5AG6A 1TY8A 3ZJ0A 4ZY0A 4UF4A 2Q7SA 4NGNA 2PIYA 1YMEA 2GIVA 1QSNA 2CY2A 2VEZA 3D4UA 3KHXA 2IJZA 2BUEA 4FD5A 4MXUA 3R9FA 3ZZIA 5F49A 2V8GA 3D7GA 1ZR3A 2PJ4A 2Z3OA 3G8WA 2JBKA 3KZWA 1R3NA 4X8IA 2JDCA 4P4JA 2AFSA 3KASA 3QNVA 1BPNA 4ESSA 5HIHA 2QYVA 4QB9A 3EC4A 4KOWA 3B3VA 5EC4A 5J8CA 4P4EA 2REFA 4B6ZA 2FCKA 2R98A 4MFPA 4OMEA 1Z9UA 4OLLA 1TF9A 3DR6A 3DR8A 4XPDC 4R6TA 2FXKA 1AMPA 4K30A 1L0CA 4MHYA 1VIXA 4R9MA 2BL1A 5CNPA 3SHPA 3WT4A 3EKEA 2P0WA 4M6IA 3GQOA 3S9LA 4J5QA 2AJ6A 3V45A 2D4OA 2Z3PA 3LMSA 3GUXA 4NGSA 2G3AA 3WC7A 5EBVA 2RB7A 3NH8A 4A39A 5KTAA 2ZW5A 3GB0A 2WCTA 1CJWA 2J8NA 5F09A 4MFJA 5BWAB 1TKHA 4CYQA 5FSXA 2PJ1A
chains in the Genus database with same CATH topology
3KR4A 5CB5A 1IY7A 4WWVA 3H8FA 3EJGA 4A37A 2ZEPA 2XD7A 5ELYA 3MRUA 2FAVA 1XBUA 4YU9A 3BHXA 3PFOA 1HDUA 2DEAA 3KR5A 3T8WA 5JH9A 4ZY2A 5HVHA 3EWRA 3IJ3A 1NJRA 4OC4A 4UMLA 3FH4A 3IEHA 4MCPA 2O53A 3RAMA 3D7DA 4PXBA 3N5FA 3IC1A 3Q71A 1ARLA 1TXRA 3SIHA 2ZEEA 2GU2A 3VH9A 2ZEDA 2BFQA 4EWTA 4IK2A 1YW6A 2PJ9A 2Q43A 2V8VA 4F9UA 4R7MA 4OC0A 1ELLP 4J5SA 3BI0A 2XEGA 2C1CA 1TF8A 1LANA 3KGQA 3SIGA 3DLJA 3SIJA 3SJFA 4GM5A 1CPSA 2V8HA 2WZNA 4MCQA 2HC9A 1AYEA 1BPMA 1SPVA 4KYBA 3WC5A 4K0CA 2ZOFA 5HOLA 5D29A 1OBRA 1Y0YA 3B3WA 3SIIA 3D7FA 2GLFA 4BD9A 1NSAA 3CPXA 5FSZA 3TX8A 1Y7EA 4DYOA 4P4FA 1FT7A 4PXCA 2QJ8A 5JM6A 3SI1A 3IIFA 4WJBA 2OR4A 4OC1A 3IO1A 4G1PA 3SI0A 3RBUA 3PBEA 4R8FA 4P6YA 1VHUA 2Q51A 5LRKA 4CPAA 2RFHA 3EW5A 2CTCA 4YWYA 3FEEA 2EK8A 1ZG9A 1LAMA 4PPZA 3VFQA 2JBJA 3SJGA 4MHZA 4MCSA 1CX8A 4NJRA 4P4BA 4UEEA 3GPQA 5CB3A 4P4DA 4EMEA 2WYRA 3EWPA 1LOKA 6CPAA 3HLPA 3L2NA 3MN8A 4NGQA 1HDQA 4PXDA 1VGYA 1ZLHA 4GVWA 4R76A 3GPGA 4IAVA 5I4MA 4MHNA 3H8GA 1YD9A 3CDXA 1YLOA 4NJQA 3D66A 5LYIA 2ZOGA 4JZ0A 4Q7AA 2XEFA 1PYTB 3ISXA 2PJCA 2EK9A 4TU0A 2AFCA 1TKFA 3CT9A 1ELMP 5FSUA 1BLLE 2OOTA 2BFRA 3GLJA 3PFEA 4LQGA 3FF3A 1IGBA 3D7HA 4F8ZA 2V8DA 3PBBA 3KQZA 1ZR5A 1M4LA 3KQXA 3B3TA 2GLJA 2JEWA 2ABZA 1F2PA 4PQAA 4NFRA 1F57A 2PE3A 3JRUA 2NYQA 2EEEA 4TWEA 2PJ2A 2VL1A 2AFWA 1H8LA 3FVLA 4OC5A 4OP4A 3SJEA 1YW4A 1EE3P 2FG1A 4NGMA 2J9AA 2ZELA 2PJAA 4D86A 4AXVA 3RZAA 5CMSA 4W9YA 2C6CA 3PRTA 2DX6A 4ZYQA 2ZEGA 3IIDA 3EJFA 3LWUA 5LYFA 2C6PA 1VHEA 4PXEA 3PB7X 4KSIA 2VRIA 2IMOA 4IQYA 3WABA 1PCAA 3KI9A 1QMUA 2Q4ZA 1BAVA 1GYTA 3SI2A 1Z2LA 1TXZA 3S9MA 2BCOA 3H8EA 2CTBA 4OIDA 1ZLIA 5LYLA 2ZENA 3D67A 4MRIA 1CP6A 1DE4C 4MHPA 3K2KA 3S9NA 1TKJA 8CPAA 2X47A 4JVVA 3EWOA 2I3CA 2PJBA 2QVPA 4UEFA 2PVVA 4JYWA 2HB6A 3NH5A 4ABLA 3CPAA 2AFOA 3BI1A 5K8NA 5LRGA 1CP7A 5DUSA 3IIBA 4GUAA 4GVVA 3V2BA 3V38A 5CPAA 2GREA 1LFWA 3HUVA 4IHMA 2PJ7A 5K8MA 5CBMA 4JCAA 3PB8X 4ZX8A 1KWMA 4FUUA 2PJ8A 5HXDA 3GQEA 4OC2A 1DTDA 2XEIA 3NH4A 4O23A 4OIWA 4P45A 2G9DA 1Q7LA 5JGFA 1Y0RA 4NGRA 2NSMA 2XEJA 1CPXA 3PB9X 5THWA 3FEDA 5K8OA 5LRJA 1F2OA 2AFXA 2C6GA 3WC6A 2POKA 3DGVA 1R43A 1ARMA 2ZEHA 4DJLA 3VARA 3NFZA 3D68A 3JZTA 3K9TA 4J5RA 3PB6X 3FMCA 3EWQA 3Q6ZA 1XFOA 4J4ZA 1XMBA 4X3RA 1ZG8A 2BOAA 4ZX9A 4UIAA 4P4IA 4P10A 2PVWA 1UWYA 5HVGA 3ISZA 5D8NA 3ETIA 4F9VA 5J1QA 5AILA 3B2YA 2PJ0A 1XJOA 2O4HA 3NA6A 1FNOA 4NGTA 4ABKA 