1ZR3A

Crystal structure of the macro-domain of human core histone variant macroh2a1.1 (form b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
GFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords histone macroH2A1.1
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 67
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1zr3A00
3EJFA 4ETKA 3KQZA 3KR5A 3Q6ZA 4X2TA 3EWOA 4ABKA 4R7MA 2FG1A 1NJRA 3EWRA 3Q71A 4GVWA 4ZX8A 4ZI6A 4GVVA 4J5SA 2ACFA 1BLLE 1LAMA 1LCPA 4D86A 1GYTA 4ABLA 3IIFA 1LANA 4KYBA 2BFRA 3V45A 5DUSA 5FSUA 3PEIA 5CMSA 3SIGA 4ZY0A 2LGRA 3GPGA 5FSVA 4ZX9A 3EWPA 2BFQA 3EWQA 5D8NA 3SIHA 2AFCA 2XD7A 3EJGA 3JZTA 3H8GA 4R76A 5E3BA 3JRUA 3H8EA 4JLLA 3GPOA 4J4ZA 4K3NA 1YD9A 5HOLA 2FXKA 3GQEA 4ZYQA 5FSXA 2FAVA 1LAPA 4J5QA 3SIIA 3V2BA 3IJ3A 3IIDA 4TU0A 5HIHA 3KQXA 5CB5A 1SPVA 2L8RA 4ZY2A 3VFQA 4JCAA 4GUAA 3GPQA 5CBMA 3EKEA 3T8WA 5AILA 2EWBA 2DX6A 3H8FA 2J9AA 1BPMA 4IQYA 1HJZA 1ZR5A 4ZY1A 3KR4A 3ETIA 4ETJA 3KZWA 5FSZA 5CB3A 3SIJA 4R6TA 3GQOA 1TY8A 2X47A 3EW5A 4J5RA 1VHUA 2VRIA 4ESSA 4JGKA 1TXZA 4UMLA 4K0CA 5FSYA 4KSIA 1ZR3A 4JVVA 1BPNA 2EEEA
chains in the Genus database with same CATH superfamily
3EJFA 4ETKA 3KQZA 3KR5A 3Q6ZA 4X2TA 3EWOA 4ABKA 4R7MA 2FG1A 1NJRA 2RNKA 3EWRA 3Q71A 4GVWA 4ZX8A 4ZI6A 4GVVA 4J5SA 2ACFA 1BLLE 1LAMA 1LCPA 4D86A 1GYTA 4ABLA 3IIFA 1LANA 4KYBA 2BFRA 3V45A 5DUSA 5FSUA 2JZFA 3PEIA 5CMSA 3SIGA 4ZY0A 2LGRA 3GPGA 5FSVA 4ZX9A 3EWPA 2BFQA 3EWQA 5D8NA 3SIHA 2AFCA 2XD7A 3EJGA 3JZTA 3H8GA 4R76A 5E3BA 3JRUA 3H8EA 4JLLA 3GPOA 4J4ZA 4K3NA 1YD9A 5HOLA 2FXKA 3GQEA 4ZYQA 5FSXA 2FAVA 1LAPA 4J5QA 3SIIA 3V2BA 3IJ3A 3IIDA 4TU0A 5HIHA 3KQXA 5CB5A 1SPVA 2L8RA 4ZY2A 3VFQA 4JCAA 4GUAA 3GPQA 5CBMA 3EKEA 3T8WA 5AILA 2WCTA 2EWBA 2W2GA 2DX6A 3H8FA 2J9AA 1BPMA 4IQYA 1HJZA 1ZR5A 4ZY1A 3KR4A 3ETIA 4ETJA 2JZEA 3KZWA 5FSZA 5CB3A 3SIJA 4R6TA 3GQOA 1TY8A 2X47A 3EW5A 4J5RA 1VHUA 2VRIA 4ESSA 4JGKA 1TXZA 2KQVA 4UMLA 4K0CA 2JZDA 4KSIA 5FSYA 1ZR3A 4JVVA 1BPNA 2EEEA
chains in the Genus database with same CATH topology
