4R76A

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
518
structure length
515
Chain Sequence
SEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 family aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 170
structure length 515
sequence length 518
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r76A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r76A02
3HLPA 3EWOA 5E3BA 1BAVA 1QMUA 1YMEA 3PB7X 4UEZA 3KR4A 1TKHA 2ZOGA 4J5SA 4NGSA 3SIJA 4A94A 4GVWA 2RB7A 3FMCA 4GUAA 3EWPA 4JZ0A 1FT7A 4FWUA 1CG2A 1PCAA 3QNVA 1VHOA 5K8PA 2AFWA 4B6ZA 1VIXA 4MCRA 4OC4A 5LRKA 1AYEA 3NH4A 4ZX8A 3V7ZA 3EWRA 1CP6A 3IWWA 2RFHA 4JYWA 5DS0A 4AXVA 3D7HA 3D7GA 4PXDA 1Z8LA 3IIDA 1DE4C 1ZG8A 1TKJA 2V8GA 5JGFA 1GYTA 2V8DA 4YWYA 4NJQA 4ZY2A 3N5FA 7CPAA 4ZY1A 3S9NA 4ZYQA 3NH8A 2Q51A 3FEEA 3IEHA 4X2TA 1YSJA 1TF8A 1HEEA 3PBEA 3IJ3A 1KWMA 2JEWA 4ABLA 3D4UA 1M4LA 3RBUA 3T8WA 2EWBA 4UMLA 1XMBA 4JGKA 1Z5RA 4P4IA 3LWUA 1IGBA 5HOLA 1F2OA 2ANPA 1CPXA 3HUVA 3L2NA 2L8RA 2QYVA 1CX8A 5LRGA 4RUHA 5K8NA 2PJ5A 4IAVA 4KSIA 5FSXA 3EW5A 1ARMA 2F7VA 2VRIA 4OC2A 3KZWA 6CPAA 2FG1A 3ETIA 4ETKA 3VATA 1BPNA 3BHXA 3RAMA 3K9TA 3EKEA 3SIHA 3PRTA 2AFUA 2ZEPA 3EWQA 3NFZA 3CPXA 5CPAA 3WC6A 2EK8A 1LANA 3D7DA 3WABA 4YU9A 1ELMP 4ZY0A 3IFEA 2EEEA 1ZR3A 3B3VA 2O53A 1NSAA 3DLJA 3IC1A 1TXZA 4IQYA 4R6TA 1OBRA 4FBEA 2GLJA 5HVFA 4Z65A 3JZTA 2PJAA 4NJRA 1LFWA 1YD9A 5K8OA 2DX6A 2PJ8A 3GPQA 1SPVA 1CPSA 4TNUA 3PFEA 5ELYA 3GB0A 3ISZA 2XD7A 1JQGA 2PVVA 3PEIA 4F9VA 1ZLIA 4MXUA 4P44A 4EMEA 3D67A 5CB3A 4DUKA 3VH9A 4EFDA 5HXDA 1ELLP 3PB4X 4P6YA 2WZNA 3SJXA 3SI0A 2IQ6A 2BO9A 5FSYA 4H2KA 4OIWA 1Y7EA 3GQEA 1XRYA 1ZG9A 3PFOA 2JBJA 2BOAA 4LQGA 4ESSA 2ZEMA 4X3RA 3WC7A 5I4MA 1TXRA 4P4EA 2NYQA 1UWYA 1XJOA 3FEDA 1TF9A 1Q7LA 4MHNA 3JRUA 5K8MA 4K0CA 3SJEA 5HIHA 2C1CA 1VHUA 2DEAA 2PJCA 8CPAA 2AFCA 4UEFA 2PVWA 4D86A 2O4HA 2Q4ZA 1ZLHA 4OMEA 3FVLA 3SI1A 3Q71A 4P45A 3DGVA 4NGPA 2IJZA 1YW6A 4GM5A 4A38A 3B35A 3B2YA 4F8ZA 3KR5A 4MHYA 4PPZA 4PXBA 2LGRA 2PJ6A 2ZEOA 4WJBA 4PXCA 4NFRA 3B3SA 3SIGA 1CP7A 3CDXA 4K3NA 1HDUA 2NSMA 2PIYA 4OKOA 4TWEA 3V45A 3KASA 3FH4A 2ZEHA 4OC0A 4P4BA 4J5RA 2XEJA 2XEFA 3D68A 5LYLA 3PB9X 3TC8A 2PJ3A 3KQXA 2BFRA 2FAVA 3CPAA 4EWTA 2PCUA 4FAIA 5D29A 1NJRA 1FNOA 5LYDA 3B3WA 2HC9A 2CTCA 1ARLA 3RZAA 4BD9A 1AMPA 2CIJA 2ZENA 4NGNA 1DTDA 4PXEA 4ABKA 2I3CA 3SIIA 3KL9A 3BI1A 1YW4A 4X8IA 4ZI6A 4ETJA 2GU2A 4FUUA 2GREA 2PJBA 1F2PA 4W9YA 2VL1A 2PE3A 2PJ7A 3MN8A 4MHPA 1LCPA 4UIBA 3TX8A 4IHMA 5HVHA 4A39A 4UF4A 1ZR5A 1VHEA 3H8FA 4J5QA 2AFSA 2QVPA 4O23A 4J4ZA 3GUXA 2PJ4A 2XEIA 1R3NA 4OP4A 2ZOFA 3BXMA 3FJUA 1HJZA 4KYBA 3H8EA 4ZX9A 4UIAA 4P10A 2AFXA 4JLLA 2AFMA 2QJ8A 5LRJA 2CF4A 4DYOA 4PQAA 3D66A 3FECA 1XFOA 1TY8A 4MRIA 5DUSA 3LMSA 4MMOA 3SJFA 3GPOA 4JCAA 3NH5A 3IIFA 5LYFA 1HDQA 2POKA 3S9LA 2ZEEA 4F9UA 1BLLE 3B3CA 3PBBA 3GQOA 2PJ1A 4A37A 2OOTA 5CB5A 2JBKA 4P4DA 3GLJA 2F8HA 1XBUA 4OC1A 2GLFA 2ZEGA 2AFZA 2V77A 1CBXA 2BFQA 2C6CA 2G9DA 1YLOA 1Y0RA 2PRQA 3ISXA 2V8VA 5LYIA 4MCSA 5AILA 5JM6A 5F09A 3BI0A 2AFOA 2IMOA 5HVGA 2FXKA 4MCPA 3I1UA 1TKFA 2PJ0A 3EJFA 3KGQA 4TU0A 2ZEFA 4OC5A 1LAMA 4MHZA 2BCOA 1Y0YA 3PB8X 3NA6A 3FF3A 4R7MA 1Z2LA 1H8LA 3H8GA 2HB6A 3SJGA 5J1QA 4IK2A 2PJ9A 4OC3A 2V8HA 2X47A 3PB6X 4P4JA 4Q7AA 5IB9A 2C6PA 5FSUA 2FVGA 3KI9A 5JH9A 4G1PA 3V2BA 3MRUA 5FSZA 3VFQA 2OR4A 4R76A 5D8NA 4OIDA 1F57A 3WC5A 3D7FA 3K2KA 3IIBA 5FSVA 1QQ9A 1LOKA 3VARA 1BPMA 2PJ2A 2J9AA 2ACFA 3CT9A 2PIZA 4WWVA 4CPAA 3B3TA 4UEEA 2XEGA 2ZEDA 3SI2A 1EE3P 4DJLA 3WT4A 3GPGA 3IO1A 2C6GA 4ONWA 4GVVA 2ZELA 3KHZA 3EJGA 3Q6ZA 1VGYA 1RTQA 4NGQA 4MCQA 2EK9A 3KHXA 2ABZA 5CMSA 4NGRA 4NGTA 4P4FA 1ZG7A 2CTBA 1R43A 1LAPA 3B7IA 3V38A 3KQZA 4JVVA 4R8FA 2Q43A 1PYTB 3S9MA 2WYRA 1IY7A 4NGMA 3FX6A 5CBMA 5THWA
chains in the Genus database with same CATH superfamily
