5FSYA

Crystal structure of trypanosoma brucei macrodomain in complex with adp-ribose
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
249
structure length
232
Chain Sequence
EFVTYSGEESPTRTRILSAALSPAERAIFDVPIEKWLSIDRSSLSGWKCAVPRPVTIEQLRPVDPSDAILRHIALYRGPVTDLQLDAIVNAANTRCLGGGGVDGAIHRVAGPLLLRECATFNGCQTGECRLTKGYQLPARYVLHTVGPVGERPDMLRKCYRSILSLALKNGLRSIGFCCVSTGVYGYPLLPATRIALGETRKFLEEHGGALDMCCFACFQEDEYKTYEKCVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proximal Adp-Ribose Hydrolysis in Trypanosomatids is Catalyzed by a Macrodomain.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Hydrolase
molecule keywords MACRODOMAIN
total genus 82
structure length 232
sequence length 249
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5fsyA00
4UMLA 4R76A 1LCPA 1ZR3A 5AILA 4ETJA 1TY8A 3ETIA 5DUSA 3EWRA 3H8GA 3GQOA 3IJ3A 4IQYA 4ABLA 2EEEA 5FSVA 3JZTA 4R7MA 4J5RA 2VRIA 3PEIA 5FSXA 1LANA 2XD7A 2L8RA 2FG1A 3SIJA 3H8EA 3EJFA 2J9AA 2BFQA 1BLLE 2EWBA 1YD9A 4K3NA 1LAMA 3Q71A 5CB5A 2AFCA 3H8FA 3V45A 2LGRA 3IIFA 3KQZA 1SPVA 4KYBA 1HJZA 3GPQA 4ZI6A 1BPMA 4X2TA 4K0CA 2DX6A 2ACFA 5FSYA 3KR4A 4JLLA 4J5QA 1TXZA 4D86A 4ZY0A 4TU0A 2X47A 5D8NA 3SIIA 4J5SA 4R6TA 3EJGA 5FSZA 4ZX9A 4GVWA 3V2BA 1GYTA 4ABKA 4ZY2A 5HOLA 2FXKA 3EWOA 4ZYQA 1LAPA 3EWQA 3GPOA 1ZR5A 5CMSA 3VFQA 4GVVA 2BFRA 3KZWA 3JRUA 2FAVA 3GQEA 3EKEA 4ZX8A 1BPNA 3EWPA 3GPGA 3KQXA 5HIHA 4JCAA 3EW5A 4GUAA 5CBMA 5E3BA 3IIDA 4ESSA 5FSUA 4J4ZA 1NJRA 4JGKA 3SIGA 1VHUA 4JVVA 4KSIA 3SIHA 4ETKA 3KR5A 3T8WA 5CB3A 4ZY1A 3Q6ZA
chains in the Genus database with same CATH superfamily
2KQVA 4UMLA 4R76A 1LCPA 1ZR3A 5AILA 4ETJA 1TY8A 3ETIA 5DUSA 3EWRA 3H8GA 3GQOA 3IJ3A 4IQYA 4ABLA 2EEEA 5FSVA 3JZTA 4R7MA 4J5RA 2VRIA 3PEIA 5FSXA 1LANA 2JZFA 2XD7A 2L8RA 2FG1A 3SIJA 3H8EA 3EJFA 2J9AA 2BFQA 2WCTA 1BLLE 2EWBA 1YD9A 4K3NA 1LAMA 3Q71A 5CB5A 2AFCA 3H8FA 3V45A 2LGRA 3IIFA 3KQZA 1SPVA 4KYBA 1HJZA 3GPQA 4ZI6A 1BPMA 4X2TA 4K0CA 2W2GA 2DX6A 2ACFA 5FSYA 3KR4A 4JLLA 2JZEA 4J5QA 1TXZA 4D86A 4ZY0A 4TU0A 2X47A 5D8NA 3SIIA 4J5SA 4R6TA 3EJGA 5FSZA 4ZX9A 4GVWA 3V2BA 1GYTA 4ABKA 4ZY2A 5HOLA 2FXKA 3EWOA 4ZYQA 1LAPA 3EWQA 3GPOA 1ZR5A 5CMSA 3VFQA 4GVVA 2BFRA 3KZWA 3JRUA 2FAVA 3GQEA 3EKEA 4ZX8A 1BPNA 3EWPA 3GPGA 3KQXA 5HIHA 4JCAA 3EW5A 2RNKA 4GUAA 5CBMA 5E3BA 3IIDA 4ESSA 5FSUA 4J4ZA 1NJRA 4JGKA 3SIGA 1VHUA 2JZDA 4JVVA 4KSIA 3SIHA 4ETKA 3KR5A 3T8WA 5CB3A 4ZY1A 3Q6ZA