3EJFA 4ETKA 3KQZA 3KR5A 3Q6ZA 4X2TA 3EWOA 4ABKA 4R7MA 2FG1A 1NJRA 3EWRA 3Q71A 4GVWA 4ZX8A 4ZI6A 4GVVA 4J5SA 2ACFA 1BLLE 1LAMA 1LCPA 4D86A 1GYTA 4ABLA 3IIFA 1LANA 4KYBA 2BFRA 3V45A 5DUSA 5FSUA 3PEIA 5CMSA 3SIGA 4ZY0A 2LGRA 3GPGA 5FSVA 4ZX9A 3EWPA 2BFQA 3EWQA 5D8NA 3SIHA 2AFCA 2XD7A 3EJGA 3JZTA 3H8GA 4R76A 5E3BA 3JRUA 3H8EA 4JLLA 3GPOA 4J4ZA 4K3NA 1YD9A 5HOLA 2FXKA 3GQEA 4ZYQA 5FSXA 2FAVA 1LAPA 4J5QA 3SIIA 3V2BA 3IJ3A 3IIDA 4TU0A 5HIHA 3KQXA 5CB5A 1SPVA 2L8RA 4ZY2A 3VFQA 4JCAA 4GUAA 3GPQA 5CBMA 3EKEA 3T8WA 5AILA 2EWBA 2DX6A 3H8FA 2J9AA 1BPMA 4IQYA 1HJZA 1ZR5A 4ZY1A 3KR4A 3ETIA 4ETJA 3KZWA 5FSZA 5CB3A 3SIJA 4R6TA 3GQOA 1TY8A 2X47A 3EW5A 4J5RA 1VHUA 2VRIA 4ESSA 4JGKA 1TXZA 4UMLA 4K0CA 5FSYA 4KSIA 1ZR3A 4JVVA 1BPNA 2EEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJF A;  4ETK A;  3KQZ A;  3KR5 A;  3Q6Z A;  4X2T A;  3EWO A;  4ABK A;  4R7M A;  2FG1 A;  1NJR A;  3EWR A;  3Q71 A;  4GVW A;  4ZX8 A;  4ZI6 A;  4GVV A;  4J5S A;  2ACF A;  1BLL E;  1LAM A;  1LCP A;  4D86 A;  1GYT A;  4ABL A;  3IIF A;  1LAN A;  4KYB A;  2BFR A;  3V45 A;  5DUS A;  5FSU A;  3PEI A;  5CMS A;  3SIG A;  4ZY0 A;  2LGR A;  3GPG A;  5FSV A;  4ZX9 A;  3EWP A;  2BFQ A;  3EWQ A;  5D8N A;  3SIH A;  2AFC A;  2XD7 A;  3EJG A;  3JZT A;  3H8G A;  4R76 A;  5E3B A;  3JRU A;  3H8E A;  4JLL A;  3GPO A;  4J4Z A;  4K3N A;  1YD9 A;  5HOL A;  2FXK A;  3GQE A;  4ZYQ A;  5FSX A;  2FAV A;  1LAP A;  4J5Q A;  3SII A;  3V2B A;  3IJ3 A;  3IID A;  4TU0 A;  5HIH A;  3KQX A;  5CB5 A;  1SPV A;  2L8R A;  4ZY2 A;  3VFQ A;  4JCA A;  4GUA A;  3GPQ A;  5CBM A;  3EKE A;  3T8W A;  5AIL A;  2EWB A;  2DX6 A;  3H8F A;  2J9A A;  1BPM A;  4IQY A;  1HJZ A;  1ZR5 A;  4ZY1 A;  3KR4 A;  3ETI A;  4ETJ A;  3KZW A;  5FSZ A;  5CB3 A;  3SIJ A;  4R6T A;  3GQO A;  1TY8 A;  2X47 A;  3EW5 A;  4J5R A;  1VHU A;  2VRI A;  4ESS A;  4JGK A;  1TXZ A;  4UML A;  4K0C A;  5FSY A;  4KSI A;  1ZR3 A;  4JVV A;  1BPN A;  2EEE A; 
#chains in the Genus database with same CATH topology
