5FSYA

Crystal structure of trypanosoma brucei macrodomain in complex with adp-ribose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
232
Chain Sequence
EFVTYSGEESPTRTRILSAALSPAERAIFDVPIEKWLSIDRSSLSGWKCAVPRPVTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLLLRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGERPDMLRKCYRSILSLALKNGLRSIGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MACRODOMAIN
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 82
structure length 232
sequence length 249
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fsyA00
3V45A 2J9AA 3GQEA 3IIFA 4IQYA 4R7MA 5HIHA 2X47A 4K0CA 4TU0A 1LAPA 1LAMA 4ZY2A 3VFQA 3KQXA 3KR5A 1YD9A 1GYTA 4X2TA 4JLLA 4GVWA 4ABKA 5CMSA 5E3BA 3SIHA 5FSZA 1SPVA 4K3NA 5DUSA 4GVVA 5FSVA 2XD7A 4ABLA 3GPQA 5CB5A 3H8GA 3EKEA 3GPGA 1LANA 5CBMA 3SIIA 3ETIA 3V2BA 3EW5A 3T8WA 5FSXA 2FG1A 5AILA 4ZY1A 4ZI6A 3EJFA 4D86A 5CB3A 3EWRA 4J5SA 4UMLA 4ESSA 3H8FA 1BPMA 3JZTA 3KZWA 3EWQA 1HJZA 4ZX8A 1TY8A 4GUAA 3GQOA 2FAVA 3Q71A 4ETKA 4JCAA 4J5RA 5FSYA 1BLLE 2EEEA 3KQZA 3SIGA 4ZX9A 3H8EA 2BFRA 3EJGA 5FSUA 2L8RA 1ZR3A 5D8NA 3IIDA 4ZY0A 3JRUA 1TXZA 1ZR5A 3PEIA 2ACFA 1BPNA 1VHUA 4J5QA 4J4ZA 4ZYQA 1NJRA 3GPOA 2LGRA 3Q6ZA 4JGKA 4ETJA 4JVVA 3IJ3A 3KR4A 2BFQA 2EWBA 4KSIA 1LCPA 2AFCA 4KYBA 3EWOA 4R6TA 2DX6A 2VRIA 3EWPA 3SIJA 5HOLA 4R76A 2FXKA
chains in the Genus database with same CATH superfamily
3V45A 2J9AA 3GQEA 3IIFA 4IQYA 4R7MA 5HIHA 2X47A 4K0CA 4TU0A 1LAPA 1LAMA 4ZY2A 3VFQA 3KQXA 3KR5A 1YD9A 1GYTA 4X2TA 4JLLA 4GVWA 4ABKA 5CMSA 5E3BA 3SIHA 5FSZA 1SPVA 4K3NA 5DUSA 4GVVA 5FSVA 2XD7A 4ABLA 3GPQA 5CB5A 3H8GA 3EKEA 3GPGA 1LANA 2JZFA 5CBMA 3SIIA 3ETIA 3V2BA 3EW5A 3T8WA 5FSXA 2FG1A 5AILA 4ZY1A 4ZI6A 3EJFA 4D86A 5CB3A 3EWRA 4J5SA 4UMLA 4ESSA 3H8FA 1BPMA 3JZTA 3KZWA 2JZDA 3EWQA 1HJZA 2KQVA 4ZX8A 1TY8A 4GUAA 3GQOA 2RNKA 2FAVA 3Q71A 4ETKA 4JCAA 4J5RA 5FSYA 1BLLE 2EEEA 3KQZA 3SIGA 4ZX9A 3H8EA 2BFRA 2WCTA 3EJGA 5FSUA 2L8RA 1ZR3A 5D8NA 3IIDA 4ZY0A 3JRUA 1TXZA 1ZR5A 3PEIA 2ACFA 1BPNA 1VHUA 4J5QA 4J4ZA 2JZEA 4ZYQA 1NJRA 3GPOA 2LGRA 3Q6ZA 4JGKA 2W2GA 4JVVA 4ETJA 3IJ3A 3KR4A 2BFQA 2EWBA 4KSIA 1LCPA 2AFCA 4KYBA 3EWOA 4R6TA 2DX6A 2VRIA 3EWPA 3SIJA 5HOLA 4R76A 2FXKA
