5FSYA

Crystal structure of trypanosoma brucei macrodomain in complex with adp-ribose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
232
Chain Sequence
b'EFVTYSGEESPTRTRILSAALSPAERAIFDVPIEKWLSIDRSSLSGWKCAVPRPVTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLLLRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGERPDMLRKCYRSILSLALKNGLRSIGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACRODOMAIN
molecule tags Hydrolase
source organism Trypanosoma brucei
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
total genus 82
structure length 232
sequence length 249
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fsyA00
1SPVA 2DX6A 4ZX9A 3V2BA 5FSZA 2VRIA 4ETJA 3VFQA 4TU0A 5HIHA 2XD7A 3GQEA 4KYBA 4GVVA 2EEEA 3JZTA 3H8EA 3EWOA 3EWRA 3KR5A 4JGKA 3KQZA 3EJGA 3IJ3A 1ZR5A 4ETKA 4J5QA 4J4ZA 3KZWA 3GPQA 2ACFA 4IQYA 3IIDA 2X47A 4GVWA 1GYTA 1BPNA 3H8FA 4X2TA 4GUAA 4ZY0A 1ZR3A 4R76A 3EWPA 3SIJA 5AILA 4K3NA 3EWQA 2FG1A 5FSVA 4ZX8A 2BFQA 5D8NA 4UMLA 2AFCA 3Q71A 5FSUA 3PEIA 4ESSA 3IIFA 1HJZA 3GPOA 3EKEA 3V45A 3KR4A 3SIHA 4K0CA 5E3BA 1LAMA 3H8GA 4JVVA 4ZYQA 2FAVA 3T8WA 4R7MA 1TY8A 4ZY2A 1LAPA 1VHUA 4ABKA 4R6TA 3SIGA 1LANA 2J9AA 4J5RA 4JLLA 5DUSA 5CB5A 5FSYA 4J5SA 2FXKA 1BLLE 5FSXA 4ZI6A 3Q6ZA 4ABLA 5CB3A 3EW5A 3SIIA 1LCPA 1NJRA 5HOLA 2L8RA 5CBMA 2EWBA 1BPMA 1TXZA 2BFRA 3GQOA 4ZY1A 5CMSA 4JCAA 3GPGA 3JRUA 4D86A 3ETIA 2LGRA 3EJFA 3KQXA 1YD9A 4KSIA
chains in the Genus database with same CATH superfamily
1SPVA 2DX6A 4ZX9A 3V2BA 5FSZA 2VRIA 4ETJA 3VFQA 4TU0A 5HIHA 2XD7A 3GQEA 4KYBA 4GVVA 2EEEA 3JZTA 3H8EA 3EWOA 3EWRA 3KR5A 4JGKA 3KQZA 3EJGA 2JZFA 3IJ3A 1ZR5A 4ETKA 4J5QA 4J4ZA 3KZWA 3GPQA 2ACFA 4IQYA 3IIDA 2X47A 2W2GA 4GVWA 1GYTA 1BPNA 3H8FA 4X2TA 4GUAA 4ZY0A 1ZR3A 4R76A 3EWPA 3SIJA 5AILA 4K3NA 3EWQA 2FG1A 5FSVA 4ZX8A 2BFQA 5D8NA 2AFCA 4UMLA 3Q71A 5FSUA 3PEIA 4ESSA 3IIFA 1HJZA 3GPOA 3EKEA 3V45A 3KR4A 3SIHA 4K0CA 5E3BA 1LAMA 3H8GA 2RNKA 4JVVA 4ZYQA 2FAVA 3T8WA 4R7MA 1TY8A 4ZY2A 1LAPA 1VHUA 4ABKA 4R6TA 3SIGA 1LANA 2J9AA 4J5RA 2JZDA 4JLLA 2WCTA 5DUSA 5CB5A 5FSYA 4J5SA 2FXKA 1BLLE 5FSXA 4ZI6A 3Q6ZA 4ABLA 5CB3A 3EW5A 3SIIA 1LCPA 1NJRA 5HOLA 2L8RA 5CBMA 2KQVA 2EWBA 1BPMA 1TXZA 2BFRA 3GQOA 4ZY1A 5CMSA 4JCAA 3GPGA 3JRUA 4D86A 3ETIA 2LGRA 3EJFA 3KQXA 1YD9A 4KSIA 2JZEA
