5FSYA

Crystal structure of trypanosoma brucei macrodomain in complex with adp-ribose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
232
Chain Sequence
EFVTYSGEESPTRTRILSAALSPAERAIFDVPIEKWLSIDRSSLSGWKCAVPRPVTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLLLRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGERPDMLRKCYRSILSLALKNGLRSIGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACRODOMAIN
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
total genus 82
structure length 232
sequence length 249
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fsyA00
1LANA 3JZTA 4TU0A 4KSIA 1TY8A 3GQEA 5AILA 5D8NA 4ZY0A 4KYBA 5CB3A 3H8GA 1BLLE 2L8RA 1ZR5A 4J5SA 1LAMA 2FG1A 5CBMA 4JCAA 4ZX8A 3EJFA 3GPQA 3IJ3A 4ZX9A 5HOLA 4JVVA 4J4ZA 5FSXA 3EWRA 1TXZA 1YD9A 4D86A 3PEIA 5CB5A 4ZI6A 5E3BA 5DUSA 2FAVA 2AFCA 2FXKA 3GQOA 3EWOA 2BFQA 4ZY2A 5FSYA 3EWPA 4JLLA 4R7MA 3SIIA 3EKEA 2VRIA 3V2BA 4R6TA 5FSVA 3KR5A 4ZY1A 2J9AA 4ETJA 3EJGA 3H8FA 5HIHA 3EW5A 1VHUA 4ESSA 4J5RA 2EWBA 3KQZA 3GPOA 3JRUA 2LGRA 1GYTA 3H8EA 4IQYA 5FSZA 3VFQA 3Q71A 4ZYQA 4R76A 1NJRA 4K3NA 3EWQA 4J5QA 2X47A 3SIGA 3IIFA 3Q6ZA 1LCPA 1BPNA 1SPVA 2EEEA 4UMLA 3GPGA 3SIHA 5FSUA 2BFRA 4GUAA 2DX6A 3SIJA 1BPMA 1LAPA 4GVWA 4ABKA 3ETIA 4K0CA 3KR4A 3V45A 4ETKA 2ACFA 4JGKA 5CMSA 3IIDA 3T8WA 3KQXA 4GVVA 1HJZA 3KZWA 2XD7A 4X2TA 1ZR3A 4ABLA
chains in the Genus database with same CATH superfamily
2JZFA 1LANA 3JZTA 4TU0A 4KSIA 1TY8A 3GQEA 5AILA 5D8NA 4ZY0A 4KYBA 2KQVA 5CB3A 3H8GA 1BLLE 2L8RA 1ZR5A 4J5SA 1LAMA 2FG1A 5CBMA 4JCAA 4ZX8A 3EJFA 3GPQA 3IJ3A 4ZX9A 5HOLA 4JVVA 4J4ZA 5FSXA 3EWRA 1TXZA 1YD9A 4D86A 3PEIA 5CB5A 4ZI6A 5E3BA 5DUSA 2FAVA 2AFCA 2FXKA 3GQOA 3EWOA 2BFQA 4ZY2A 5FSYA 3EWPA 4JLLA 4R7MA 3SIIA 3EKEA 2VRIA 3V2BA 2W2GA 4R6TA 5FSVA 3KR5A 4ZY1A 2J9AA 4ETJA 3EJGA 3H8FA 5HIHA 3EW5A 1VHUA 4ESSA 4J5RA 2EWBA 3KQZA 2JZDA 3GPOA 2RNKA 3JRUA 2LGRA 1GYTA 2JZEA 3H8EA 4IQYA 5FSZA 3VFQA 3Q71A 4ZYQA 4R76A 2WCTA 1NJRA 4K3NA 3EWQA 4J5QA 2X47A 3SIGA 3IIFA 3Q6ZA 1LCPA 1BPNA 1SPVA 2EEEA 4UMLA 3GPGA 3SIHA 5FSUA 2BFRA 4GUAA 2DX6A 3SIJA 1BPMA 1LAPA 4GVWA 4ABKA 3ETIA 4K0CA 3KR4A 3V45A 4ETKA 2ACFA 4JGKA 5CMSA 3IIDA 3T8WA 3KQXA 4GVVA 1HJZA 3KZWA 2XD7A 4X2TA 1ZR3A 4ABLA