2Z11A 2WUUA 3HLPA 2Q0YA 2DXQA 4MFZA 3EWOA 5E3BA 1BAVA 1S7FA 1QMUA 2FXFA 3JUWA 3K9UA 1YMEA 3PB7X 2P0WA 4FD5A 4UEZA 3KR4A 1TKHA 2J8NA 4J5SA 2ZOGA 4NGSA 3SIJA 4A94A 3GYAA 4GVWA 2WCTA 1KUYA 2RB7A 3FMCA 4I49A 1NE9A 2FL4A 4GUAA 5F46A 4UFVA 4OADA 4YGOA 3EWPA 3PZJA 4JZ0A 1FT7A 4FWUA 4AG9A 1XEBA 2B5GA 1CG2A 1PCAA 3QNVA 1VHOA 5K8PA 4KOXA 4B11A 2AFWA 4B6ZA 2FCKA 4CAXA 1VIXA 3BJ7A 4MFJA 4L89A 4MCRA 4OC4A 5LRKA 4XPDC 1AYEA 3NH4A 4ZX8A 1S7KA 1SQHA 3V7ZA 3EWRA 1CP6A 1NMTA 2BUEA 3IWWA 4IF5A 2RFHA 3I9SA 5DWNA 4CYNA 4F0YA 4JYWA 4MFKA 3DSBA 5DS0A 4AXVA 3D7HA 3D7GA 4PXDA 4F0XA 1Z8LA 4UA3A 4HPSA 4KOYA 3IIDA 1DE4C 3TO7A 1ZG8A 1TKJA 3SXOA 2V8GA 5JGFA 1GYTA 2V8DA 3CXSA 4YWYA 4NJQA 4ZY2A 3N5FA 5G20A 7CPAA 4M6GA 4ZY1A 4KOWA 2F5IA 3S9NA 2JZEA 4ZYQA 3NH8A 3S6GA 2Q51A 3FEEA 4KS9A 4C2YA 3IEHA 4AVBA 2HV2A 4AG7A 4X2TA 2KCWA 2ZW6A 5EMIA 1YSJA 1TF8A 2B4DB 1HEEA 3BLNA 3JVNA 2REFA 3PBEA 4QC6A 3IJ3A 1KWMA 4KSAA 5KTAA 5G21A 2JEWA 1IICA 4ABLA 3I3GA 3D4UA 2CNMA 1M4LA 3RBUA 3T8WA 5EC4A 2EWBA 4UMLA 3JTKA 2KQVA 1XMBA 4M6HA 3D3SA 1UFHA 2I79A 4JGKA 1Z5RA 1XMTA 4B5PB 4PSWA 4P4IA 2P6EA 3LWUA 4FD6A 1IGBA 4H6UA 1V0CA 1YVKA 1WWZA 4BINA 5HOLA 1F2OA 2ANPA 1CPXA 3HUVA 3L2NA 2L8RA 1ZO0A 2QYVA 1CX8A 5LRGA 2W2GA 1YQEA 2X7BA 4RUHA 5KTDA 2JZFA 5K8NA 3EY5A 4KORA 2PJ5A 4OAEA 4IAVA 4KSIA 5FSXA 1QSOA 4RN7A 3EW5A 1ARMA 2EO8A 2FE7A 2F7VA 2VRIA 4OC2A 2AJ6A 2YNDA 3KZWA 3LACA 6CPAA 4H6ZA 2FG1A 2CNTA 3ETIA 1Z4EA 2JEVA 4ETKA 4MY0A 4BBHA 4R3KA 3VATA 1BPNA 3BHXA 3RAMA 4QB9A 5IX3A 3K9TA 4KSFA 3TO9A 3EKEA 5AG4A 4UCMA 4LX9A 1BOBA 3SIHA 3PRTA 4A30A 2AFUA 2ZEPA 3N7ZA 2Z3OA 4RI1A 3EWQA 1XOVA 3NFZA 3CPXA 5CPAA 3TOAA 2OZHA 3WC6A 1QSNA 3T9YA 5DWMA 2EK8A 1LANA 5A28A 1Y9WA 3D7DA 3WABA 4YU9A 1ELMP 2VQYA 2CY2A 4ZY0A 3IFEA 3R96A 4J3GA 4X5KA 3S6FA 2EEEA 1ZR3A 3B3VA 2O53A 1NSAA 3DLJA 3IC1A 1TXZA 4M3SA 3FRMA 4IQYA 4R6TA 4C2XA 1OBRA 4FBEA 2GLJA 1I1DA 4R87A 1Z8TA 2PDOA 5HVFA 4Z65A 3JZTA 2JDCA 2PJAA 3H5ZA 3BJ8A 3F8KA 2PR1A 4NJRA 1U6MA 2QMLA 1LFWA 4Y49C 1YD9A 1JWQA 5K8OA 2DX6A 2PJ8A 2DPTA 2R1IA 2OZUA 3GPQA 3QAHA 1SPVA 1CPSA 3D8PA 4DNCA 4QVTA 1Z9UA 4TNUA 2B58A 1R57A 2Y0MA 3PFEA 5ELYA 3GB0A 3ISZA 4F6AA 2YGWA 3UY5A 1K4JA 2XD7A 1JQGA 2PRBA 4XNHB 3F0AA 2PVVA 3PEIA 1Q2CA 2Q44A 4CAVA 1ZLIA 4MXUA 1M4IA 4F9VA 1MJAA 4P44A 4EMEA 3D67A 5CB3A 2WPXA 2YNEA 3VH9A 3ZZIA 4DUKA 1A2ZA 4MI4A 4EFDA 5HXDA 1ELLP 4JWPA 3WR7A 3PB4X 4P6YA 2A4NA 2WZNA 3SJXA 3SI0A 2IQ6A 2RNKA 5FSYA 1S60A 2BO9A 2Z3MA 1BO4A 4MBUA 1IOFA 4H2KA 4OIWA 1Y7EA 3GQEA 1XRYA 1ZG9A 3PFOA 5EBVA 3TCVA 2JBJA 1Z8XA 2BOAA 4LQGA 5KTCA 4ESSA 2ZEMA 4K30A 4X3RA 4KVXA 4KUBA 5GCNA 1NSLA 3WC7A 3IWGA 4CAWA 2Z0ZA 2Q7BA 4CYPA 5I4MA 1TXRA 4P4EA 3R95A 2NYQA 3FYNA 1UWYA 1P0HA 1XJOA 2YNCA 3IU1A 3FEDA 2ZXVA 2Z3NA 1AUGA 2WSAA 4YRHA 1TF9A 1Q7LA 3CXPA 4MHNA 5H84A 3JRUA 4U9YA 2HQYA 4K0CA 2NMTA 5K8MA 1M4GA 4UCPA 3SJEA 5HIHA 2EUIA 4KOUA 2C1CA 1VHUA 2DEAA 4MY3A 2PJCA 1FY7A 8CPAA 2AFCA 4UEFA 4MHDA 4C2ZA 2PVWA 1PUAA 2BSWA 2R7HA 4HKFA 4D86A 2EVNA 2O4HA 2CNSA 1XIXA 2Q4ZA 1ZLHA 2P6GA 3FVLA 4OMEA 4CGLA 3SI1A 2D4OA 3Q71A 2VEZA 3DDDA 2OH1A 4P45A 3DGVA 1ON0A 2IJZA 4NGPA 1YW6A 4GM5A 4A32A 4A38A 4CGPA 3LD2A 3B35A 2Q7SA 3B2YA 3NE8A 5AG5A 2B3VA 4CYOA 4F8ZA 4KOVA 2ATRA 4ONUA 1S3ZA 4AVCA 1YK3A 3KR5A 4MHYA 1KUXA 4PPZA 4PXBA 3KKWA 2DF5A 2LGRA 2GFQA 2PJ6A 2ZEOA 3EXNA 4WJBA 4PXCA 1PU9A 4NFRA 1B87A 3B3SA 4MFQA 3DNSA 2R98A 4KVOE 3SIGA 1CP7A 3CDXA 4K3NA 1HDUA 2Z3PA 4MFPA 2NSMA 4Q38A 2PIYA 4OKOA 4TWEA 5F48A 3V45A 4A2ZA 3KASA 2CXAA 3FH4A 1YVOA 2ZEHA 4HNXB 5CNPA 4OC0A 4P4BA 2I00A 4J5RA 1KUVA 3NE7A 2XEJA 2XEFA 3D68A 4RS2A 5LYLA 5E96A 4R57A 3PB9X 4UWJA 4C7HA 3TC8A 3KQXA 2PJ3A 5FVJA 2J8RA 2BFRA 3G8WA 2FAVA 4XPKA 3IGRA 1MJBA 3CPAA 2G3AA 4UFXA 3W6SA 4EWTA 4BMHA 5H86A 2PCUA 4FAIA 5D29A 1NJRA 5F49A 1FNOA 5LYDA 2WPWA 5G1ZA 3FIXA 3B3WA 3CXQA 2HC9A 2CTCA 3A9LA 3IU2A 4FD7A 1ARLA 1OZPA 4M6IA 3RZAA 5J8CA 1QSRA 4BD9A 4CYQA 1AMPA 2CIJA 2ZENA 4NGNA 1DTDA 4PSXA 1MJ9A 4ABKA 3P2HA 2I3CA 4PXEA 4AVAA 3SIIA 2OU2A 1CM0A 3KL9A 4C68A 4II9A 4MFLA 3BI1A 1YW4A 4R9MA 1S7LA 3PP9A 4ZI6A 2FIAA 4X8IA 4ETJA 2GU2A 4FUUA 2GREA 2PJBA 1F2PA 3CZXA 2VL1A 4W9YA 3TTHA 2PE3A 2PJ7A 3MN8A 4MHPA 1LCPA 4A95A 2B4DA 4UIBA 2G3TA 3R1KA 4IHMA 4ORFA 3TX8A 4U9ZA 5HVHA 4A39A 4UF4A 5JQ4A 1ZR5A 1VHEA 3H8FA 4J5QA 4R3LA 1IYLA 1Q2YA 1Z8WA 2AFSA 2JLMA 2QVPA 2VZYA 4O23A 2B5GB 2OB0A 4CGMA 3DR8A 4B10A 4J4ZA 1IYKA 5HH1A 3GUXA 4KZTA 3RNZA 3W91A 4B5PA 2PJ4A 2XEIA 1R3NA 5JPHA 4OP4A 2ZOFA 1YREA 2H5MA 5IB0A 2J8MA 3BXMA 1X12A 1HJZA 2Z3LA 3FJUA 4KYBA 2ZPAA 3H8EA 4ZX9A 1KZFA 1XF8A 2Z3KA 3D2PA 4UIAA 1GHEA 4CRYB 4P10A 4C7IA 2AFXA 2R8VA 4JLLA 4UWIA 3SXNA 3TFYA 2D4PA 2AFMA 2QJ8A 5LRJA 2CF4A 4KOTA 5AGEA 1VKCA 4E2AA 4DYOA 3E0KA 4UFWA 3SHPA 2QIRA 4PQAA 3D2MA 4UBRA 3D66A 3EO4A 1XFOA 3FECA 1TY8A 4MRIA 5DUSA 2DPSA 5C82A 2VXKA 3LMSA 1QSTA 4MMOA 2C27A 1MK4A 3SJFA 3GPOA 4JCAA 1Z4RA 3NH5A 4LQ6A 3IIFA 5J8FA 5LYFA 2GIVA 5A27A 3FB3A 1HDQA 4XNHC 2POKA 3RYOA 4U5YA 2VI7A 