chains in the Genus database with same CATH topology
1SPVA 2DX6A 4ZX9A 3V2BA 5FSZA 2VRIA 4ETJA 3VFQA 4TU0A 5HIHA 2XD7A 3GQEA 4KYBA 4GVVA 2EEEA 3JZTA 3H8EA 3EWOA 3EWRA 3KR5A 4JGKA 3KQZA 3EJGA 3IJ3A 1ZR5A 4ETKA 4J5QA 4J4ZA 3KZWA 3GPQA 2ACFA 4IQYA 3IIDA 2X47A 4GVWA 1GYTA 1BPNA 3H8FA 4X2TA 4GUAA 4ZY0A 1ZR3A 4R76A 3EWPA 3SIJA 5AILA 4K3NA 3EWQA 2FG1A 5FSVA 4ZX8A 2BFQA 5D8NA 4UMLA 2AFCA 3Q71A 5FSUA 3PEIA 4ESSA 3IIFA 1HJZA 3GPOA 3EKEA 3V45A 3KR4A 3SIHA 4K0CA 5E3BA 1LAMA 3H8GA 4JVVA 4ZYQA 2FAVA 3T8WA 4R7MA 1TY8A 4ZY2A 1LAPA 1VHUA 4ABKA 4R6TA 3SIGA 1LANA 2J9AA 4J5RA 4JLLA 5DUSA 5CB5A 5FSYA 4J5SA 2FXKA 1BLLE 5FSXA 4ZI6A 3Q6ZA 4ABLA 5CB3A 3EW5A 3SIIA 1LCPA 1NJRA 5HOLA 2L8RA 5CBMA 2EWBA 1BPMA 1TXZA 2BFRA 3GQOA 4ZY1A 5CMSA 4JCAA 3GPGA 3JRUA 4D86A 3ETIA 2LGRA 3EJFA 3KQXA 1YD9A 4KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPV A;  2DX6 A;  4ZX9 A;  3V2B A;  5FSZ A;  2VRI A;  4ETJ A;  3VFQ A;  4TU0 A;  5HIH A;  2XD7 A;  3GQE A;  4KYB A;  4GVV A;  2EEE A;  3JZT A;  3H8E A;  3EWO A;  3EWR A;  3KR5 A;  4JGK A;  3KQZ A;  3EJG A;  3IJ3 A;  1ZR5 A;  4ETK A;  4J5Q A;  4J4Z A;  3KZW A;  3GPQ A;  2ACF A;  4IQY A;  3IID A;  2X47 A;  4GVW A;  1GYT A;  1BPN A;  3H8F A;  4X2T A;  4GUA A;  4ZY0 A;  1ZR3 A;  4R76 A;  3EWP A;  3SIJ A;  5AIL A;  4K3N A;  3EWQ A;  2FG1 A;  5FSV A;  4ZX8 A;  2BFQ A;  5D8N A;  4UML A;  2AFC A;  3Q71 A;  5FSU A;  3PEI A;  4ESS A;  3IIF A;  1HJZ A;  3GPO A;  3EKE A;  3V45 A;  3KR4 A;  3SIH A;  4K0C A;  5E3B A;  1LAM A;  3H8G A;  4JVV A;  4ZYQ A;  2FAV A;  3T8W A;  4R7M A;  1TY8 A;  4ZY2 A;  1LAP A;  1VHU A;  4ABK A;  4R6T A;  3SIG A;  1LAN A;  2J9A A;  4J5R A;  4JLL A;  5DUS A;  5CB5 A;  5FSY A;  4J5S A;  2FXK A;  1BLL E;  5FSX A;  4ZI6 A;  3Q6Z A;  4ABL A;  5CB3 A;  3EW5 A;  3SII A;  1LCP A;  1NJR A;  5HOL A;  2L8R A;  5CBM A;  2EWB A;  1BPM A;  1TXZ A;  2BFR A;  3GQO A;  4ZY1 A;  5CMS A;  4JCA A;  3GPG A;  3JRU A;  4D86 A;  3ETI A;  2LGR A;  3EJF A;  3KQX A;  1YD9 A;  4KSI A; 
#chains in the Genus database with same CATH topology