3SJXA 4UEZA 1CG2A 4TNUA 2L8RA 2CF4A 2EWBA 2PJ3A 3FJUA 4A38A 3IFEA 2PRQA 4A94A 4ZI6A 2PIZA 5FSYA 2ZEFA 2V77A 2PJ5A 3KHZA 4NGPA 4FBEA 4ETJA 2CIJA 3TC8A 4X2TA 1LAPA 1RTQA 3FECA 1Z8LA 4FWUA 3B3CA 5LYDA 4JGKA 3IWWA 2PJ6A 1HEEA 4UIBA 2ZEMA 2F7VA 3FX6A 5K8PA 2IQ6A 2FVGA 4ONWA 7CPAA 1XRYA 2BO9A 1LCPA 2LGRA 4MMOA 3I1UA 5FSVA 1ZG7A 3KL9A 4ZY1A 3VATA 3GPOA 4MCRA 4OC3A 4OKOA 4P44A 2ANPA 4DUKA 2ZEOA 2AFUA 4RUHA 1QQ9A 4H2KA 1HJZA 3PB4X 4ETKA 3B7IA 5IB9A 1CBXA 2ACFA 1VHOA 4JLLA 4EFDA 2PCUA 4Z65A 3PEIA 3V7ZA 5DS0A 2AFZA 5E3BA 2F8HA 4K3NA 1YSJA 2AFMA 1JQGA 3BXMA 4FAIA 3B3SA 1Z5RA 5HVFA 3B35A 1TY8A 4ZY0A 4UF4A 4NGNA 2PIYA 1YMEA 3D4UA 3KHXA 2IJZA 4MXUA 2V8GA 3D7GA 1ZR3A 2PJ4A 2JBKA 3KZWA 1R3NA 4X8IA 4P4JA 2AFSA 3KASA 3QNVA 1BPNA 4ESSA 5HIHA 2QYVA 3B3VA 4P4EA 4B6ZA 4OMEA 1TF9A 4R6TA 2FXKA 1AMPA 4MHYA 1VIXA 3WT4A 3EKEA 3S9LA 3GQOA 4J5QA 3V45A 3LMSA 3GUXA 4NGSA 3WC7A 2RB7A 3NH8A 4A39A 3GB0A 5F09A 1TKHA 5FSXA 2PJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KR4 A;  5CB5 A;  1IY7 A;  4WWV A;  3H8F A;  3EJG A;  4A37 A;  2ZEP A;  2XD7 A;  5ELY A;  3MRU A;  2FAV A;  1XBU A;  4YU9 A;  3BHX A;  3PFO A;  1HDU A;  2DEA A;  3KR5 A;  3T8W A;  5JH9 A;  4ZY2 A;  5HVH A;  3EWR A;  3IJ3 A;  1NJR A;  4OC4 A;  4UML A;  3FH4 A;  3IEH A;  4MCP A;  2O53 A;  3RAM A;  3D7D A;  4PXB A;  3N5F A;  3IC1 A;  3Q71 A;  1ARL A;  1TXR A;  3SIH A;  2ZEE A;  2GU2 A;  3VH9 A;  2ZED A;  2BFQ A;  4EWT A;  4IK2 A;  1YW6 A;  2PJ9 A;  2Q43 A;  2V8V A;  4F9U A;  4R7M A;  4OC0 A;  1ELL P;  4J5S A;  3BI0 A;  2XEG A;  2C1C A;  1TF8 A;  1LAN A;  3KGQ A;  3SIG A;  3DLJ A;  3SIJ A;  3SJF A;  4GM5 A;  1CPS A;  2V8H A;  2WZN A;  4MCQ A;  2HC9 A;  1AYE A;  1BPM A;  1SPV A;  4KYB A;  3WC5 A;  4K0C A;  2ZOF A;  5HOL A;  5D29 A;  1OBR A;  1Y0Y A;  3B3W A;  3SII A;  3D7F A;  2GLF A;  4BD9 A;  1NSA A;  3CPX A;  5FSZ A;  3TX8 A;  1Y7E A;  4DYO A;  4P4F A;  1FT7 A;  4PXC A;  2QJ8 A;  5JM6 A;  3SI1 A;  3IIF A;  4WJB A;  2OR4 A;  4OC1 A;  3IO1 A;  4G1P A;  3SI0 A;  3RBU A;  3PBE A;  4R8F A;  4P6Y A;  1VHU A;  2Q51 A;  5LRK A;  4CPA A;  2RFH A;  3EW5 A;  2CTC A;  4YWY A;  3FEE A;  2EK8 A;  1ZG9 A;  1LAM A;  4PPZ A;  3VFQ A;  2JBJ A;  3SJG A;  4MHZ A;  4MCS A;  1CX8 A;  4NJR A;  4P4B A;  4UEE A;  3GPQ A;  5CB3 A;  4P4D A;  4EME A;  2WYR A;  3EWP A;  1LOK A;  6CPA A;  3HLP A;  3L2N A;  3MN8 A;  4NGQ A;  1HDQ A;  4PXD A;  1VGY A;  1ZLH A;  4GVW A;  4R76 A;  3GPG A;  4IAV A;  5I4M A;  4MHN A;  3H8G A;  1YD9 A;  3CDX A;  1YLO A;  4NJQ A;  3D66 A;  5LYI A;  2ZOG A;  4JZ0 A;  4Q7A A;  2XEF A;  1PYT B;  3ISX A;  2PJC A;  2EK9 A;  4TU0 A;  2AFC A;  1TKF A;  3CT9 A;  1ELM P;  5FSU A;  1BLL E;  2OOT A;  2BFR A;  3GLJ A;  3PFE A;  4LQG A;  3FF3 A;  1IGB A;  3D7H A;  4F8Z A;  2V8D A;  3PBB A;  3KQZ A;  1ZR5 A;  1M4L A;  3KQX A;  3B3T A;  2GLJ A;  2JEW A;  2ABZ A;  1F2P A;  4PQA A;  4NFR A;  1F57 A;  2PE3 A;  3JRU A;  2NYQ A;  2EEE A;  4TWE A;  2PJ2 A;  2VL1 A;  2AFW A;  1H8L A;  3FVL A;  4OC5 A;  4OP4 A;  3SJE A;  1YW4 A;  1EE3 P;  2FG1 A;  4NGM A;  2J9A A;  2ZEL A;  