3S9LA 2ZEEA 3F5BA 3H4QA 4F9UA 4LUAA 1BLLE 1IB1E 3B3CA 2QECA 4JXQA 3PBBA 3GQOA 4NEXA 4XPDB 2PJ1A 5HMNA 2JZDA 4GXHA 4A37A 2AE6A 2OOTA 5CB5A 2O28A 3TOBA 4EVYA 4H89A 2JBKA 4P4DA 3GLJA 1VHSA 3S6HA 1N71A 4NSQA 2PQ8A 2F8HA 1XBUA 4OC1A 1Q2DA 2GLFA 4CRZB 3W6XA 3MGDA 2ZEGA 4JXRA 1X10A 1S7NA 4HNWB 2AFZA 2V77A 1CBXA 1Y9KA 2VBQA 2FT0A 2IL4A 4B5OA 3PGPA 4A31A 2BFQA 2Q04A 5BWAB 3QB8A 3GY9A 5C88A 2C6CA 2G9DA 5AG6A 1YLOA 1Y0RA 4MJ8A 3R9FA 3OWCA 4XPLA 3S6KA 4YFJA 3RO0A 3FXTA 4B12A 5IV0A 2PRQA 2Q4VA 3ISXA 2V8VA 3FBUA 5LYIA 4MCSA 5AILA 2HUZA 5JM6A 5F09A 3BI0A 2AFOA 2IMOA 4KVME 5HVGA 2Q4YA 4ZBGA 2FXKA 2ARHA 3TT2A 4KLWA 4MCPA 3P2FA 3I1UA 4CGNA 1TKFA 2FIWA 3EJFA 2PJ0A 3KGQA 3EFAA 2BEIA 3FNCA 4TU0A 1QSMA 2ZEFA 2JDDA 3DR6A 1M4DA 1LAMA 4OC5A 4MHZA 3V8IA 2BCOA 1YLEA 4CAFA 1Y0YA 3PB8X 2OZGA 2RC4A 1RXTA 3FF3A 3NA6A 4R7MA 1J4JA 1Z2LA 3T90A 1H8LA 3H8GA 2HB6A 3SJGA 3B8GA 4PK3A 1RO5A 2FS5A 1CJWA 5ISVA 5J1QA 1M44A 1S5KA 4FD4A 4IK2A 2PJ9A 2ODFA 1LRZA 4OC3A 4NF1A 2V8HA 2X47A 3PB6X 3R9EA 4P4JA 4Q7AA 4QUSA 3IWEA 4CAEA 2ZW4A 3TE4A 5IB9A 2Z10A 2C6PA 2GANA 5FSUA 2FVGA 3KI9A 4NXYA 3TO6A 5JH9A 1TIQA 4G1PA 3V2BA 3MRUA 3QAYA 4PK2A 5F47A 4L8AA 3GIUA 1M1DA 5FSZA 3VFQA 2OR4A 4R76A 5D8NA 4OIDA 4ZGYB 3R9GA 4QBJA 1F57A 3WC5A 4M85A 3D7FA 2B4BA 3K2KA 3IIBA 4E0AA 4IUSA 5FSVA 3VWDA 1IIDA 1QQ9A 1LOKA 2VZZA 3GKRA 3VARA 1BPMA 1IOIA 4UCNA 2PJ2A 2J9AA 1B6BA 2ZW7A 2ACFA 3C26A 1Y7RA 3CT9A 2PIZA 4WWVA 4CPAA 3B3TA 4Y49B 4UEEA 2XEGA 2ZEDA 3SI2A 1EE3P 1YR0A 1YGHA 5G22A 3LODA 2P6FA 4CS0B 2G0BA 4DJLA 3WT4A 2B3UA 3GPGA 3IO1A 4NCZA 1YX0A 2C6GA 4ONWA 4GVVA 1P4NA 3ZJ0A 4E8OA 2ZELA 3KHZA 3EJGA 4Q36A 4AB7A 3Q6ZA 1VGYA 1RTQA 3EC4A 4NGQA 4B13A 4MCQA 2EK9A 3KHXA 2ABZA 4KLVA 2PSWA 5CMSA 4NGRA 4JD6A 4OLLA 5I0CA 4NGTA 4P4FA 5AG7A 1ZG7A 1I12A 3VWEA 2CTBA 4CGOA 1R43A 2GE3A 1L0CA 1LAPA 2K5TA 4JJXA 2PC1A 4KOSA 4A33A 3B7IA 2BL1A 3V38A 4B14A 3G3SA 2YNCC 4GS4A 3KQZA 4JVVA 4KUAA 4PV6A 4R8FA 1IU8A 2FSRA 2Q43A 1PYTB 3S9MA 1WK4A 1IY7A 2EBJA 2WYRA 4NGMA 2PR8A 3FX6A 5CBMA 1XE4A 2REEA 5THWA 4HNYB 1I21A 2ZW5A 4JLYA
chains in the Genus database with same CATH topology
3HLPA 3EWOA 5E3BA 1BAVA 1QMUA 1YMEA 3PB7X 4UEZA 3KR4A 1TKHA 2ZOGA 4J5SA 4NGSA 3SIJA 4A94A 4GVWA 2RB7A 3FMCA 4GUAA 3EWPA 4JZ0A 1FT7A 4FWUA 1CG2A 1PCAA 3QNVA 1VHOA 5K8PA 2AFWA 4B6ZA 1VIXA 4MCRA 4OC4A 5LRKA 1AYEA 3NH4A 4ZX8A 3V7ZA 3EWRA 1CP6A 3IWWA 2RFHA 4JYWA 5DS0A 4AXVA 3D7HA 3D7GA 4PXDA 1Z8LA 3IIDA 1DE4C 1ZG8A 1TKJA 2V8GA 5JGFA 1GYTA 2V8DA 4YWYA 4NJQA 4ZY2A 3N5FA 7CPAA 4ZY1A 3S9NA 4ZYQA 3NH8A 2Q51A 3FEEA 3IEHA 4X2TA 1YSJA 1TF8A 1HEEA 3PBEA 3IJ3A 1KWMA 2JEWA 4ABLA 3D4UA 1M4LA 3RBUA 3T8WA 2EWBA 4UMLA 1XMBA 4JGKA 1Z5RA 4P4IA 3LWUA 1IGBA 5HOLA 1F2OA 2ANPA 1CPXA 3HUVA 3L2NA 2L8RA 2QYVA 1CX8A 5LRGA 4RUHA 5K8NA 2PJ5A 4IAVA 4KSIA 5FSXA 3EW5A 1ARMA 2F7VA 2VRIA 4OC2A 3KZWA 6CPAA 2FG1A 3ETIA 4ETKA 3VATA 1BPNA 3BHXA 3RAMA 3K9TA 3EKEA 3SIHA 3PRTA 2AFUA 2ZEPA 3EWQA 3NFZA 3CPXA 5CPAA 3WC6A 2EK8A 1LANA 3D7DA 3WABA 4YU9A 1ELMP 4ZY0A 3IFEA 2EEEA 1ZR3A 3B3VA 2O53A 1NSAA 3DLJA 3IC1A 1TXZA 4IQYA 4R6TA 1OBRA 4FBEA 2GLJA 5HVFA 4Z65A 3JZTA 2PJAA 4NJRA 1LFWA 1YD9A 5K8OA 2DX6A 2PJ8A 3GPQA 1SPVA 1CPSA 4TNUA 3PFEA 5ELYA 3GB0A 3ISZA 2XD7A 1JQGA 2PVVA 3PEIA 4F9VA 1ZLIA 4MXUA 4P44A 4EMEA 3D67A 5CB3A 4DUKA 3VH9A 4EFDA 5HXDA 1ELLP 3PB4X 4P6YA 2WZNA 3SJXA 3SI0A 2IQ6A 2BO9A 5FSYA 4H2KA 4OIWA 1Y7EA 3GQEA 1XRYA 1ZG9A 3PFOA 2JBJA 2BOAA 4LQGA 4ESSA 2ZEMA 4X3RA 3WC7A 5I4MA 1TXRA 4P4EA 2NYQA 1UWYA 1XJOA 3FEDA 1TF9A 1Q7LA 4MHNA 3JRUA 5K8MA 4K0CA 3SJEA 5HIHA 2C1CA 1VHUA 2DEAA 2PJCA 8CPAA 2AFCA 4UEFA 2PVWA 4D86A 2O4HA 2Q4ZA 1ZLHA 4OMEA 3FVLA 3SI1A 3Q71A 4P45A 3DGVA 4NGPA 2IJZA 1YW6A 4GM5A 4A38A 3B35A 3B2YA 4F8ZA 3KR5A 4MHYA 4PPZA 4PXBA 2LGRA 2PJ6A 2ZEOA 4WJBA 4PXCA 4NFRA 3B3SA 3SIGA 1CP7A 3CDXA 4K3NA 1HDUA 2NSMA 2PIYA 4OKOA 4TWEA 3V45A 3KASA 3FH4A 2ZEHA 4OC0A 4P4BA 4J5RA 2XEJA 2XEFA 3D68A 5LYLA 3PB9X 3TC8A 2PJ3A 3KQXA 2BFRA 2FAVA 3CPAA 4EWTA 2PCUA 4FAIA 5D29A 1NJRA 1FNOA 5LYDA 3B3WA 2HC9A 2CTCA 1ARLA 3RZAA 4BD9A 1AMPA 2CIJA 2ZENA 4NGNA 1DTDA 4PXEA 4ABKA 2I3CA 3SIIA 3KL9A 3BI1A 1YW4A 4X8IA 4ZI6A 4ETJA 2GU2A 4FUUA 2GREA 2PJBA 1F2PA 4W9YA 2VL1A 2PE3A 2PJ7A 3MN8A 4MHPA 1LCPA 4UIBA 3TX8A 4IHMA 5HVHA 4A39A 4UF4A 1ZR5A 1VHEA 3H8FA 4J5QA 2AFSA 2QVPA 4O23A 4J4ZA 3GUXA 2PJ4A 2XEIA 1R3NA 4OP4A 2ZOFA 3BXMA 3FJUA 1HJZA 4KYBA 3H8EA 4ZX9A 4UIAA 4P10A 