chains in the Genus database with same CATH topology
1LANA 3JZTA 4TU0A 4KSIA 1TY8A 3GQEA 5AILA 5D8NA 4ZY0A 4KYBA 5CB3A 3H8GA 1BLLE 2L8RA 1ZR5A 4J5SA 1LAMA 2FG1A 5CBMA 4JCAA 4ZX8A 3EJFA 3GPQA 3IJ3A 4ZX9A 5HOLA 4JVVA 4J4ZA 5FSXA 3EWRA 1TXZA 1YD9A 4D86A 3PEIA 5CB5A 4ZI6A 5E3BA 5DUSA 2FAVA 2AFCA 2FXKA 3GQOA 3EWOA 2BFQA 4ZY2A 5FSYA 3EWPA 4JLLA 4R7MA 3SIIA 3EKEA 2VRIA 3V2BA 4R6TA 5FSVA 3KR5A 4ZY1A 2J9AA 4ETJA 3EJGA 3H8FA 5HIHA 3EW5A 1VHUA 4ESSA 4J5RA 2EWBA 3KQZA 3GPOA 3JRUA 2LGRA 1GYTA 3H8EA 4IQYA 5FSZA 3VFQA 3Q71A 4ZYQA 4R76A 1NJRA 4K3NA 3EWQA 4J5QA 2X47A 3SIGA 3IIFA 3Q6ZA 1LCPA 1BPNA 1SPVA 2EEEA 4UMLA 3GPGA 3SIHA 5FSUA 2BFRA 4GUAA 2DX6A 3SIJA 1BPMA 1LAPA 4GVWA 4ABKA 3ETIA 4K0CA 3KR4A 3V45A 4ETKA 2ACFA 4JGKA 5CMSA 3IIDA 3T8WA 3KQXA 4GVVA 1HJZA 3KZWA 2XD7A 4X2TA 1ZR3A 4ABLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAN A;  3JZT A;  4TU0 A;  4KSI A;  1TY8 A;  3GQE A;  5AIL A;  5D8N A;  4ZY0 A;  4KYB A;  5CB3 A;  3H8G A;  1BLL E;  2L8R A;  1ZR5 A;  4J5S A;  1LAM A;  2FG1 A;  5CBM A;  4JCA A;  4ZX8 A;  3EJF A;  3GPQ A;  3IJ3 A;  4ZX9 A;  5HOL A;  4JVV A;  4J4Z A;  5FSX A;  3EWR A;  1TXZ A;  1YD9 A;  4D86 A;  3PEI A;  5CB5 A;  4ZI6 A;  5E3B A;  5DUS A;  2FAV A;  2AFC A;  2FXK A;  3GQO A;  3EWO A;  2BFQ A;  4ZY2 A;  5FSY A;  3EWP A;  4JLL A;  4R7M A;  3SII A;  3EKE A;  2VRI A;  3V2B A;  4R6T A;  5FSV A;  3KR5 A;  4ZY1 A;  2J9A A;  4ETJ A;  3EJG A;  3H8F A;  5HIH A;  3EW5 A;  1VHU A;  4ESS A;  4J5R A;  2EWB A;  3KQZ A;  3GPO A;  3JRU A;  2LGR A;  1GYT A;  3H8E A;  4IQY A;  5FSZ A;  3VFQ A;  3Q71 A;  4ZYQ A;  4R76 A;  1NJR A;  4K3N A;  3EWQ A;  4J5Q A;  2X47 A;  3SIG A;  3IIF A;  3Q6Z A;  1LCP A;  1BPN A;  1SPV A;  2EEE A;  4UML A;  3GPG A;  3SIH A;  5FSU A;  2BFR A;  4GUA A;  2DX6 A;  3SIJ A;  1BPM A;  1LAP A;  4GVW A;  4ABK A;  3ETI A;  4K0C A;  3KR4 A;  3V45 A;  4ETK A;  2ACF A;  4JGK A;  5CMS A;  3IID A;  3T8W A;  3KQX A;  4GVV A;  1HJZ A;  3KZW A;  2XD7 A;  4X2T A;  1ZR3 A;  4ABL A; 
#chains in the Genus database with same CATH topology