2PJA A;  4D86 A;  4AXV A;  3RZA A;  5CMS A;  4W9Y A;  2C6C A;  3PRT A;  2DX6 A;  4ZYQ A;  2ZEG A;  3IID A;  3EJF A;  3LWU A;  5LYF A;  2C6P A;  1VHE A;  4PXE A;  3PB7 X;  4KSI A;  2VRI A;  2IMO A;  4IQY A;  3WAB A;  1PCA A;  3KI9 A;  1QMU A;  2Q4Z A;  1BAV A;  1GYT A;  3SI2 A;  1Z2L A;  1TXZ A;  3S9M A;  2BCO A;  3H8E A;  2CTB A;  4OID A;  1ZLI A;  5LYL A;  2ZEN A;  3D67 A;  4MRI A;  1CP6 A;  1DE4 C;  4MHP A;  3K2K A;  3S9N A;  1TKJ A;  8CPA A;  2X47 A;  4JVV A;  3EWO A;  2I3C A;  2PJB A;  2QVP A;  4UEF A;  2PVV A;  4JYW A;  2HB6 A;  3NH5 A;  4ABL A;  3CPA A;  2AFO A;  3BI1 A;  5K8N A;  5LRG A;  1CP7 A;  5DUS A;  3IIB A;  4GUA A;  4GVV A;  3V2B A;  3V38 A;  5CPA A;  2GRE A;  1LFW A;  3HUV A;  4IHM A;  2PJ7 A;  5K8M A;  5CBM A;  4JCA A;  3PB8 X;  4ZX8 A;  1KWM A;  4FUU A;  2PJ8 A;  5HXD A;  3GQE A;  4OC2 A;  1DTD A;  2XEI A;  3NH4 A;  4O23 A;  4OIW A;  4P45 A;  2G9D A;  1Q7L A;  5JGF A;  1Y0R A;  4NGR A;  2NSM A;  2XEJ A;  1CPX A;  3PB9 X;  5THW A;  3FED A;  5K8O A;  5LRJ A;  1F2O A;  2AFX A;  2C6G A;  3WC6 A;  2POK A;  3DGV A;  1R43 A;  1ARM A;  2ZEH A;  4DJL A;  3VAR A;  3NFZ A;  3D68 A;  3JZT A;  3K9T A;  4J5R A;  3PB6 X;  3FMC A;  3EWQ A;  3Q6Z A;  1XFO A;  4J4Z A;  1XMB A;  4X3R A;  1ZG8 A;  2BOA A;  4ZX9 A;  4UIA A;  4P4I A;  4P10 A;  2PVW A;  1UWY A;  5HVG A;  3ISZ A;  5D8N A;  3ETI A;  4F9V A;  5J1Q A;  5AIL A;  3B2Y A;  2PJ0 A;  1XJO A;  2O4H A;  3NA6 A;  1FNO A;  4NGT A;  4ABK A;  3SJX A;  4UEZ A;  1CG2 A;  4TNU A;  2L8R A;  2CF4 A;  2EWB A;  2PJ3 A;  3FJU A;  4A38 A;  3IFE A;  2PRQ A;  4A94 A;  4ZI6 A;  2PIZ A;  5FSY A;  2ZEF A;  2V77 A;  2PJ5 A;  3KHZ A;  4NGP A;  4FBE A;  4ETJ A;  2CIJ A;  3TC8 A;  4X2T A;  1LAP A;  1RTQ A;  3FEC A;  1Z8L A;  4FWU A;  3B3C A;  5LYD A;  4JGK A;  3IWW A;  2PJ6 A;  1HEE A;  4UIB A;  2ZEM A;  2F7V A;  3FX6 A;  5K8P A;  2IQ6 A;  2FVG A;  4ONW A;  7CPA A;  1XRY A;  2BO9 A;  1LCP A;  2LGR A;  4MMO A;  3I1U A;  5FSV A;  1ZG7 A;  3KL9 A;  4ZY1 A;  3VAT A;  3GPO A;  4MCR A;  4OC3 A;  4OKO A;  4P44 A;  2ANP A;  4DUK A;  2ZEO A;  2AFU A;  4RUH A;  1QQ9 A;  4H2K A;  1HJZ A;  3PB4 X;  4ETK A;  3B7I A;  5IB9 A;  1CBX A;  2ACF A;  1VHO A;  4JLL A;  4EFD A;  2PCU A;  4Z65 A;  3PEI A;  3V7Z A;  5DS0 A;  2AFZ A;  5E3B A;  2F8H A;  4K3N A;  1YSJ A;  2AFM A;  1JQG A;  3BXM A;  4FAI A;  3B3S A;  1Z5R A;  5HVF A;  3B35 A;  1TY8 A;  4ZY0 A;  4UF4 A;  4NGN A;  2PIY A;  1YME A;  3D4U A;  3KHX A;  2IJZ A;  4MXU A;  2V8G A;  3D7G A;  1ZR3 A;  2PJ4 A;  2JBK A;  3KZW A;  1R3N A;  4X8I A;  4P4J A;  2AFS A;  3KAS A;  3QNV A;  1BPN A;  4ESS A;  5HIH A;  2QYV A;  3B3V A;  4P4E A;  4B6Z A;  4OME A;  1TF9 A;  4R6T A;  2FXK A;  1AMP A;  4MHY A;  1VIX A;  3WT4 A;  3EKE A;  3S9L A;  3GQO A;  4J5Q A;  3V45 A;  3LMS A;  3GUX A;  4NGS A;  3WC7 A;  2RB7 A;  3NH8 A;  4A39 A;  3GB0 A;  5F09 A;  1TKH A;  5FSX A;  2PJ1 A; 
#chains in the Genus database with same CATH topology