chains in the Genus database with same CATH topology
4UMLA 4R76A 1LCPA 1ZR3A 5AILA 4ETJA 1TY8A 3ETIA 5DUSA 3EWRA 3H8GA 3GQOA 3IJ3A 4IQYA 4ABLA 2EEEA 5FSVA 3JZTA 4R7MA 4J5RA 2VRIA 3PEIA 5FSXA 1LANA 2XD7A 2L8RA 2FG1A 3SIJA 3H8EA 3EJFA 2J9AA 2BFQA 1BLLE 2EWBA 1YD9A 4K3NA 1LAMA 3Q71A 5CB5A 2AFCA 3H8FA 3V45A 2LGRA 3IIFA 3KQZA 1SPVA 4KYBA 1HJZA 3GPQA 4ZI6A 1BPMA 4X2TA 4K0CA 2DX6A 2ACFA 5FSYA 3KR4A 4JLLA 4J5QA 1TXZA 4D86A 4ZY0A 4TU0A 2X47A 5D8NA 3SIIA 4J5SA 4R6TA 3EJGA 5FSZA 4ZX9A 4GVWA 3V2BA 1GYTA 4ABKA 4ZY2A 5HOLA 2FXKA 3EWOA 4ZYQA 1LAPA 3EWQA 3GPOA 1ZR5A 5CMSA 3VFQA 4GVVA 2BFRA 3KZWA 3JRUA 2FAVA 3GQEA 3EKEA 4ZX8A 1BPNA 3EWPA 3GPGA 3KQXA 5HIHA 4JCAA 3EW5A 4GUAA 5CBMA 5E3BA 3IIDA 4ESSA 5FSUA 4J4ZA 1NJRA 4JGKA 3SIGA 1VHUA 4JVVA 4KSIA 3SIHA 4ETKA 3KR5A 3T8WA 5CB3A 4ZY1A 3Q6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UML A;  4R76 A;  1LCP A;  1ZR3 A;  5AIL A;  4ETJ A;  1TY8 A;  3ETI A;  5DUS A;  3EWR A;  3H8G A;  3GQO A;  3IJ3 A;  4IQY A;  4ABL A;  2EEE A;  5FSV A;  3JZT A;  4R7M A;  4J5R A;  2VRI A;  3PEI A;  5FSX A;  1LAN A;  2XD7 A;  2L8R A;  2FG1 A;  3SIJ A;  3H8E A;  3EJF A;  2J9A A;  2BFQ A;  1BLL E;  2EWB A;  1YD9 A;  4K3N A;  1LAM A;  3Q71 A;  5CB5 A;  2AFC A;  3H8F A;  3V45 A;  2LGR A;  3IIF A;  3KQZ A;  1SPV A;  4KYB A;  1HJZ A;  3GPQ A;  4ZI6 A;  1BPM A;  4X2T A;  4K0C A;  2DX6 A;  2ACF A;  5FSY A;  3KR4 A;  4JLL A;  4J5Q A;  1TXZ A;  4D86 A;  4ZY0 A;  4TU0 A;  2X47 A;  5D8N A;  3SII A;  4J5S A;  4R6T A;  3EJG A;  5FSZ A;  4ZX9 A;  4GVW A;  3V2B A;  1GYT A;  4ABK A;  4ZY2 A;  5HOL A;  2FXK A;  3EWO A;  4ZYQ A;  1LAP A;  3EWQ A;  3GPO A;  1ZR5 A;  5CMS A;  3VFQ A;  4GVV A;  2BFR A;  3KZW A;  3JRU A;  2FAV A;  3GQE A;  3EKE A;  4ZX8 A;  1BPN A;  3EWP A;  3GPG A;  3KQX A;  5HIH A;  4JCA A;  3EW5 A;  4GUA A;  5CBM A;  5E3B A;  3IID A;  4ESS A;  5FSU A;  4J4Z A;  1NJR A;  4JGK A;  3SIG A;  1VHU A;  4JVV A;  4KSI A;  3SIH A;  4ETK A;  3KR5 A;  3T8W A;  5CB3 A;  4ZY1 A;  3Q6Z A; 
#chains in the Genus database with same CATH topology