2AFXA 4JLLA 2AFMA 2QJ8A 5LRJA 2CF4A 4DYOA 4PQAA 3D66A 3FECA 1XFOA 1TY8A 4MRIA 5DUSA 3LMSA 4MMOA 3SJFA 3GPOA 4JCAA 3NH5A 3IIFA 5LYFA 1HDQA 2POKA 3S9LA 2ZEEA 4F9UA 1BLLE 3B3CA 3PBBA 3GQOA 2PJ1A 4A37A 2OOTA 5CB5A 2JBKA 4P4DA 3GLJA 2F8HA 1XBUA 4OC1A 2GLFA 2ZEGA 2AFZA 2V77A 1CBXA 2BFQA 2C6CA 2G9DA 1YLOA 1Y0RA 2PRQA 3ISXA 2V8VA 5LYIA 4MCSA 5AILA 5JM6A 5F09A 3BI0A 2AFOA 2IMOA 5HVGA 2FXKA 4MCPA 3I1UA 1TKFA 2PJ0A 3EJFA 3KGQA 4TU0A 2ZEFA 4OC5A 1LAMA 4MHZA 2BCOA 1Y0YA 3PB8X 3NA6A 3FF3A 4R7MA 1Z2LA 1H8LA 3H8GA 2HB6A 3SJGA 5J1QA 4IK2A 2PJ9A 4OC3A 2V8HA 2X47A 3PB6X 4P4JA 4Q7AA 5IB9A 2C6PA 5FSUA 2FVGA 3KI9A 5JH9A 4G1PA 3V2BA 3MRUA 5FSZA 3VFQA 2OR4A 4R76A 5D8NA 4OIDA 1F57A 3WC5A 3D7FA 3K2KA 3IIBA 5FSVA 1QQ9A 1LOKA 3VARA 1BPMA 2PJ2A 2J9AA 2ACFA 3CT9A 2PIZA 4WWVA 4CPAA 3B3TA 4UEEA 2XEGA 2ZEDA 3SI2A 1EE3P 4DJLA 3WT4A 3GPGA 3IO1A 2C6GA 4ONWA 4GVVA 2ZELA 3KHZA 3EJGA 3Q6ZA 1VGYA 1RTQA 4NGQA 4MCQA 2EK9A 3KHXA 2ABZA 5CMSA 4NGRA 4NGTA 4P4FA 1ZG7A 2CTBA 1R43A 1LAPA 3B7IA 3V38A 3KQZA 4JVVA 4R8FA 2Q43A 1PYTB 3S9MA 2WYRA 1IY7A 4NGMA 3FX6A 5CBMA 5THWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HLP A;  3EWO A;  5E3B A;  1BAV A;  1QMU A;  1YME A;  3PB7 X;  4UEZ A;  3KR4 A;  1TKH A;  2ZOG A;  4J5S A;  4NGS A;  3SIJ A;  4A94 A;  4GVW A;  2RB7 A;  3FMC A;  4GUA A;  3EWP A;  4JZ0 A;  1FT7 A;  4FWU A;  1CG2 A;  1PCA A;  3QNV A;  1VHO A;  5K8P A;  2AFW A;  4B6Z A;  1VIX A;  4MCR A;  4OC4 A;  5LRK A;  1AYE A;  3NH4 A;  4ZX8 A;  3V7Z A;  3EWR A;  1CP6 A;  3IWW A;  2RFH A;  4JYW A;  5DS0 A;  4AXV A;  3D7H A;  3D7G A;  4PXD A;  1Z8L A;  3IID A;  1DE4 C;  1ZG8 A;  1TKJ A;  2V8G A;  5JGF A;  1GYT A;  2V8D A;  4YWY A;  4NJQ A;  4ZY2 A;  3N5F A;  7CPA A;  4ZY1 A;  3S9N A;  4ZYQ A;  3NH8 A;  2Q51 A;  3FEE A;  3IEH A;  4X2T A;  1YSJ A;  1TF8 A;  1HEE A;  3PBE A;  3IJ3 A;  1KWM A;  2JEW A;  4ABL A;  3D4U A;  1M4L A;  3RBU A;  3T8W A;  2EWB A;  4UML A;  1XMB A;  4JGK A;  1Z5R A;  4P4I A;  3LWU A;  1IGB A;  5HOL A;  1F2O A;  2ANP A;  1CPX A;  3HUV A;  3L2N A;  2L8R A;  2QYV A;  1CX8 A;  5LRG A;  4RUH A;  5K8N A;  2PJ5 A;  4IAV A;  4KSI A;  5FSX A;  3EW5 A;  1ARM A;  2F7V A;  2VRI A;  4OC2 A;  3KZW A;  6CPA A;  2FG1 A;  3ETI A;  4ETK A;  3VAT A;  1BPN A;  3BHX A;  3RAM A;  3K9T A;  3EKE A;  3SIH A;  3PRT A;  2AFU A;  2ZEP A;  3EWQ A;  3NFZ A;  3CPX A;  5CPA A;  3WC6 A;  2EK8 A;  1LAN A;  3D7D A;  3WAB A;  4YU9 A;  1ELM P;  4ZY0 A;  3IFE A;  2EEE A;  1ZR3 A;  3B3V A;  2O53 A;  1NSA A;  3DLJ A;  3IC1 A;  1TXZ A;  4IQY A;  4R6T A;  1OBR A;  4FBE A;  2GLJ A;  5HVF A;  4Z65 A;  3JZT A;  2PJA A;  4NJR A;  1LFW A;  1YD9 A;  5K8O A;  2DX6 A;  2PJ8 A;  3GPQ A;  1SPV A;  1CPS A;  4TNU A;  3PFE A;  5ELY A;  3GB0 A;  3ISZ A;  2XD7 A;  1JQG A;  2PVV A;  3PEI A;  4F9V A;  1ZLI A;  4MXU A;  4P44 A;  4EME A;  3D67 A;  5CB3 A;  4DUK A;  3VH9 A;  4EFD A;  5HXD A;  1ELL P;  3PB4 X;  4P6Y A;  2WZN A;  3SJX A;  3SI0 A;  2IQ6 A;  2BO9 A;  5FSY A;  4H2K A;  4OIW A;  1Y7E A;  3GQE A;  1XRY A;  1ZG9 A;  3PFO A;  2JBJ A;  2BOA A;  4LQG A;  4ESS A;  2ZEM A;  4X3R A;  3WC7 A;  5I4M A;  1TXR A;  4P4E A;  2NYQ A;  1UWY A;  1XJO A;  3FED A;  1TF9 A;  1Q7L A;  4MHN A;  3JRU A;  5K8M A;  4K0C A;  3SJE A;  5HIH A;  2C1C A;  1VHU A;  2DEA A;  2PJC A;  8CPA A;  2AFC A;  4UEF A;  2PVW A;  4D86 A;  2O4H A;  2Q4Z A;  1ZLH A;  4OME A;  3FVL A;  3SI1 A;  3Q71 A;  4P45 A;  3DGV A;  4NGP A;  2IJZ A;  1YW6 A;  4GM5 A;  4A38 A;  3B35 A;  3B2Y A;  4F8Z A;  3KR5 A;  4MHY A;  4PPZ A;  4PXB A;  2LGR A;  2PJ6 A;  2ZEO A;  4WJB A;  4PXC A;  4NFR A;  3B3S A;  3SIG A;  1CP7 A;  3CDX A;  4K3N A;  1HDU A;  2NSM A;  2PIY A;  4OKO A;  4TWE A;  3V45 A;  3KAS A;  3FH4 A;  2ZEH A;  4OC0 A;  4P4B A;  4J5R A;  2XEJ A;  2XEF A;  3D68 A;  5LYL A;  3PB9 X;  3TC8 A;  2PJ3 A;  3KQX A;  2BFR A;  2FAV A;  3CPA A;  4EWT A;  2PCU A;  4FAI A;  5D29 A;  1NJR A;  1FNO A;  5LYD A;  3B3W A;  2HC9 A;  2CTC A;  1ARL A;  3RZA A;  4BD9 A;  1AMP A;  2CIJ A;  2ZEN A;  4NGN A;  1DTD A;  4PXE A;  4ABK A;  2I3C A;  3SII A;  3KL9 A;  3BI1 A;  1YW4 A;  4X8I A;  4ZI6 A;  4ETJ A;  2GU2 A;  4FUU A;  2GRE A;  2PJB A;  1F2P A;  4W9Y A;  2VL1 A;  2PE3 A;  2PJ7 A;  3MN8 A;  4MHP A;  1LCP A;  4UIB A;  3TX8 A;  4IHM A;  5HVH A;  4A39 A;  4UF4 A;  1ZR5 A;  1VHE A;  3H8F A;  4J5Q A;  2AFS A;  2QVP A;  