 2OZU A;  3TTH A;  1M4D A;  2C27 A;  3PP9 A;  1B6B A;  2CNM A;  3D2M A;  3KR4 A;  3H5Z A;  5CB5 A;  1IY7 A;  4WWV A;  4C68 A;  3H8F A;  3EJG A;  1J4J A;  2Q4Y A;  2ZXV A;  4A37 A;  4CAV A;  2B4B A;  2Q0Y A;  2XD7 A;  2ZEP A;  5ELY A;  4YGO A;  3LD2 A;  3MRU A;  2FAV A;  1S7K A;  2I00 A;  5IX3 A;  2A4N A;  1XBU A;  4YU9 A;  2EO8 A;  3BHX A;  3PFO A;  2B4D A;  4KOS A;  4KOR A;  4U9Y A;  1HDU A;  1S7L A;  2DEA A;  3KR5 A;  3T8W A;  3VWD A;  4BIN A;  5JH9 A;  4ZY2 A;  5HVH A;  4MY0 A;  3EWR A;  2Q7B A;  3IJ3 A;  2ZW4 A;  1NJR A;  1Y7R A;  4OC4 A;  3WR7 A;  1S60 A;  4UML A;  3FH4 A;  4ZGY B;  2PSW A;  3IEH A;  4MCP A;  5EMI A;  2O53 A;  2OU2 A;  1TIQ A;  3RAM A;  1ZO0 A;  1Z4E A;  2Z3L A;  3A9L A;  4UWJ A;  4RI1 A;  3V8I A;  2RNK A;  3D7D A;  4LUA A;  3H4Q A;  3N5F A;  1XIX A;  3IC1 A;  4PXB A;  3Q71 A;  1ARL A;  1TXR A;  3SIH A;  2GU2 A;  2ZEE A;  3VH9 A;  3TO9 A;  4C7I A;  2YNC A;  2ZED A;  2BFQ A;  4EWT A;  4IK2 A;  1YW6 A;  2PJ9 A;  2Q43 A;  2V8V A;  4F9U A;  3TFY A;  4R7M A;  4OC0 A;  5G1Z A;  1ELL P;  4J5S A;  5J8F A;  1I21 A;  3BI0 A;  4AVA A;  4KS9 A;  1P4N A;  2XEG A;  3QB8 A;  1YR0 A;  2C1C A;  1TF8 A;  1LAN A;  3KGQ A;  3SIG A;  1KZF A;  3DLJ A;  3SIJ A;  1QST A;  2Q04 A;  3SJF A;  4GM5 A;  3GIU A;  4Y49 B;  5AG4 A;  1RXT A;  4NXY A;  2VBQ A;  1CPS A;  1XF8 A;  2V8H A;  2YNC C;  2WZN A;  4MCQ A;  2YNE A;  3KKW A;  3I3G A;  2HC9 A;  4AVC A;  2H5M A;  1NE9 A;  4F0Y A;  1AYE A;  2FS5 A;  1BPM A;  4CGM A;  3FBU A;  1SPV A;  3EXN A;  4KYB A;  3BJ7 A;  2ARH A;  3WC5 A;  4K0C A;  2GFQ A;  2ZOF A;  2J8R A;  5HOL A;  5D29 A;  1OBR A;  1PUA A;  4PSX A;  1Y0Y A;  4CRY B;  5JPH A;  3N7Z A;  4Q36 A;  4GS4 A;  2HQY A;  2PRB A;  3B3W A;  3SII A;  3FNC A;  3D7F A;  3JTK A;  2GLF A;  4IF5 A;  4BD9 A;  1NSA A;  3CPX A;  5FSZ A;  2NMT A;  1Y7E A;  2O28 A;  3TX8 A;  4DYO A;  4M6H A;  4P4F A;  5KTC A;  1FT7 A;  4PXC A;  4UFW A;  2QJ8 A;  5JM6 A;  1IID A;  3SI1 A;  4JD6 A;  3IIF A;  4KUB A;  4WJB A;  4QBJ A;  1OZP A;  2OR4 A;  4OC1 A;  3IO1 A;  4CYN A;  4MFQ A;  3C26 A;  4G1P A;  3SI0 A;  3VWE A;  2VQY A;  2FL4 A;  3PBE A;  3EY5 A;  4KUA A;  3RBU A;  1Y9K A;  2AE6 A;  4R8F A;  4P6Y A;  1VHU A;  1Q2D A;  2Q51 A;  5C88 A;  1R57 A;  1PU9 A;  4UCP A;  3F5B A;  3TCV A;  4CPA A;  5LRK A;  4CGN A;  2RFH A;  4L89 A;  3EW5 A;  2CTC A;  4YWY A;  3FEE A;  2EK8 A;  1ZG9 A;  4XNH B;  1LAM A;  1M1D A;  3FYN A;  1YRE A;  3VFQ A;  4PPZ A;  2JBJ A;  4E2A A;  3SJG A;  4MHZ A;  4PK3 A;  4HPS A;  4MCS A;  1CX8 A;  4NJR A;  4P4B A;  4U5Y A;  4UEE A;  3JVN A;  3GPQ A;  5CB3 A;  3B8G A;  4P4D A;  1KUV A;  4EME A;  1CM0 A;  4HNX B;  3R9E A;  2WYR A;  2BSW A;  1M4I A;  4LX9 A;  3EWP A;  1LOK A;  1ON0 A;  3F0A A;  6CPA A;  4KOT A;  3W91 A;  4JJX A;  4HNW B;  3IU2 A;  3HLP A;  3L2N A;  4NSQ A;  2P6E A;  3MN8 A;  1HDQ A;  4NGQ A;  4PXD A;  1VGY A;  1YQE A;  1ZLH A;  4GVW A;  2EUI A;  4R76 A;  3GPG A;  4XPD B;  4IAV A;  5I4M A;  4MHN A;  3T90 A;  3H8G A;  1YD9 A;  3CDX A;  1YLO A;  4NJQ A;  2HUZ A;  2Z3K A;  2CNT A;  3D66 A;  3FB3 A;  1XEB A;  4MBU A;  5LYI A;  5HMN A;  2ZOG A;  2PR1 A;  4JZ0 A;  4NCZ A;  2VZZ A;  4Q7A A;  2XEF A;  4KVO