 1SPV A;  2DX6 A;  4ZX9 A;  3V2B A;  5FSZ A;  2VRI A;  4ETJ A;  3VFQ A;  4TU0 A;  5HIH A;  2XD7 A;  3GQE A;  4KYB A;  4GVV A;  2EEE A;  3JZT A;  3H8E A;  3EWO A;  3EWR A;  3KR5 A;  4JGK A;  3KQZ A;  3EJG A;  2JZF A;  3IJ3 A;  1ZR5 A;  4ETK A;  4J5Q A;  4J4Z A;  3KZW A;  3GPQ A;  2ACF A;  4IQY A;  3IID A;  2X47 A;  2W2G A;  4GVW A;  1GYT A;  1BPN A;  3H8F A;  4X2T A;  4GUA A;  4ZY0 A;  1ZR3 A;  4R76 A;  3EWP A;  3SIJ A;  5AIL A;  4K3N A;  3EWQ A;  2FG1 A;  5FSV A;  4ZX8 A;  2BFQ A;  5D8N A;  2AFC A;  4UML A;  3Q71 A;  5FSU A;  3PEI A;  4ESS A;  3IIF A;  1HJZ A;  3GPO A;  3EKE A;  3V45 A;  3KR4 A;  3SIH A;  4K0C A;  5E3B A;  1LAM A;  3H8G A;  2RNK A;  4JVV A;  4ZYQ A;  2FAV A;  3T8W A;  4R7M A;  1TY8 A;  4ZY2 A;  1LAP A;  1VHU A;  4ABK A;  4R6T A;  3SIG A;  1LAN A;  2J9A A;  4J5R A;  2JZD A;  4JLL A;  2WCT A;  5DUS A;  5CB5 A;  5FSY A;  4J5S A;  2FXK A;  1BLL E;  5FSX A;  4ZI6 A;  3Q6Z A;  4ABL A;  5CB3 A;  3EW5 A;  3SII A;  1LCP A;  1NJR A;  5HOL A;  2L8R A;  5CBM A;  2KQV A;  2EWB A;  1BPM A;  1TXZ A;  2BFR A;  3GQO A;  4ZY1 A;  5CMS A;  4JCA A;  3GPG A;  3JRU A;  4D86 A;  3ETI A;  2LGR A;  3EJF A;  3KQX A;  1YD9 A;  4KSI A;  2JZE A; 
#chains in the Genus database with same CATH homology
 1SPV A;  2DX6 A;  4ZX9 A;  3V2B A;  5FSZ A;  2VRI A;  4ETJ A;  3VFQ A;  4TU0 A;  5HIH A;  2XD7 A;  3GQE A;  4KYB A;  4GVV A;  2EEE A;  3JZT A;  3H8E A;  3EWO A;  3EWR A;  3KR5 A;  4JGK A;  3KQZ A;  3EJG A;  3IJ3 A;  1ZR5 A;  4ETK A;  4J5Q A;  4J4Z A;  3KZW A;  3GPQ A;  2ACF A;  4IQY A;  3IID A;  2X47 A;  4GVW A;  1GYT A;  1BPN A;  3H8F A;  4X2T A;  4GUA A;  4ZY0 A;  1ZR3 A;  4R76 A;  3EWP A;  3SIJ A;  5AIL A;  4K3N A;  3EWQ A;  2FG1 A;  5FSV A;  4ZX8 A;  2BFQ A;  5D8N A;  4UML A;  2AFC A;  3Q71 A;  5FSU A;  3PEI A;  4ESS A;  3IIF A;  1HJZ A;  3GPO A;  3EKE A;  3V45 A;  3KR4 A;  3SIH A;  4K0C A;  5E3B A;  1LAM A;  3H8G A;  4JVV A;  4ZYQ A;  2FAV A;  3T8W A;  4R7M A;  1TY8 A;  4ZY2 A;  1LAP A;  1VHU A;  4ABK A;  4R6T A;  3SIG A;  1LAN A;  2J9A A;  4J5R A;  4JLL A;  5DUS A;  5CB5 A;  5FSY A;  4J5S A;  2FXK A;  1BLL E;  5FSX A;  4ZI6 A;  3Q6Z A;  4ABL A;  5CB3 A;  3EW5 A;  3SII A;  1LCP A;  1NJR A;  5HOL A;  2L8R A;  5CBM A;  2EWB A;  1BPM A;  1TXZ A;  2BFR A;  3GQO A;  4ZY1 A;  5CMS A;  4JCA A;  3GPG A;  3JRU A;  4D86 A;  3ETI A;  2LGR A;  3EJF A;  3KQX A;  1YD9 A;  4KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...