chains in the Genus database with same CATH topology
3V45A 2J9AA 3GQEA 3IIFA 4IQYA 4R7MA 5HIHA 2X47A 4K0CA 4TU0A 1LAPA 1LAMA 4ZY2A 3VFQA 3KQXA 3KR5A 1YD9A 1GYTA 4X2TA 4JLLA 4GVWA 4ABKA 5CMSA 5E3BA 3SIHA 5FSZA 1SPVA 4K3NA 5DUSA 4GVVA 5FSVA 2XD7A 4ABLA 3GPQA 5CB5A 3H8GA 3EKEA 3GPGA 1LANA 5CBMA 3SIIA 3ETIA 3V2BA 3EW5A 3T8WA 5FSXA 2FG1A 5AILA 4ZY1A 4ZI6A 3EJFA 4D86A 5CB3A 3EWRA 4J5SA 4UMLA 4ESSA 3H8FA 1BPMA 3JZTA 3KZWA 3EWQA 1HJZA 4ZX8A 1TY8A 4GUAA 3GQOA 2FAVA 3Q71A 4ETKA 4JCAA 4J5RA 5FSYA 1BLLE 2EEEA 3KQZA 3SIGA 4ZX9A 3H8EA 2BFRA 3EJGA 5FSUA 2L8RA 1ZR3A 5D8NA 3IIDA 4ZY0A 3JRUA 1TXZA 1ZR5A 3PEIA 2ACFA 1BPNA 1VHUA 4J5QA 4J4ZA 4ZYQA 1NJRA 3GPOA 2LGRA 3Q6ZA 4JGKA 4ETJA 4JVVA 3IJ3A 3KR4A 2BFQA 2EWBA 4KSIA 1LCPA 2AFCA 4KYBA 3EWOA 4R6TA 2DX6A 2VRIA 3EWPA 3SIJA 5HOLA 4R76A 2FXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V45 A;  2J9A A;  3GQE A;  3IIF A;  4IQY A;  4R7M A;  5HIH A;  2X47 A;  4K0C A;  4TU0 A;  1LAP A;  1LAM A;  4ZY2 A;  3VFQ A;  3KQX A;  3KR5 A;  1YD9 A;  1GYT A;  4X2T A;  4JLL A;  4GVW A;  4ABK A;  5CMS A;  5E3B A;  3SIH A;  5FSZ A;  1SPV A;  4K3N A;  5DUS A;  4GVV A;  5FSV A;  2XD7 A;  4ABL A;  3GPQ A;  5CB5 A;  3H8G A;  3EKE A;  3GPG A;  1LAN A;  5CBM A;  3SII A;  3ETI A;  3V2B A;  3EW5 A;  3T8W A;  5FSX A;  2FG1 A;  5AIL A;  4ZY1 A;  4ZI6 A;  3EJF A;  4D86 A;  5CB3 A;  3EWR A;  4J5S A;  4UML A;  4ESS A;  3H8F A;  1BPM A;  3JZT A;  3KZW A;  3EWQ A;  1HJZ A;  4ZX8 A;  1TY8 A;  4GUA A;  3GQO A;  2FAV A;  3Q71 A;  4ETK A;  4JCA A;  4J5R A;  5FSY A;  1BLL E;  2EEE A;  3KQZ A;  3SIG A;  4ZX9 A;  3H8E A;  2BFR A;  3EJG A;  5FSU A;  2L8R A;  1ZR3 A;  5D8N A;  3IID A;  4ZY0 A;  3JRU A;  1TXZ A;  1ZR5 A;  3PEI A;  2ACF A;  1BPN A;  1VHU A;  4J5Q A;  4J4Z A;  4ZYQ A;  1NJR A;  3GPO A;  2LGR A;  3Q6Z A;  4JGK A;  4ETJ A;  4JVV A;  3IJ3 A;  3KR4 A;  2BFQ A;  2EWB A;  4KSI A;  1LCP A;  2AFC A;  4KYB A;  3EWO A;  4R6T A;  2DX6 A;  2VRI A;  3EWP A;  3SIJ A;  5HOL A;  4R76 A;  2FXK A; 
#chains in the Genus database with same CATH topology