E;  2GAN A;  4M3S A;  1PYT B;  5I0C A;  3ISX A;  4RS2 A;  3GY9 A;  4FD7 A;  2PJC A;  2EK9 A;  4FD6 A;  1MK4 A;  4TU0 A;  2AFC A;  2KQV A;  1TKF A;  3CT9 A;  1ELM P;  5FSU A;  1BLL E;  2ZW6 A;  3CXS A;  1A2Z A;  2OOT A;  3IU1 A;  4LQ6 A;  2BFR A;  3GLJ A;  3PFE A;  2FE7 A;  4LQG A;  4B14 A;  3FF3 A;  1IGB A;  2YND A;  1I12 A;  3D7H A;  2WSA A;  2V8D A;  3PBB A;  3KQZ A;  1ZR5 A;  1M4L A;  3KQX A;  3B3T A;  2GLJ A;  1YVO A;  2JEW A;  3S6G A;  3T9Y A;  3W6X A;  2ABZ A;  1F2P A;  4PQA A;  2P6G A;  4CAF A;  1Q2C A;  3GYA A;  4NFR A;  1UFH A;  4NEX A;  1BOB A;  1F57 A;  2PE3 A;  3JRU A;  2NYQ A;  2Z11 A;  2K5T A;  2EEE A;  4TWE A;  1K4J A;  4KOV A;  2PJ2 A;  3TO7 A;  3BLN A;  2VL1 A;  4IUS A;  2D4P A;  1XE4 A;  2AFW A;  4DNC A;  1H8L A;  3EO4 A;  1XMT A;  4PSW A;  5HH1 A;  1B87 A;  2DPS A;  3FVL A;  4OC5 A;  4C7H A;  2Z3M A;  2VXK A;  4OP4 A;  4FD4 A;  3SJE A;  1YW4 A;  4Q38 A;  1EE3 P;  2FG1 A;  4B13 A;  2G3T A;  4JWP A;  4KLW A;  4NGM A;  2Z10 A;  2J9A A;  4JLY A;  4KOU A;  2ZEL A;  3S6F A;  2PJA A;  4D86 A;  4MJ8 A;  4AXV A;  4KSA A;  4HNY B;  3E0K A;  3RZA A;  4R57 A;  3TOA A;  5CMS A;  4W9Y A;  2C6C A;  2ODF A;  3PRT A;  2CNS A;  4MY3 A;  4R87 A;  4CS0 B;  2DX6 A;  4RN7 A;  3P2F A;  4UFX A;  4MFK A;  4ZYQ A;  3R1K A;  1YVK A;  2JLM A;  2ZEG A;  4BBH A;  3IID A;  3RO0 A;  3EJF A;  3LWU A;  5LYF A;  4L8A A;  4H6Z A;  2C6P A;  5GCN A;  2DF5 A;  4F6A A;  1VHE A;  4XPK A;  2IL4 A;  1M44 A;  4PXE A;  2Q44 A;  1WK4 A;  3PB7 X;  1Y9W A;  2J8M A;  4KSI A;  2VRI A;  4C2X A;  2IMO A;  4IQY A;  2JZE A;  3WAB A;  1PCA A;  3KI9 A;  1FY7 A;  1QMU A;  1BO4 A;  2Q4Z A;  1BAV A;  1S3Z A;  1GYT A;  3SI2 A;  1Z2L A;  1IYL A;  1TXZ A;  3QAY A;  4B5P A;  3CXP A;  1IYK A;  3TO6 A;  3S9M A;  4X5K A;  2BCO A;  3H8E A;  2CTB A;  4OID A;  1ZLI A;  5LYL A;  1AUG A;  2ZEN A;  3D67 A;  4MRI A;  1CP6 A;  5AG5 A;  3IWE A;  1S5K A;  4KZT A;  1DE4 C;  4MHP A;  3DDD A;  4EVY A;  5IV0 A;  3K2K A;  3S9N A;  1TKJ A;  8CPA A;  2X47 A;  4JVV A;  2OZG A;  2DPT A;  3EWO A;  2I3C A;  2PJB A;  2QVP A;  4UEF A;  2PVV A;  4KLV A;  4YRH A;  4JYW A;  2HB6 A;  3NH5 A;  4UA3 A;  4HKF A;  4ABL A;  3CPA A;  5A28 A;  3FXT A;  1VHS A;  5FVJ A;  2AFO A;  3BI1 A;  4UCN A;  5K8N A;  3G3S A;  5LRG A;  3S6H A;  4M6G A;  3SXN A;  1CP7 A;  1WWZ A;  1Z8T A;  5DUS A;  2FXF A;  4GUA A;  4GVV A;  3FIX A;  3IIB A;  5G22 A;  3V2B A;  3V38 A;  1S7F A;  3TE4 A;  1VKC A;  5CPA A;  2GRE A;  1LFW A;  3HUV A;  4IHM A;  4QUS A;  3FRM A;  4UWI A;  2PJ7 A;  4B5O A;  5F46 A;  5K8M A;  5CBM A;  4JCA A;  3PB8 X;  2CXA A;  1QSM A;  4UCM A;  4ZX8 A;  1KWM A;  4FUU A;  2PJ8 A;  3W6S A;  3P2H A;  5C82 A;  5HXD A;  3GQE A;  4OC2 A;  1DTD A;  2VI7 A;  2XEI A;  3NH4 A;  4O23 A;  4OIW A;  4PV6 A;  4C2Z A;  1NSL A;  4P45 A;  2KCW A;  2G9D A;  4GXH A;  4BMH A;  4CRZ B;  5ISV A;  1Q7L A;  2WPW A;  2X7B A;  4B11 A;  5A27 A;  4KOX A;  2FIW A;  3D2P A;  1Y0R A;  4A33 A;  5JGF A;  4NGR A;  2R7H A;  2NSM A;  2XEJ A;  1IU8 A;  2DXQ A;  1CPX A;  3PB9 X;  5THW A;  3FED A;  4R3K