4O23 A;  4J4Z A;  3GUX A;  2PJ4 A;  2XEI A;  1R3N A;  4OP4 A;  2ZOF A;  3BXM A;  3FJU A;  1HJZ A;  4KYB A;  3H8E A;  4ZX9 A;  4UIA A;  4P10 A;  2AFX A;  4JLL A;  2AFM A;  2QJ8 A;  5LRJ A;  2CF4 A;  4DYO A;  4PQA A;  3D66 A;  3FEC A;  1XFO A;  1TY8 A;  4MRI A;  5DUS A;  3LMS A;  4MMO A;  3SJF A;  3GPO A;  4JCA A;  3NH5 A;  3IIF A;  5LYF A;  1HDQ A;  2POK A;  3S9L A;  2ZEE A;  4F9U A;  1BLL E;  3B3C A;  3PBB A;  3GQO A;  2PJ1 A;  4A37 A;  2OOT A;  5CB5 A;  2JBK A;  4P4D A;  3GLJ A;  2F8H A;  1XBU A;  4OC1 A;  2GLF A;  2ZEG A;  2AFZ A;  2V77 A;  1CBX A;  2BFQ A;  2C6C A;  2G9D A;  1YLO A;  1Y0R A;  2PRQ A;  3ISX A;  2V8V A;  5LYI A;  4MCS A;  5AIL A;  5JM6 A;  5F09 A;  3BI0 A;  2AFO A;  2IMO A;  5HVG A;  2FXK A;  4MCP A;  3I1U A;  1TKF A;  2PJ0 A;  3EJF A;  3KGQ A;  4TU0 A;  2ZEF A;  4OC5 A;  1LAM A;  4MHZ A;  2BCO A;  1Y0Y A;  3PB8 X;  3NA6 A;  3FF3 A;  4R7M A;  1Z2L A;  1H8L A;  3H8G A;  2HB6 A;  3SJG A;  5J1Q A;  4IK2 A;  2PJ9 A;  4OC3 A;  2V8H A;  2X47 A;  3PB6 X;  4P4J A;  4Q7A A;  5IB9 A;  2C6P A;  5FSU A;  2FVG A;  3KI9 A;  5JH9 A;  4G1P A;  3V2B A;  3MRU A;  5FSZ A;  3VFQ A;  2OR4 A;  4R76 A;  5D8N A;  4OID A;  1F57 A;  3WC5 A;  3D7F A;  3K2K A;  3IIB A;  5FSV A;  1QQ9 A;  1LOK A;  3VAR A;  1BPM A;  2PJ2 A;  2J9A A;  2ACF A;  3CT9 A;  2PIZ A;  4WWV A;  4CPA A;  3B3T A;  4UEE A;  2XEG A;  2ZED A;  3SI2 A;  1EE3 P;  4DJL A;  3WT4 A;  3GPG A;  3IO1 A;  2C6G A;  4ONW A;  4GVV A;  2ZEL A;  3KHZ A;  3EJG A;  3Q6Z A;  1VGY A;  1RTQ A;  4NGQ A;  4MCQ A;  2EK9 A;  3KHX A;  2ABZ A;  5CMS A;  4NGR A;  4NGT A;  4P4F A;  1ZG7 A;  2CTB A;  1R43 A;  1LAP A;  3B7I A;  3V38 A;  3KQZ A;  4JVV A;  4R8F A;  2Q43 A;  1PYT B;  3S9M A;  2WYR A;  1IY7 A;  4NGM A;  3FX6 A;  5CBM A;  5THW A; 
#chains in the Genus database with same CATH topology
 2Z11 A;  2WUU A;  3HLP A;  2Q0Y A;  2DXQ A;  4MFZ A;  3EWO A;  5E3B A;  1BAV A;  1S7F A;  1QMU A;  2FXF A;  3JUW A;  3K9U A;  1YME A;  3PB7 X;  2P0W A;  4FD5 A;  4UEZ A;  3KR4 A;  1TKH A;  2J8N A;  4J5S A;  2ZOG A;  4NGS A;  3SIJ A;  4A94 A;  3GYA A;  4GVW A;  2WCT A;  1KUY A;  2RB7 A;  3FMC A;  4I49 A;  1NE9 A;  2FL4 A;  4GUA A;  5F46 A;  4UFV A;  4OAD A;  4YGO A;  3EWP A;  3PZJ A;  4JZ0 A;  1FT7 A;  4FWU A;  4AG9 A;  1XEB A;  2B5G A;  1CG2 A;  1PCA A;  3QNV A;  1VHO A;  5K8P A;  4KOX A;  4B11 A;  2AFW A;  4B6Z A;  2FCK A;  4CAX A;  1VIX A;  3BJ7 A;  4MFJ A;  4L89 A;  4MCR A;  4OC4 A;  5LRK A;  4XPD C;  1AYE A;  3NH4 A;  4ZX8 A;  1S7K A;  1SQH A;  3V7Z A;  3EWR A;  1CP6 A;  1NMT A;  2BUE A;  3IWW A;  4IF5 A;  2RFH A;  3I9S A;  5DWN A;  4CYN A;  4F0Y A;  4JYW A;  4MFK A;  3DSB A;  5DS0 A;  4AXV A;  3D7H A;  3D7G A;  4PXD A;  4F0X A;  1Z8L A;  4UA3 A;  4HPS A;  4KOY A;  3IID A;  1DE4 C;  3TO7 A;  1ZG8 A;  1TKJ A;  3SXO A;  2V8G A;  5JGF A;  1GYT A;  2V8D A;  3CXS A;  4YWY A;  4NJQ A;  4ZY2 A;  3N5F A;  5G20 A;  7CPA A;  4M6G A;  4ZY1 A;  4KOW A;  2F5I A;  3S9N A;  2JZE A;  4ZYQ A;  3NH8 A;  3S6G A;  2Q51 A;  3FEE A;  4KS9 A;  4C2Y A;  3IEH A;  4AVB A;  2HV2 A;  4AG7 A;  4X2T A;  2KCW A;  2ZW6 A;  5EMI A;  1YSJ A;  1TF8 A;  2B4D B;  1HEE A;  3BLN A;  3JVN A;  2REF A;  3PBE A;  4QC6 A;  3IJ3 A;  1KWM A;  4KSA A;  5KTA A;  5G21 A;  2JEW A;  1IIC A;  4ABL A;  3I3G A;  3D4U A;  2CNM A;  1M4L A;  3RBU A;  3T8W A;  5EC4 A;  2EWB A;  4UML A;  3JTK A;  2KQV A;  1XMB A;  4M6H A;  3D3S A;  1UFH A;  2I79 A;  4JGK A;  1Z5R A;  1XMT A;  4B5P B;  4PSW A;  4P4I A;  2P6E A;  3LWU A;  4FD6 A;  1IGB A;  4H6U A;  1V0C A;  1YVK A;  1WWZ A;  4BIN A;  5HOL A;  1F2O A;  2ANP A;  1CPX A;  3HUV A;  3L2N A;  2L8R A;  1ZO0 A;  2QYV A;  1CX8 A;  5LRG A;  2W2G A;  1YQE A;  2X7B A;  4RUH A;  5KTD A;  2JZF A;  5K8N A;  3EY5 A;  4KOR A;  2PJ5 A;  4OAE A;  4IAV A;  4KSI A;  5FSX A;  1QSO A;  4RN7 A;  3EW5 A;  1ARM A;  2EO8 A;  2FE7 A;  2F7V A;  2VRI A;  4OC2 A;  2AJ6 A;  2YND A;  3KZW A;  3LAC A;  6CPA A;  4H6Z A;  2FG1 A;  2CNT A;  3ETI A;  1Z4E A;  2JEV A;  4ETK A;  4MY0 A;  4BBH A;  4R3K A;  3VAT A;  1BPN A;  3BHX A;  3RAM A;  4QB9 A;  5IX3 A;  3K9T A;  4KSF A;  3TO9 A;  3EKE A;  5AG4 A;  4UCM A;  4LX9 A;  1BOB A;  3SIH A;  3PRT A;  4A30 A;  2AFU A;  2ZEP A;  3N7Z A;  2Z3O A;  4RI1 A;  3EWQ A;  1XOV A;  3NFZ A;  3CPX A;  5CPA A;  3TOA A;  2OZH A;  3WC6 A;  1QSN A;  3T9Y