 2KQV A;  4UML A;  4R76 A;  1LCP A;  1ZR3 A;  5AIL A;  4ETJ A;  1TY8 A;  3ETI A;  5DUS A;  3EWR A;  3H8G A;  3GQO A;  3IJ3 A;  4IQY A;  4ABL A;  2EEE A;  5FSV A;  3JZT A;  4R7M A;  4J5R A;  2VRI A;  3PEI A;  5FSX A;  1LAN A;  2JZF A;  2XD7 A;  2L8R A;  2FG1 A;  3SIJ A;  3H8E A;  3EJF A;  2J9A A;  2BFQ A;  2WCT A;  1BLL E;  2EWB A;  1YD9 A;  4K3N A;  1LAM A;  3Q71 A;  5CB5 A;  2AFC A;  3H8F A;  3V45 A;  2LGR A;  3IIF A;  3KQZ A;  1SPV A;  4KYB A;  1HJZ A;  3GPQ A;  4ZI6 A;  1BPM A;  4X2T A;  4K0C A;  2W2G A;  2DX6 A;  2ACF A;  5FSY A;  3KR4 A;  4JLL A;  2JZE A;  4J5Q A;  1TXZ A;  4D86 A;  4ZY0 A;  4TU0 A;  2X47 A;  5D8N A;  3SII A;  4J5S A;  4R6T A;  3EJG A;  5FSZ A;  4ZX9 A;  4GVW A;  3V2B A;  1GYT A;  4ABK A;  4ZY2 A;  5HOL A;  2FXK A;  3EWO A;  4ZYQ A;  1LAP A;  3EWQ A;  3GPO A;  1ZR5 A;  5CMS A;  3VFQ A;  4GVV A;  2BFR A;  3KZW A;  3JRU A;  2FAV A;  3GQE A;  3EKE A;  4ZX8 A;  1BPN A;  3EWP A;  3GPG A;  3KQX A;  5HIH A;  4JCA A;  3EW5 A;  2RNK A;  4GUA A;  5CBM A;  5E3B A;  3IID A;  4ESS A;  5FSU A;  4J4Z A;  1NJR A;  4JGK A;  3SIG A;  1VHU A;  2JZD A;  4JVV A;  4KSI A;  3SIH A;  4ETK A;  3KR5 A;  3T8W A;  5CB3 A;  4ZY1 A;  3Q6Z A; 
#chains in the Genus database with same CATH homology
 4UML A;  4R76 A;  1LCP A;  1ZR3 A;  5AIL A;  4ETJ A;  1TY8 A;  3ETI A;  5DUS A;  3EWR A;  3H8G A;  3GQO A;  3IJ3 A;  4IQY A;  4ABL A;  2EEE A;  5FSV A;  3JZT A;  4R7M A;  4J5R A;  2VRI A;  3PEI A;  5FSX A;  1LAN A;  2XD7 A;  2L8R A;  2FG1 A;  3SIJ A;  3H8E A;  3EJF A;  2J9A A;  2BFQ A;  1BLL E;  2EWB A;  1YD9 A;  4K3N A;  1LAM A;  3Q71 A;  5CB5 A;  2AFC A;  3H8F A;  3V45 A;  2LGR A;  3IIF A;  3KQZ A;  1SPV A;  4KYB A;  1HJZ A;  3GPQ A;  4ZI6 A;  1BPM A;  4X2T A;  4K0C A;  2DX6 A;  2ACF A;  5FSY A;  3KR4 A;  4JLL A;  4J5Q A;  1TXZ A;  4D86 A;  4ZY0 A;  4TU0 A;  2X47 A;  5D8N A;  3SII A;  4J5S A;  4R6T A;  3EJG A;  5FSZ A;  4ZX9 A;  4GVW A;  3V2B A;  1GYT A;  4ABK A;  4ZY2 A;  5HOL A;  2FXK A;  3EWO A;  4ZYQ A;  1LAP A;  3EWQ A;  3GPO A;  1ZR5 A;  5CMS A;  3VFQ A;  4GVV A;  2BFR A;  3KZW A;  3JRU A;  2FAV A;  3GQE A;  3EKE A;  4ZX8 A;  1BPN A;  3EWP A;  3GPG A;  3KQX A;  5HIH A;  4JCA A;  3EW5 A;  4GUA A;  5CBM A;  5E3B A;  3IID A;  4ESS A;  5FSU A;  4J4Z A;  1NJR A;  4JGK A;  3SIG A;  1VHU A;  4JVV A;  4KSI A;  3SIH A;  4ETK A;  3KR5 A;  3T8W A;  5CB3 A;  4ZY1 A;  3Q6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...