A;  5K8O A;  2R8V A;  1NMT A;  5LRJ A;  2BEI A;  1I1D A;  1P0H A;  2Y0M A;  1F2O A;  5JQ4 A;  2AFX A;  2C6G A;  3DNS A;  3WC6 A;  2POK A;  2B58 A;  4B12 A;  4B10 A;  3DGV A;  1R43 A;  3I9S A;  4JXQ A;  1ARM A;  2ZEH A;  4DJL A;  4AG9 A;  2OB0 A;  4QVT A;  3VAR A;  3NFZ A;  2Q4V A;  4A31 A;  4CGP A;  3CZX A;  3D68 A;  3JZT A;  2YGW A;  1IOF A;  3K9T A;  4XPL A;  4J5R A;  3PB6 X;  3FMC A;  3EWQ A;  3Q6Z A;  4Y49 C;  1XFO A;  1JWQ A;  4CGL A;  1IOI A;  4J4Z A;  2EBJ A;  1XMB A;  4NF1 A;  4X3R A;  4XNH C;  3DSB A;  4YFJ A;  1ZG8 A;  2BOA A;  2FSR A;  4ZX9 A;  4UIA A;  4P4I A;  4P10 A;  2PVW A;  2I79 A;  2B3V A;  3F8K A;  5F47 A;  1UWY A;  4ONU A;  1QSR A;  4AVB A;  4F0X A;  5HVG A;  3ISZ A;  2WUU A;  3GKR A;  4CYO A;  5D8N A;  3ETI A;  3NE8 A;  4R3L A;  4F9V A;  1N71 A;  5IB0 A;  3RNZ A;  5J1Q A;  1KUX A;  3R95 A;  4JXR A;  5AIL A;  1Z8W A;  3B2Y A;  2PJ0 A;  3MGD A;  1XJO A;  4H6U A;  4CAE A;  2O4H A;  2ZW7 A;  3NA6 A;  2B4D B;  2PDO A;  1FNO A;  1YLE A;  2PR8 A;  1LRZ A;  4UBR A;  4NGT A;  4ABK A;  1KUY A;  3R9G A;  3SJX A;  2W2G A;  1M4G A;  4UEZ A;  2PC1 A;  1CG2 A;  1RO5 A;  3D3S A;  4TNU A;  2B5G B;  2L8R A;  2CF4 A;  2EWB A;  1U6M A;  4ORF A;  2JEV A;  4H89 A;  1XOV A;  1IIC A;  1GHE A;  2PJ3 A;  3FJU A;  2WPX A;  4QC6 A;  4MHD A;  2JDD A;  2VZY A;  3TOB A;  3IFE A;  4A38 A;  1SQH A;  3QAH A;  3LOD A;  4UFV A;  4F8Z A;  4CGO A;  3JUW A;  1YGH A;  2PRQ A;  4A94 A;  4ZI6 A;  3IGR A;  2OH1 A;  2PIZ A;  3OWC A;  5F48 A;  5FSY A;  2ZEF A;  2V77 A;  2PJ5 A;  3KHZ A;  4NGP A;  4KOY A;  1YK3 A;  4FBE A;  4ETJ A;  2CIJ A;  4PK2 A;  3S6K A;  3TC8 A;  4A2Z A;  3K9U A;  2G0B A;  4OAD A;  3NE7 A;  4X2T A;  1LAP A;  1MJ9 A;  1RTQ A;  3UY5 A;  3FEC A;  2ZPA A;  4ZBG A;  4A30 A;  1Z8L A;  4KVM E;  4II9 A;  2JZD A;  1IB1 E;  4FWU A;  4AB7 A;  3B3C A;  1YX0 A;  5K8P A;  5LYD A;  4JGK A;  1Z4R A;  2F5I A;  2QEC A;  3IWW A;  2PJ6 A;  2R1I A;  1HEE A;  4UIB A;  2ZEM A;  3IWG A;  2F7V A;  5DWN A;  3FX6 A;  1V0C A;  3RYO A;  4C2Y A;  2IQ6 A;  2JZF A;  4M85 A;  2FVG A;  4ONW A;  3SXO A;  7CPA A;  4A95 A;  3EFA A;  1XRY A;  2BO9 A;  4CAX A;  2Z3N A;  1LCP A;  2LGR A;  4MMO A;  2Z0Z A;  3I1U A;  5AGE A;  5FSV A;  1ZG7 A;  2P6F A;  4I49 A;  4KVX A;  3TT2 A;  3KL9 A;  4ZY1 A;  3VAT A;  4CYP A;  3GPO A;  1S7N A;  2HV2 A;  4KSF A;  1Q2Y A;  4MCR A;  4OC3 A;  4OKO A;  5E96 A;  2ATR A;  5KTD A;  4P44 A;  2ANP A;  4DUK A;  1QSO A;  1X12 A;  2AFU A;  1MJB A;  2ZEO A;  5DWM A;  3PGP A;  2EVN A;  2QML A;  3PZJ A;  4J3G A;  3R96 A;  2OZH A;  4RUH A;  4E0A A;  3LAC A;  1QQ9 A;  2QIR A;  1HJZ A;  4H2K A;  4OAE A;  2GE3 A;  1X10 A;  2FT0 A;  3D8P A;  4U9Z A;  3PB4 X;  4ETK A;  3B7I A;  5IB9 A;  1CBX A;  2ACF A;  1VHO A;  4E8O A;  4JLL A;  3BJ8 A;  3CXQ A;  5H84 A;  4EFD A;  2PCU A;  5G20 A;  4AG7 A;  4Z65 A;  3PEI A;  3V7Z A;  2B3U A;  5AG7 A;  2AFZ A;  5DS0 A;  5E3B A;  2F8H A;  4CAW A;  1Z8X A;  4MFL A;  4B5P B;  4K3N A;  2PQ8 A;  1YSJ A;  2AFM A;  1JQG A;  1MJA A;  3BXM A;  4MI4 A;  5G21 A;  5H86 A;  4FAI A;  2FIA A;  