 3V45 A;  2J9A A;  3GQE A;  3IIF A;  4IQY A;  4R7M A;  5HIH A;  2X47 A;  4K0C A;  4TU0 A;  1LAP A;  1LAM A;  4ZY2 A;  3VFQ A;  3KQX A;  3KR5 A;  1YD9 A;  1GYT A;  4X2T A;  4JLL A;  4GVW A;  4ABK A;  5CMS A;  5E3B A;  3SIH A;  5FSZ A;  1SPV A;  4K3N A;  5DUS A;  4GVV A;  5FSV A;  2XD7 A;  4ABL A;  3GPQ A;  5CB5 A;  3H8G A;  3EKE A;  3GPG A;  1LAN A;  2JZF A;  5CBM A;  3SII A;  3ETI A;  3V2B A;  3EW5 A;  3T8W A;  5FSX A;  2FG1 A;  5AIL A;  4ZY1 A;  4ZI6 A;  3EJF A;  4D86 A;  5CB3 A;  3EWR A;  4J5S A;  4UML A;  4ESS A;  3H8F A;  1BPM A;  3JZT A;  3KZW A;  2JZD A;  3EWQ A;  1HJZ A;  2KQV A;  4ZX8 A;  1TY8 A;  4GUA A;  3GQO A;  2RNK A;  2FAV A;  3Q71 A;  4ETK A;  4JCA A;  4J5R A;  5FSY A;  1BLL E;  2EEE A;  3KQZ A;  3SIG A;  4ZX9 A;  3H8E A;  2BFR A;  2WCT A;  3EJG A;  5FSU A;  2L8R A;  1ZR3 A;  5D8N A;  3IID A;  4ZY0 A;  3JRU A;  1TXZ A;  1ZR5 A;  3PEI A;  2ACF A;  1BPN A;  1VHU A;  4J5Q A;  4J4Z A;  2JZE A;  4ZYQ A;  1NJR A;  3GPO A;  2LGR A;  3Q6Z A;  4JGK A;  2W2G A;  4JVV A;  4ETJ A;  3IJ3 A;  3KR4 A;  2BFQ A;  2EWB A;  4KSI A;  1LCP A;  2AFC A;  4KYB A;  3EWO A;  4R6T A;  2DX6 A;  2VRI A;  3EWP A;  3SIJ A;  5HOL A;  4R76 A;  2FXK A; 
#chains in the Genus database with same CATH homology
 3V45 A;  2J9A A;  3GQE A;  3IIF A;  4IQY A;  4R7M A;  5HIH A;  2X47 A;  4K0C A;  4TU0 A;  1LAP A;  1LAM A;  4ZY2 A;  3VFQ A;  3KQX A;  3KR5 A;  1YD9 A;  1GYT A;  4X2T A;  4JLL A;  4GVW A;  4ABK A;  5CMS A;  5E3B A;  3SIH A;  5FSZ A;  1SPV A;  4K3N A;  5DUS A;  4GVV A;  5FSV A;  2XD7 A;  4ABL A;  3GPQ A;  5CB5 A;  3H8G A;  3EKE A;  3GPG A;  1LAN A;  5CBM A;  3SII A;  3ETI A;  3V2B A;  3EW5 A;  3T8W A;  5FSX A;  2FG1 A;  5AIL A;  4ZY1 A;  4ZI6 A;  3EJF A;  4D86 A;  5CB3 A;  3EWR A;  4J5S A;  4UML A;  4ESS A;  3H8F A;  1BPM A;  3JZT A;  3KZW A;  3EWQ A;  1HJZ A;  4ZX8 A;  1TY8 A;  4GUA A;  3GQO A;  2FAV A;  3Q71 A;  4ETK A;  4JCA A;  4J5R A;  5FSY A;  1BLL E;  2EEE A;  3KQZ A;  3SIG A;  4ZX9 A;  3H8E A;  2BFR A;  3EJG A;  5FSU A;  2L8R A;  1ZR3 A;  5D8N A;  3IID A;  4ZY0 A;  3JRU A;  1TXZ A;  1ZR5 A;  3PEI A;  2ACF A;  1BPN A;  1VHU A;  4J5Q A;  4J4Z A;  4ZYQ A;  1NJR A;  3GPO A;  2LGR A;  3Q6Z A;  4JGK A;  4ETJ A;  4JVV A;  3IJ3 A;  3KR4 A;  2BFQ A;  2EWB A;  4KSI A;  1LCP A;  2AFC A;  4KYB A;  3EWO A;  4R6T A;  2DX6 A;  2VRI A;  3EWP A;  3SIJ A;  5HOL A;  4R76 A;  2FXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...