A;  5DWM A;  2EK8 A;  1LAN A;  5A28 A;  1Y9W A;  3D7D A;  3WAB A;  4YU9 A;  1ELM P;  2VQY A;  2CY2 A;  4ZY0 A;  3IFE A;  3R96 A;  4J3G A;  4X5K A;  3S6F A;  2EEE A;  1ZR3 A;  3B3V A;  2O53 A;  1NSA A;  3DLJ A;  3IC1 A;  1TXZ A;  4M3S A;  3FRM A;  4IQY A;  4R6T A;  4C2X A;  1OBR A;  4FBE A;  2GLJ A;  1I1D A;  4R87 A;  1Z8T A;  2PDO A;  5HVF A;  4Z65 A;  3JZT A;  2JDC A;  2PJA A;  3H5Z A;  3BJ8 A;  3F8K A;  2PR1 A;  4NJR A;  1U6M A;  2QML A;  1LFW A;  4Y49 C;  1YD9 A;  1JWQ A;  5K8O A;  2DX6 A;  2PJ8 A;  2DPT A;  2R1I A;  2OZU A;  3GPQ A;  3QAH A;  1SPV A;  1CPS A;  3D8P A;  4DNC A;  4QVT A;  1Z9U A;  4TNU A;  2B58 A;  1R57 A;  2Y0M A;  3PFE A;  5ELY A;  3GB0 A;  3ISZ A;  4F6A A;  2YGW A;  3UY5 A;  1K4J A;  2XD7 A;  1JQG A;  2PRB A;  4XNH B;  3F0A A;  2PVV A;  3PEI A;  1Q2C A;  2Q44 A;  4CAV A;  1ZLI A;  4MXU A;  1M4I A;  4F9V A;  1MJA A;  4P44 A;  4EME A;  3D67 A;  5CB3 A;  2WPX A;  2YNE A;  3VH9 A;  3ZZI A;  4DUK A;  1A2Z A;  4MI4 A;  4EFD A;  5HXD A;  1ELL P;  4JWP A;  3WR7 A;  3PB4 X;  4P6Y A;  2A4N A;  2WZN A;  3SJX A;  3SI0 A;  2IQ6 A;  2RNK A;  5FSY A;  1S60 A;  2BO9 A;  2Z3M A;  1BO4 A;  4MBU A;  1IOF A;  4H2K A;  4OIW A;  1Y7E A;  3GQE A;  1XRY A;  1ZG9 A;  3PFO A;  5EBV A;  3TCV A;  2JBJ A;  1Z8X A;  2BOA A;  4LQG A;  5KTC A;  4ESS A;  2ZEM A;  4K30 A;  4X3R A;  4KVX A;  4KUB A;  5GCN A;  1NSL A;  3WC7 A;  3IWG A;  4CAW A;  2Z0Z A;  2Q7B A;  4CYP A;  5I4M A;  1TXR A;  4P4E A;  3R95 A;  2NYQ A;  3FYN A;  1UWY A;  1P0H A;  1XJO A;  2YNC A;  3IU1 A;  3FED A;  2ZXV A;  2Z3N A;  1AUG A;  2WSA A;  4YRH A;  1TF9 A;  1Q7L A;  3CXP A;  4MHN A;  5H84 A;  3JRU A;  4U9Y A;  2HQY A;  4K0C A;  2NMT A;  5K8M A;  1M4G A;  4UCP A;  3SJE A;  5HIH A;  2EUI A;  4KOU A;  2C1C A;  1VHU A;  2DEA A;  4MY3 A;  2PJC A;  1FY7 A;  8CPA A;  2AFC A;  4UEF A;  4MHD A;  4C2Z A;  2PVW A;  1PUA A;  2BSW A;  2R7H A;  4HKF A;  4D86 A;  2EVN A;  2O4H A;  2CNS A;  1XIX A;  2Q4Z A;  1ZLH A;  2P6G A;  3FVL A;  4OME A;  4CGL A;  3SI1 A;  2D4O A;  3Q71 A;  2VEZ A;  3DDD A;  2OH1 A;  4P45 A;  3DGV A;  1ON0 A;  2IJZ A;  4NGP A;  1YW6 A;  4GM5 A;  4A32 A;  4A38 A;  4CGP A;  3LD2 A;  3B35 A;  2Q7S A;  3B2Y A;  3NE8 A;  5AG5 A;  2B3V A;  4CYO A;  4F8Z A;  4KOV A;  2ATR A;  4ONU A;  1S3Z A;  4AVC A;  1YK3 A;  3KR5 A;  4MHY A;  1KUX A;  4PPZ A;  4PXB A;  3KKW A;  2DF5 A;  2LGR A;  2GFQ A;  2PJ6 A;  2ZEO A;  3EXN A;  4WJB A;  4PXC A;  1PU9 A;  4NFR A;  1B87 A;  3B3S A;  4MFQ A;  3DNS A;  2R98 A;  4KVO E;  3SIG A;  1CP7 A;  3CDX A;  4K3N A;  1HDU A;  2Z3P A;  4MFP A;  2NSM A;  4Q38 A;  2PIY A;  4OKO A;  4TWE A;  5F48 A;  3V45 A;  4A2Z A;  3KAS A;  2CXA A;  3FH4 A;  1YVO A;  2ZEH A;  4HNX B;  5CNP A;  4OC0 A;  4P4B A;  2I00 A;  4J5R A;  1KUV A;  3NE7 A;  2XEJ A;  2XEF A;  3D68 A;  4RS2 A;  5LYL A;  5E96 A;  4R57 A;  3PB9 X;  4UWJ A;  4C7H A;  3TC8 A;  3KQX A;  2PJ3 A;  5FVJ A;  2J8R A;  2BFR A;  3G8W A;  2FAV A;  4XPK A;  3IGR A;  1MJB A;  3CPA A;  2G3A A;  4UFX A;  3W6S A;  4EWT A;  4BMH A;  5H86 A;  2PCU A;  4FAI A;  5D29 A;  1NJR A;  5F49 A;  1FNO A;  5LYD A;  2WPW A;  5G1Z A;  3FIX A;  3B3W A;  3CXQ A;  2HC9 A;  2CTC A;  3A9L A;  3IU2 A;  4FD7 A;  1ARL A;  1OZP A;  4M6I A;  3RZA A;  5J8C A;  1QSR A;  4BD9 A;  4CYQ A;  1AMP A;  2CIJ A;  2ZEN A;  4NGN A;  1DTD A;  4PSX A;  1MJ9 A;  4ABK A;  3P2H A;  2I3C A;  4PXE A;  4AVA A;  3SII A;  2OU2 A;  1CM0 A;  3KL9 A;  4C68 A;  4II9 A;  4MFL A;  3BI1 A;  1YW4 A;  4R9M A;  1S7L A;  3PP9 A;  4ZI6 A;  2FIA A;  4X8I A;  4ETJ A;  2GU2 A;  4FUU A;  2GRE A;  2PJB A;  1F2P A;  3CZX A;  2VL1 A;  4W9Y A;  3TTH A;  2PE3 A;  2PJ7 A;  3MN8 A;  4MHP A;  1LCP A;  4A95 A;  2B4D A;  4UIB A;  2G3T A;  3R1K A;  4IHM A;  4ORF A;  3TX8 A;  4U9Z A;  5HVH A;  4A39 A;  4UF4 A;  5JQ4 A;  1ZR5 A;  1VHE A;  3H8F A;  4J5Q A;  4R3L A;  1IYL A;  1Q2Y A;  1Z8W A;  2AFS A;  2JLM A;  2QVP A;  2VZY A;  4O23 A;  2B5G B;  2OB0 A;  4CGM A;  3DR8 A;  4B10 A;  4J4Z A;  1IYK A;  5HH1 A;  3GUX A;  4KZT A;  3RNZ A;  3W91 A;  4B5P A;  2PJ4 A;  2XEI A;  1R3N A;  5JPH A;  4OP4 A;  2ZOF A;  1YRE A;  2H5M A;  5IB0 A;  2J8M A;  3BXM A;  1X12 A;  1HJZ A;  2Z3L A;  3FJU A;  4KYB A;  2ZPA A;  3H8E A;  4ZX9 A;  1KZF A;  1XF8 A;  2Z3K A;  3D2P A;  4UIA A;  1GHE A;  4CRY B;  4P10 A;  4C7I A;  2AFX A;  2R8V A;  4JLL