3B3S A;  4MFZ A;  2REE A;  1Z5R A;  5HVF A;  2RC4 A;  4A32 A;  3B35 A;  2B5G A;  5AG6 A;  1TY8 A;  3ZJ0 A;  4ZY0 A;  4UF4 A;  2Q7S A;  4NGN A;  2PIY A;  1YME A;  2GIV A;  1QSN A;  2CY2 A;  2VEZ A;  3D4U A;  3KHX A;  2IJZ A;  2BUE A;  4FD5 A;  4MXU A;  3R9F A;  3ZZI A;  5F49 A;  2V8G A;  3D7G A;  1ZR3 A;  2PJ4 A;  2Z3O A;  3G8W A;  2JBK A;  3KZW A;  1R3N A;  4X8I A;  2JDC A;  4P4J A;  2AFS A;  3KAS A;  3QNV A;  1BPN A;  4ESS A;  5HIH A;  2QYV A;  4QB9 A;  3EC4 A;  4KOW A;  3B3V A;  5EC4 A;  5J8C A;  4P4E A;  2REF A;  4B6Z A;  2FCK A;  2R98 A;  4MFP A;  4OME A;  1Z9U A;  4OLL A;  1TF9 A;  3DR6 A;  3DR8 A;  4XPD C;  4R6T A;  2FXK A;  1AMP A;  4K30 A;  1L0C A;  4MHY A;  1VIX A;  4R9M A;  2BL1 A;  5CNP A;  3SHP A;  3WT4 A;  3EKE A;  2P0W A;  4M6I A;  3GQO A;  3S9L A;  4J5Q A;  2AJ6 A;  3V45 A;  2D4O A;  2Z3P A;  3LMS A;  3GUX A;  4NGS A;  2G3A A;  3WC7 A;  5EBV A;  2RB7 A;  3NH8 A;  4A39 A;  5KTA A;  2ZW5 A;  3GB0 A;  2WCT A;  1CJW A;  2J8N A;  5F09 A;  4MFJ A;  5BWA B;  1TKH A;  4CYQ A;  5FSX A;  2PJ1 A; 
#chains in the Genus database with same CATH homology
 3KR4 A;  5CB5 A;  1IY7 A;  4WWV A;  3H8F A;  3EJG A;  4A37 A;  2ZEP A;  2XD7 A;  5ELY A;  3MRU A;  2FAV A;  1XBU A;  4YU9 A;  3BHX A;  3PFO A;  1HDU A;  2DEA A;  3KR5 A;  3T8W A;  5JH9 A;  4ZY2 A;  5HVH A;  3EWR A;  3IJ3 A;  1NJR A;  4OC4 A;  4UML A;  3FH4 A;  3IEH A;  4MCP A;  2O53 A;  3RAM A;  3D7D A;  4PXB A;  3N5F A;  3IC1 A;  3Q71 A;  1ARL A;  1TXR A;  3SIH A;  2ZEE A;  2GU2 A;  3VH9 A;  2ZED A;  2BFQ A;  4EWT A;  4IK2 A;  1YW6 A;  2PJ9 A;  2Q43 A;  2V8V A;  4F9U A;  4R7M A;  4OC0 A;  1ELL P;  4J5S A;  3BI0 A;  2XEG A;  2C1C A;  1TF8 A;  1LAN A;  3KGQ A;  3SIG A;  3DLJ A;  3SIJ A;  3SJF A;  4GM5 A;  1CPS A;  2V8H A;  2WZN A;  4MCQ A;  2HC9 A;  1AYE A;  1BPM A;  1SPV A;  4KYB A;  3WC5 A;  4K0C A;  2ZOF A;  5HOL A;  5D29 A;  1OBR A;  1Y0Y A;  3B3W A;  3SII A;  3D7F A;  2GLF A;  4BD9 A;  1NSA A;  3CPX A;  5FSZ A;  3TX8 A;  1Y7E A;  4DYO A;  4P4F A;  1FT7 A;  4PXC A;  2QJ8 A;  5JM6 A;  3SI1 A;  3IIF A;  4WJB A;  2OR4 A;  4OC1 A;  3IO1 A;  4G1P A;  3SI0 A;  3RBU A;  3PBE A;  4R8F A;  4P6Y A;  1VHU A;  2Q51 A;  5LRK A;  4CPA A;  2RFH A;  3EW5 A;  2CTC A;  4YWY A;  3FEE A;  2EK8 A;  1ZG9 A;  1LAM A;  4PPZ A;  3VFQ A;  2JBJ A;  3SJG A;  4MHZ A;  4MCS A;  1CX8 A;  4NJR A;  4P4B A;  4UEE A;  3GPQ A;  5CB3 A;  4P4D A;  4EME A;  2WYR A;  3EWP A;  1LOK A;  6CPA A;  3HLP A;  3L2N A;  3MN8 A;  4NGQ A;  1HDQ A;  4PXD A;  1VGY A;  1ZLH A;  4GVW A;  4R76 A;  3GPG A;  4IAV A;  5I4M A;  4MHN A;  3H8G A;  1YD9 A;  3CDX A;  1YLO A;  4NJQ A;  3D66 A;  5LYI A;  2ZOG A;  4JZ0 A;  4Q7A A;  2XEF A;  1PYT B;  3ISX A;  2PJC A;  2EK9 A;  4TU0 A;  2AFC A;  1TKF A;  3CT9 A;  1ELM P;  5FSU A;  1BLL E;  2OOT A;  2BFR A;  3GLJ A;  3PFE A;  4LQG A;  3FF3 A;  1IGB A;  3D7H A;  4F8Z A;  2V8D A;  3PBB A;  3KQZ A;  1ZR5 A;  1M4L A;  3KQX A;  3B3T A;  2GLJ A;  2JEW A;  2ABZ A;  1F2P A;  4PQA A;  4NFR A;  1F57 A;  2PE3 A;  3JRU A;  2NYQ A;  2EEE A;  4TWE A;  2PJ2 A;  