 3EJF A;  4ETK A;  3KQZ A;  3KR5 A;  3Q6Z A;  4X2T A;  3EWO A;  4ABK A;  4R7M A;  2FG1 A;  1NJR A;  2RNK A;  3EWR A;  3Q71 A;  4GVW A;  4ZX8 A;  4ZI6 A;  4GVV A;  4J5S A;  2ACF A;  1BLL E;  1LAM A;  1LCP A;  4D86 A;  1GYT A;  4ABL A;  3IIF A;  1LAN A;  4KYB A;  2BFR A;  3V45 A;  5DUS A;  5FSU A;  2JZF A;  3PEI A;  5CMS A;  3SIG A;  4ZY0 A;  2LGR A;  3GPG A;  5FSV A;  4ZX9 A;  3EWP A;  2BFQ A;  3EWQ A;  5D8N A;  3SIH A;  2AFC A;  2XD7 A;  3EJG A;  3JZT A;  3H8G A;  4R76 A;  5E3B A;  3JRU A;  3H8E A;  4JLL A;  3GPO A;  4J4Z A;  4K3N A;  1YD9 A;  5HOL A;  2FXK A;  3GQE A;  4ZYQ A;  5FSX A;  2FAV A;  1LAP A;  4J5Q A;  3SII A;  3V2B A;  3IJ3 A;  3IID A;  4TU0 A;  5HIH A;  3KQX A;  5CB5 A;  1SPV A;  2L8R A;  4ZY2 A;  3VFQ A;  4JCA A;  4GUA A;  3GPQ A;  5CBM A;  3EKE A;  3T8W A;  5AIL A;  2WCT A;  2EWB A;  2W2G A;  2DX6 A;  3H8F A;  2J9A A;  1BPM A;  4IQY A;  1HJZ A;  1ZR5 A;  4ZY1 A;  3KR4 A;  3ETI A;  4ETJ A;  2JZE A;  3KZW A;  5FSZ A;  5CB3 A;  3SIJ A;  4R6T A;  3GQO A;  1TY8 A;  2X47 A;  3EW5 A;  4J5R A;  1VHU A;  2VRI A;  4ESS A;  4JGK A;  1TXZ A;  2KQV A;  4UML A;  4K0C A;  2JZD A;  4KSI A;  5FSY A;  1ZR3 A;  4JVV A;  1BPN A;  2EEE A; 
#chains in the Genus database with same CATH homology
 3EJF A;  4ETK A;  3KQZ A;  3KR5 A;  3Q6Z A;  4X2T A;  3EWO A;  4ABK A;  4R7M A;  2FG1 A;  1NJR A;  3EWR A;  3Q71 A;  4GVW A;  4ZX8 A;  4ZI6 A;  4GVV A;  4J5S A;  2ACF A;  1BLL E;  1LAM A;  1LCP A;  4D86 A;  1GYT A;  4ABL A;  3IIF A;  1LAN A;  4KYB A;  2BFR A;  3V45 A;  5DUS A;  5FSU A;  3PEI A;  5CMS A;  3SIG A;  4ZY0 A;  2LGR A;  3GPG A;  5FSV A;  4ZX9 A;  3EWP A;  2BFQ A;  3EWQ A;  5D8N A;  3SIH A;  2AFC A;  2XD7 A;  3EJG A;  3JZT A;  3H8G A;  4R76 A;  5E3B A;  3JRU A;  3H8E A;  4JLL A;  3GPO A;  4J4Z A;  4K3N A;  1YD9 A;  5HOL A;  2FXK A;  3GQE A;  4ZYQ A;  5FSX A;  2FAV A;  1LAP A;  4J5Q A;  3SII A;  3V2B A;  3IJ3 A;  3IID A;  4TU0 A;  5HIH A;  3KQX A;  5CB5 A;  1SPV A;  2L8R A;  4ZY2 A;  3VFQ A;  4JCA A;  4GUA A;  3GPQ A;  5CBM A;  3EKE A;  3T8W A;  5AIL A;  2EWB A;  2DX6 A;  3H8F A;  2J9A A;  1BPM A;  4IQY A;  1HJZ A;  1ZR5 A;  4ZY1 A;  3KR4 A;  3ETI A;  4ETJ A;  3KZW A;  5FSZ A;  5CB3 A;  3SIJ A;  4R6T A;  3GQO A;  1TY8 A;  2X47 A;  3EW5 A;  4J5R A;  1VHU A;  2VRI A;  4ESS A;  4JGK A;  1TXZ A;  4UML A;  4K0C A;  5FSY A;  4KSI A;  1ZR3 A;  4JVV A;  1BPN A;  2EEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...