A;  4UWI A;  3SXN A;  3TFY A;  2D4P A;  2AFM A;  2QJ8 A;  5LRJ A;  2CF4 A;  4KOT A;  5AGE A;  1VKC A;  4E2A A;  4DYO A;  3E0K A;  4UFW A;  3SHP A;  2QIR A;  4PQA A;  3D2M A;  4UBR A;  3D66 A;  3EO4 A;  1XFO A;  3FEC A;  1TY8 A;  4MRI A;  5DUS A;  2DPS A;  5C82 A;  2VXK A;  3LMS A;  1QST A;  4MMO A;  2C27 A;  1MK4 A;  3SJF A;  3GPO A;  4JCA A;  1Z4R A;  3NH5 A;  4LQ6 A;  3IIF A;  5J8F A;  5LYF A;  2GIV A;  5A27 A;  3FB3 A;  1HDQ A;  4XNH C;  2POK A;  3RYO A;  4U5Y A;  2VI7 A;  3S9L A;  2ZEE A;  3F5B A;  3H4Q A;  4F9U A;  4LUA A;  1BLL E;  1IB1 E;  3B3C A;  2QEC A;  4JXQ A;  3PBB A;  3GQO A;  4NEX A;  4XPD B;  2PJ1 A;  5HMN A;  2JZD A;  4GXH A;  4A37 A;  2AE6 A;  2OOT A;  5CB5 A;  2O28 A;  3TOB A;  4EVY A;  4H89 A;  2JBK A;  4P4D A;  3GLJ A;  1VHS A;  3S6H A;  1N71 A;  4NSQ A;  2PQ8 A;  2F8H A;  1XBU A;  4OC1 A;  1Q2D A;  2GLF A;  4CRZ B;  3W6X A;  3MGD A;  2ZEG A;  4JXR A;  1X10 A;  1S7N A;  4HNW B;  2AFZ A;  2V77 A;  1CBX A;  1Y9K A;  2VBQ A;  2FT0 A;  2IL4 A;  4B5O A;  3PGP A;  4A31 A;  2BFQ A;  2Q04 A;  5BWA B;  3QB8 A;  3GY9 A;  5C88 A;  2C6C A;  2G9D A;  5AG6 A;  1YLO A;  1Y0R A;  4MJ8 A;  3R9F A;  3OWC A;  4XPL A;  3S6K A;  4YFJ A;  3RO0 A;  3FXT A;  4B12 A;  5IV0 A;  2PRQ A;  2Q4V A;  3ISX A;  2V8V A;  3FBU A;  5LYI A;  4MCS A;  5AIL A;  2HUZ A;  5JM6 A;  5F09 A;  3BI0 A;  2AFO A;  2IMO A;  4KVM E;  5HVG A;  2Q4Y A;  4ZBG A;  2FXK A;  2ARH A;  3TT2 A;  4KLW A;  4MCP A;  3P2F A;  3I1U A;  4CGN A;  1TKF A;  2FIW A;  3EJF A;  2PJ0 A;  3KGQ A;  3EFA A;  2BEI A;  3FNC A;  4TU0 A;  1QSM A;  2ZEF A;  2JDD A;  3DR6 A;  1M4D A;  1LAM A;  4OC5 A;  4MHZ A;  3V8I A;  2BCO A;  1YLE A;  4CAF A;  1Y0Y A;  3PB8 X;  2OZG A;  2RC4 A;  1RXT A;  3FF3 A;  3NA6 A;  4R7M A;  1J4J A;  1Z2L A;  3T90 A;  1H8L A;  3H8G A;  2HB6 A;  3SJG A;  3B8G A;  4PK3 A;  1RO5 A;  2FS5 A;  1CJW A;  5ISV A;  5J1Q A;  1M44 A;  1S5K A;  4FD4 A;  4IK2 A;  2PJ9 A;  2ODF A;  1LRZ A;  4OC3 A;  4NF1 A;  2V8H A;  2X47 A;  3PB6 X;  3R9E A;  4P4J A;  4Q7A A;  4QUS A;  3IWE A;  4CAE A;  2ZW4 A;  3TE4 A;  5IB9 A;  2Z10 A;  2C6P A;  2GAN A;  5FSU A;  2FVG A;  3KI9 A;  4NXY A;  3TO6 A;  5JH9 A;  1TIQ A;  4G1P A;  3V2B A;  3MRU A;  3QAY A;  4PK2 A;  5F47 A;  4L8A A;  3GIU A;  1M1D A;  5FSZ A;  3VFQ A;  2OR4 A;  4R76 A;  5D8N A;  4OID A;  4ZGY B;  3R9G A;  4QBJ A;  1F57 A;  3WC5 A;  4M85 A;  3D7F A;  2B4B A;  3K2K A;  3IIB A;  4E0A A;  4IUS A;  5FSV A;  3VWD A;  1IID A;  1QQ9 A;  1LOK A;  2VZZ A;  3GKR A;  3VAR A;  1BPM A;  1IOI A;  4UCN A;  2PJ2 A;  2J9A A;  1B6B A;  2ZW7 A;  2ACF A;  3C26 A;  1Y7R A;  3CT9 A;  2PIZ A;  4WWV A;  4CPA A;  3B3T A;  4Y49 B;  4UEE A;  2XEG A;  2ZED A;  3SI2 A;  1EE3 P;  1YR0 A;  1YGH A;  5G22 A;  3LOD A;  2P6F A;  4CS0 B;  2G0B A;  4DJL A;  3WT4 A;  2B3U A;  3GPG A;  3IO1 A;  4NCZ A;  1YX0 A;  2C6G A;  4ONW A;  4GVV A;  1P4N A;  3ZJ0 A;  4E8O A;  2ZEL A;  3KHZ A;  3EJG A;  4Q36 A;  4AB7 A;  3Q6Z A;  1VGY A;  1RTQ A;  3EC4 A;  4NGQ A;  4B13 A;  4MCQ A;  2EK9 A;  3KHX A;  2ABZ A;  4KLV A;  2PSW A;  5CMS A;  4NGR A;  4JD6 A;  4OLL A;  5I0C A;  4NGT A;  4P4F A;  5AG7 A;  1ZG7 A;  1I12 A;  3VWE A;  2CTB A;  4CGO A;  1R43 A;  2GE3 A;  1L0C A;  1LAP A;  2K5T A;  4JJX A;  2PC1 A;  4KOS A;  4A33 A;  3B7I A;  2BL1 A;  3V38 A;  4B14 A;  3G3S A;  2YNC C;  4GS4 A;  3KQZ A;  4JVV A;  4KUA A;  4PV6 A;  4R8F A;  1IU8 A;  2FSR A;  2Q43 A;  1PYT B;  3S9M A;  1WK4 A;  1IY7 A;  2EBJ A;  2WYR A;  4NGM A;  2PR8 A;  3FX6 A;  5CBM A;  1XE4 A;  2REE A;  5THW A;  4HNY B;  1I21 A;  2ZW5 A;  4JLY A; 
#chains in the Genus database with same CATH homology
 3HLP A;  3EWO A;  5E3B A;  1BAV A;  1QMU A;  1YME A;  3PB7 X;  4UEZ A;  3KR4 A;  1TKH A;  2ZOG A;  4J5S A;  4NGS A;  3SIJ A;  4A94 A;  4GVW A;  2RB7 A;  3FMC A;  4GUA A;  3EWP A;  4JZ0 A;  1FT7 A;  4FWU A;  1CG2 A;  1PCA A;  3QNV A;  1VHO A;  5K8P A;  2AFW A;  4B6Z A;  1VIX A;  4MCR A;  4OC4 A;  5LRK A;  1AYE A;  3NH4 A;  4ZX8 A;  3V7Z A;  3EWR A;  1CP6 A;  3IWW A;  2RFH A;  4JYW A;  5DS0 A;  4AXV A;  3D7H A;  3D7G A;  4PXD A;  1Z8L A;  3IID A;  1DE4 C;  1ZG8 A;  1TKJ A;  2V8G A;  5JGF A;  1GYT A;  2V8D A;  4YWY A;  4NJQ A;  4ZY2 A;  3N5F A;  7CPA A;  4ZY1 A;  3S9N A;  4ZYQ A;  3NH8 A;  2Q51 A;  3FEE A;  3IEH A;  4X2T A;  1YSJ A;  1TF8 A;  1HEE A;  3PBE A;  