2VL1 A;  2AFW A;  1H8L A;  3FVL A;  4OC5 A;  4OP4 A;  3SJE A;  1YW4 A;  1EE3 P;  2FG1 A;  4NGM A;  2J9A A;  2ZEL A;  2PJA A;  4D86 A;  4AXV A;  3RZA A;  5CMS A;  4W9Y A;  2C6C A;  3PRT A;  2DX6 A;  4ZYQ A;  2ZEG A;  3IID A;  3EJF A;  3LWU A;  5LYF A;  2C6P A;  1VHE A;  4PXE A;  3PB7 X;  4KSI A;  2VRI A;  2IMO A;  4IQY A;  3WAB A;  1PCA A;  3KI9 A;  1QMU A;  2Q4Z A;  1BAV A;  1GYT A;  3SI2 A;  1Z2L A;  1TXZ A;  3S9M A;  2BCO A;  3H8E A;  2CTB A;  4OID A;  1ZLI A;  5LYL A;  2ZEN A;  3D67 A;  4MRI A;  1CP6 A;  1DE4 C;  4MHP A;  3K2K A;  3S9N A;  1TKJ A;  8CPA A;  2X47 A;  4JVV A;  3EWO A;  2I3C A;  2PJB A;  2QVP A;  4UEF A;  2PVV A;  4JYW A;  2HB6 A;  3NH5 A;  4ABL A;  3CPA A;  2AFO A;  3BI1 A;  5K8N A;  5LRG A;  1CP7 A;  5DUS A;  3IIB A;  4GUA A;  4GVV A;  3V2B A;  3V38 A;  5CPA A;  2GRE A;  1LFW A;  3HUV A;  4IHM A;  2PJ7 A;  5K8M A;  5CBM A;  4JCA A;  3PB8 X;  4ZX8 A;  1KWM A;  4FUU A;  2PJ8 A;  5HXD A;  3GQE A;  4OC2 A;  1DTD A;  2XEI A;  3NH4 A;  4O23 A;  4OIW A;  4P45 A;  2G9D A;  1Q7L A;  5JGF A;  1Y0R A;  4NGR A;  2NSM A;  2XEJ A;  1CPX A;  3PB9 X;  5THW A;  3FED A;  5K8O A;  5LRJ A;  1F2O A;  2AFX A;  2C6G A;  3WC6 A;  2POK A;  3DGV A;  1R43 A;  1ARM A;  2ZEH A;  4DJL A;  3VAR A;  3NFZ A;  3D68 A;  3JZT A;  3K9T A;  4J5R A;  3PB6 X;  3FMC A;  3EWQ A;  3Q6Z A;  1XFO A;  4J4Z A;  1XMB A;  4X3R A;  1ZG8 A;  2BOA A;  4ZX9 A;  4UIA A;  4P4I A;  4P10 A;  2PVW A;  1UWY A;  5HVG A;  3ISZ A;  5D8N A;  3ETI A;  4F9V A;  5J1Q A;  5AIL A;  3B2Y A;  2PJ0 A;  1XJO A;  2O4H A;  3NA6 A;  1FNO A;  4NGT A;  4ABK A;  3SJX A;  4UEZ A;  1CG2 A;  4TNU A;  2L8R A;  2CF4 A;  2EWB A;  2PJ3 A;  3FJU A;  4A38 A;  3IFE A;  2PRQ A;  4A94 A;  4ZI6 A;  2PIZ A;  5FSY A;  2ZEF A;  2V77 A;  2PJ5 A;  3KHZ A;  4NGP A;  4FBE A;  4ETJ A;  2CIJ A;  3TC8 A;  4X2T A;  1LAP A;  1RTQ A;  3FEC A;  1Z8L A;  4FWU A;  3B3C A;  5LYD A;  4JGK A;  3IWW A;  2PJ6 A;  1HEE A;  4UIB A;  2ZEM A;  2F7V A;  3FX6 A;  5K8P A;  2IQ6 A;  2FVG A;  4ONW A;  7CPA A;  1XRY A;  2BO9 A;  1LCP A;  2LGR A;  4MMO A;  3I1U A;  5FSV A;  1ZG7 A;  3KL9 A;  4ZY1 A;  3VAT A;  3GPO A;  4MCR A;  4OC3 A;  4OKO A;  4P44 A;  2ANP A;  4DUK A;  2ZEO A;  2AFU A;  4RUH A;  1QQ9 A;  4H2K A;  1HJZ A;  3PB4 X;  4ETK A;  3B7I A;  5IB9 A;  1CBX A;  2ACF A;  1VHO A;  4JLL A;  4EFD A;  2PCU A;  4Z65 A;  3PEI A;  3V7Z A;  5DS0 A;  2AFZ A;  5E3B A;  2F8H A;  4K3N A;  1YSJ A;  2AFM A;  1JQG A;  3BXM A;  4FAI A;  3B3S A;  1Z5R A;  5HVF A;  3B35 A;  1TY8 A;  4ZY0 A;  4UF4 A;  4NGN A;  2PIY A;  1YME A;  3D4U A;  3KHX A;  2IJZ A;  4MXU A;  2V8G A;  3D7G A;  1ZR3 A;  2PJ4 A;  2JBK A;  3KZW A;  1R3N A;  4X8I A;  4P4J A;  2AFS A;  3KAS A;  3QNV A;  1BPN A;  4ESS A;  5HIH A;  2QYV A;  3B3V A;  4P4E A;  4B6Z A;  4OME A;  1TF9 A;  4R6T A;  2FXK A;  1AMP A;  4MHY A;  1VIX A;  3WT4 A;  3EKE A;  3S9L A;  3GQO A;  4J5Q A;  3V45 A;  3LMS A;  3GUX A;  4NGS A;  3WC7 A;  2RB7 A;  3NH8 A;  4A39 A;  3GB0 A;  5F09 A;  1TKH A;  5FSX A;  2PJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...