 2JZF A;  1LAN A;  3JZT A;  4TU0 A;  4KSI A;  1TY8 A;  3GQE A;  5AIL A;  5D8N A;  4ZY0 A;  4KYB A;  2KQV A;  5CB3 A;  3H8G A;  1BLL E;  2L8R A;  1ZR5 A;  4J5S A;  1LAM A;  2FG1 A;  5CBM A;  4JCA A;  4ZX8 A;  3EJF A;  3GPQ A;  3IJ3 A;  4ZX9 A;  5HOL A;  4JVV A;  4J4Z A;  5FSX A;  3EWR A;  1TXZ A;  1YD9 A;  4D86 A;  3PEI A;  5CB5 A;  4ZI6 A;  5E3B A;  5DUS A;  2FAV A;  2AFC A;  2FXK A;  3GQO A;  3EWO A;  2BFQ A;  4ZY2 A;  5FSY A;  3EWP A;  4JLL A;  4R7M A;  3SII A;  3EKE A;  2VRI A;  3V2B A;  2W2G A;  4R6T A;  5FSV A;  3KR5 A;  4ZY1 A;  2J9A A;  4ETJ A;  3EJG A;  3H8F A;  5HIH A;  3EW5 A;  1VHU A;  4ESS A;  4J5R A;  2EWB A;  3KQZ A;  2JZD A;  3GPO A;  2RNK A;  3JRU A;  2LGR A;  1GYT A;  2JZE A;  3H8E A;  4IQY A;  5FSZ A;  3VFQ A;  3Q71 A;  4ZYQ A;  4R76 A;  2WCT A;  1NJR A;  4K3N A;  3EWQ A;  4J5Q A;  2X47 A;  3SIG A;  3IIF A;  3Q6Z A;  1LCP A;  1BPN A;  1SPV A;  2EEE A;  4UML A;  3GPG A;  3SIH A;  5FSU A;  2BFR A;  4GUA A;  2DX6 A;  3SIJ A;  1BPM A;  1LAP A;  4GVW A;  4ABK A;  3ETI A;  4K0C A;  3KR4 A;  3V45 A;  4ETK A;  2ACF A;  4JGK A;  5CMS A;  3IID A;  3T8W A;  3KQX A;  4GVV A;  1HJZ A;  3KZW A;  2XD7 A;  4X2T A;  1ZR3 A;  4ABL A; 
#chains in the Genus database with same CATH homology
 1LAN A;  3JZT A;  4TU0 A;  4KSI A;  1TY8 A;  3GQE A;  5AIL A;  5D8N A;  4ZY0 A;  4KYB A;  5CB3 A;  3H8G A;  1BLL E;  2L8R A;  1ZR5 A;  4J5S A;  1LAM A;  2FG1 A;  5CBM A;  4JCA A;  4ZX8 A;  3EJF A;  3GPQ A;  3IJ3 A;  4ZX9 A;  5HOL A;  4JVV A;  4J4Z A;  5FSX A;  3EWR A;  1TXZ A;  1YD9 A;  4D86 A;  3PEI A;  5CB5 A;  4ZI6 A;  5E3B A;  5DUS A;  2FAV A;  2AFC A;  2FXK A;  3GQO A;  3EWO A;  2BFQ A;  4ZY2 A;  5FSY A;  3EWP A;  4JLL A;  4R7M A;  3SII A;  3EKE A;  2VRI A;  3V2B A;  4R6T A;  5FSV A;  3KR5 A;  4ZY1 A;  2J9A A;  4ETJ A;  3EJG A;  3H8F A;  5HIH A;  3EW5 A;  1VHU A;  4ESS A;  4J5R A;  2EWB A;  3KQZ A;  3GPO A;  3JRU A;  2LGR A;  1GYT A;  3H8E A;  4IQY A;  5FSZ A;  3VFQ A;  3Q71 A;  4ZYQ A;  4R76 A;  1NJR A;  4K3N A;  3EWQ A;  4J5Q A;  2X47 A;  3SIG A;  3IIF A;  3Q6Z A;  1LCP A;  1BPN A;  1SPV A;  2EEE A;  4UML A;  3GPG A;  3SIH A;  5FSU A;  2BFR A;  4GUA A;  2DX6 A;  3SIJ A;  1BPM A;  1LAP A;  4GVW A;  4ABK A;  3ETI A;  4K0C A;  3KR4 A;  3V45 A;  4ETK A;  2ACF A;  4JGK A;  5CMS A;  3IID A;  3T8W A;  3KQX A;  4GVV A;  1HJZ A;  3KZW A;  2XD7 A;  4X2T A;  1ZR3 A;  4ABL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...