3IJ3 A;  1KWM A;  2JEW A;  4ABL A;  3D4U A;  1M4L A;  3RBU A;  3T8W A;  2EWB A;  4UML A;  1XMB A;  4JGK A;  1Z5R A;  4P4I A;  3LWU A;  1IGB A;  5HOL A;  1F2O A;  2ANP A;  1CPX A;  3HUV A;  3L2N A;  2L8R A;  2QYV A;  1CX8 A;  5LRG A;  4RUH A;  5K8N A;  2PJ5 A;  4IAV A;  4KSI A;  5FSX A;  3EW5 A;  1ARM A;  2F7V A;  2VRI A;  4OC2 A;  3KZW A;  6CPA A;  2FG1 A;  3ETI A;  4ETK A;  3VAT A;  1BPN A;  3BHX A;  3RAM A;  3K9T A;  3EKE A;  3SIH A;  3PRT A;  2AFU A;  2ZEP A;  3EWQ A;  3NFZ A;  3CPX A;  5CPA A;  3WC6 A;  2EK8 A;  1LAN A;  3D7D A;  3WAB A;  4YU9 A;  1ELM P;  4ZY0 A;  3IFE A;  2EEE A;  1ZR3 A;  3B3V A;  2O53 A;  1NSA A;  3DLJ A;  3IC1 A;  1TXZ A;  4IQY A;  4R6T A;  1OBR A;  4FBE A;  2GLJ A;  5HVF A;  4Z65 A;  3JZT A;  2PJA A;  4NJR A;  1LFW A;  1YD9 A;  5K8O A;  2DX6 A;  2PJ8 A;  3GPQ A;  1SPV A;  1CPS A;  4TNU A;  3PFE A;  5ELY A;  3GB0 A;  3ISZ A;  2XD7 A;  1JQG A;  2PVV A;  3PEI A;  4F9V A;  1ZLI A;  4MXU A;  4P44 A;  4EME A;  3D67 A;  5CB3 A;  4DUK A;  3VH9 A;  4EFD A;  5HXD A;  1ELL P;  3PB4 X;  4P6Y A;  2WZN A;  3SJX A;  3SI0 A;  2IQ6 A;  2BO9 A;  5FSY A;  4H2K A;  4OIW A;  1Y7E A;  3GQE A;  1XRY A;  1ZG9 A;  3PFO A;  2JBJ A;  2BOA A;  4LQG A;  4ESS A;  2ZEM A;  4X3R A;  3WC7 A;  5I4M A;  1TXR A;  4P4E A;  2NYQ A;  1UWY A;  1XJO A;  3FED A;  1TF9 A;  1Q7L A;  4MHN A;  3JRU A;  5K8M A;  4K0C A;  3SJE A;  5HIH A;  2C1C A;  1VHU A;  2DEA A;  2PJC A;  8CPA A;  2AFC A;  4UEF A;  2PVW A;  4D86 A;  2O4H A;  2Q4Z A;  1ZLH A;  4OME A;  3FVL A;  3SI1 A;  3Q71 A;  4P45 A;  3DGV A;  4NGP A;  2IJZ A;  1YW6 A;  4GM5 A;  4A38 A;  3B35 A;  3B2Y A;  4F8Z A;  3KR5 A;  4MHY A;  4PPZ A;  4PXB A;  2LGR A;  2PJ6 A;  2ZEO A;  4WJB A;  4PXC A;  4NFR A;  3B3S A;  3SIG A;  1CP7 A;  3CDX A;  4K3N A;  1HDU A;  2NSM A;  2PIY A;  4OKO A;  4TWE A;  3V45 A;  3KAS A;  3FH4 A;  2ZEH A;  4OC0 A;  4P4B A;  4J5R A;  2XEJ A;  2XEF A;  3D68 A;  5LYL A;  3PB9 X;  3TC8 A;  2PJ3 A;  3KQX A;  2BFR A;  2FAV A;  3CPA A;  4EWT A;  2PCU A;  4FAI A;  5D29 A;  1NJR A;  1FNO A;  5LYD A;  3B3W A;  2HC9 A;  2CTC A;  1ARL A;  3RZA A;  4BD9 A;  1AMP A;  2CIJ A;  2ZEN A;  4NGN A;  1DTD A;  4PXE A;  4ABK A;  2I3C A;  3SII A;  3KL9 A;  3BI1 A;  1YW4 A;  4X8I A;  4ZI6 A;  4ETJ A;  2GU2 A;  4FUU A;  2GRE A;  2PJB A;  1F2P A;  4W9Y A;  2VL1 A;  2PE3 A;  2PJ7 A;  3MN8 A;  4MHP A;  1LCP A;  4UIB A;  3TX8 A;  4IHM A;  5HVH A;  4A39 A;  4UF4 A;  1ZR5 A;  1VHE A;  3H8F A;  4J5Q A;  2AFS A;  2QVP A;  4O23 A;  4J4Z A;  3GUX A;  2PJ4 A;  2XEI A;  1R3N A;  4OP4 A;  2ZOF A;  3BXM A;  3FJU A;  1HJZ A;  4KYB A;  3H8E A;  4ZX9 A;  4UIA A;  4P10 A;  2AFX A;  4JLL A;  2AFM A;  2QJ8 A;  5LRJ A;  2CF4 A;  4DYO A;  4PQA A;  3D66 A;  3FEC A;  1XFO A;  1TY8 A;  4MRI A;  5DUS A;  3LMS A;  4MMO A;  3SJF A;  3GPO A;  4JCA A;  3NH5 A;  3IIF A;  5LYF A;  1HDQ A;  2POK A;  3S9L A;  2ZEE A;  4F9U A;  1BLL E;  3B3C A;  3PBB A;  3GQO A;  2PJ1 A;  4A37 A;  2OOT A;  5CB5 A;  2JBK A;  4P4D A;  3GLJ A;  2F8H A;  1XBU A;  4OC1 A;  2GLF A;  2ZEG A;  2AFZ A;  2V77 A;  1CBX A;  2BFQ A;  2C6C A;  2G9D A;  1YLO A;  1Y0R A;  2PRQ A;  3ISX A;  2V8V A;  5LYI A;  4MCS A;  5AIL A;  5JM6 A;  5F09 A;  3BI0 A;  2AFO A;  2IMO A;  5HVG A;  2FXK A;  4MCP A;  3I1U A;  1TKF A;  2PJ0 A;  3EJF A;  3KGQ A;  4TU0 A;  2ZEF A;  4OC5 A;  1LAM A;  4MHZ A;  2BCO A;  1Y0Y A;  3PB8 X;  3NA6 A;  3FF3 A;  4R7M A;  1Z2L A;  1H8L A;  3H8G A;  2HB6 A;  3SJG A;  5J1Q A;  4IK2 A;  2PJ9 A;  4OC3 A;  2V8H A;  2X47 A;  3PB6 X;  4P4J A;  4Q7A A;  5IB9 A;  2C6P A;  5FSU A;  2FVG A;  3KI9 A;  5JH9 A;  4G1P A;  3V2B A;  3MRU A;  5FSZ A;  3VFQ A;  2OR4 A;  4R76 A;  5D8N A;  4OID A;  1F57 A;  3WC5 A;  3D7F A;  3K2K A;  3IIB A;  5FSV A;  1QQ9 A;  1LOK A;  3VAR A;  1BPM A;  2PJ2 A;  2J9A A;  2ACF A;  3CT9 A;  2PIZ A;  4WWV A;  4CPA A;  3B3T A;  4UEE A;  2XEG A;  2ZED A;  3SI2 A;  1EE3 P;  4DJL A;  3WT4 A;  3GPG A;  3IO1 A;  2C6G A;  4ONW A;  4GVV A;  2ZEL A;  3KHZ A;  3EJG A;  3Q6Z A;  1VGY A;  1RTQ A;  4NGQ A;  4MCQ A;  2EK9 A;  3KHX A;  2ABZ A;  5CMS A;  4NGR A;  4NGT A;  4P4F A;  1ZG7 A;  2CTB A;  1R43 A;  1LAP A;  3B7I A;  3V38 A;  3KQZ A;  4JVV A;  4R8F A;  2Q43 A;  1PYT B;  3S9M A;  2WYR A;  1IY7 A;  4NGM A;  3FX6 A;  5CBM A;  5THW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...