1ZR3A

Crystal structure of the macro-domain of human core histone variant macroh2a1.1 (form b)
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
186
structure length
186
Chain Sequence
GFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords histone macroH2A1.1
publication title Splicing regulates NAD metabolite binding to histone macroH2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1zr3A00
4ZI6A 4KYBA 3V45A 3VFQA 2BFRA 1SPVA 2FXKA 4GVVA 3ETIA 2L8RA 5FSYA 3SIHA 4JGKA 5HIHA 3GQEA 5D8NA 3EJFA 5FSVA 4J5QA 3KQZA 3H8EA 4ABLA 1ZR3A 4K3NA 5FSUA 2X47A 3EKEA 5CMSA 4J5RA 3SIJA 4ETJA 2EWBA 4ZYQA 5E3BA 2XD7A 3Q6ZA 4ZX9A 1BPMA 5CBMA 3EWQA 4ABKA 1YD9A 4GVWA 5HOLA 3IIFA 3EW5A 3H8FA 3T8WA 3KR4A 4ZY0A 4R6TA 1BPNA 1TY8A 3IIDA 4GUAA 2ACFA 3GPGA 1GYTA 4ZY1A 3JZTA 4UMLA 4IQYA 2EEEA 3GQOA 4R76A 4JCAA 4ETKA 5FSXA 2J9AA 3GPQA 1VHUA 3EWPA 4J4ZA 1HJZA 1LANA 4K0CA 5FSZA 3SIGA 1BLLE 3IJ3A 3GPOA 4JVVA 3JRUA 1LAMA 4ESSA 3EJGA 3EWRA 2LGRA 2DX6A 2AFCA 4D86A 3EWOA 1LCPA 4J5SA 3SIIA 4TU0A 4JLLA 4KSIA 3PEIA 1LAPA 2VRIA 5CB5A 4ZX8A 4X2TA 3H8GA 4R7MA 1ZR5A 2FG1A 2BFQA 3KZWA 4ZY2A 5DUSA 3KR5A 3V2BA 1NJRA 1TXZA 5AILA 3Q71A 5CB3A 2FAVA 3KQXA
chains in the Genus database with same CATH superfamily
4ZI6A 4KYBA 3V45A 3VFQA 2BFRA 1SPVA 2FXKA 4GVVA 3ETIA 2L8RA 5FSYA 3SIHA 4JGKA 5HIHA 3GQEA 5D8NA 3EJFA 5FSVA 4J5QA 3KQZA 3H8EA 4ABLA 1ZR3A 4K3NA 5FSUA 2KQVA 2X47A 3EKEA 5CMSA 4J5RA 3SIJA 4ETJA 2EWBA 4ZYQA 5E3BA 2XD7A 3Q6ZA 4ZX9A 1BPMA 5CBMA 3EWQA 4ABKA 1YD9A 4GVWA 5HOLA 3IIFA 3EW5A 3H8FA 3T8WA 3KR4A 2JZEA 4ZY0A 4R6TA 1BPNA 1TY8A 3IIDA 4GUAA 2ACFA 3GPGA 1GYTA 4ZY1A 3JZTA 4UMLA 4IQYA 2EEEA 3GQOA 4R76A 4JCAA 4ETKA 5FSXA 2J9AA 3GPQA 1VHUA 3EWPA 4J4ZA 1HJZA 1LANA 2JZDA 4K0CA 5FSZA 3SIGA 1BLLE 3IJ3A 3GPOA 4JVVA 3JRUA 1LAMA 4ESSA 3EJGA 2WCTA 3EWRA 2LGRA 2DX6A 2JZFA 2AFCA 4D86A 3EWOA 1LCPA 4J5SA 3SIIA 4TU0A 2RNKA 4JLLA 4KSIA 3PEIA 1LAPA 2VRIA 5CB5A 4ZX8A 4X2TA 3H8GA 4R7MA 1ZR5A 2FG1A 2BFQA 3KZWA 4ZY2A 5DUSA 3KR5A 3V2BA 1NJRA 1TXZA 5AILA 3Q71A 5CB3A 2FAVA 2W2GA 3KQXA
chains in the Genus database with same CATH topology
4ZI6A 4KYBA 3V45A 3VFQA 2BFRA 1SPVA 2FXKA 4GVVA 3ETIA 2L8RA 5FSYA 3SIHA 4JGKA 5HIHA 3GQEA 5D8NA 3EJFA 5FSVA 4J5QA 3KQZA 3H8EA 4ABLA 1ZR3A 4K3NA 5FSUA 2X47A 3EKEA 5CMSA 4J5RA 3SIJA 4ETJA 2EWBA 4ZYQA 5E3BA 2XD7A 3Q6ZA 4ZX9A 1BPMA 5CBMA 3EWQA 4ABKA 1YD9A 4GVWA 5HOLA 3IIFA 3EW5A 3H8FA 3T8WA 3KR4A 4ZY0A 4R6TA 1BPNA 1TY8A 3IIDA 4GUAA 2ACFA 3GPGA 1GYTA 4ZY1A 3JZTA 4UMLA 4IQYA 2EEEA 3GQOA 4R76A 4JCAA 4ETKA 5FSXA 2J9AA 3GPQA 1VHUA 3EWPA 4J4ZA 1HJZA 1LANA 4K0CA 5FSZA 3SIGA 1BLLE 3IJ3A 3GPOA 4JVVA 3JRUA 1LAMA 4ESSA 3EJGA 3EWRA 2LGRA 2DX6A 2AFCA 4D86A 3EWOA 1LCPA 4J5SA 3SIIA 4TU0A 4JLLA 4KSIA 3PEIA 1LAPA 2VRIA 5CB5A 4ZX8A 4X2TA 3H8GA 4R7MA 1ZR5A 2FG1A 2BFQA 3KZWA 4ZY2A 5DUSA 3KR5A 3V2BA 1NJRA 1TXZA 5AILA 3Q71A 5CB3A 2FAVA 3KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI6 A;  4KYB A;  3V45 A;  3VFQ A;  2BFR A;  1SPV A;  2FXK A;  4GVV A;  3ETI A;  2L8R A;  5FSY A;  3SIH A;  4JGK A;  5HIH A;  3GQE A;  5D8N A;  3EJF A;  5FSV A;  4J5Q A;  3KQZ A;  3H8E A;  4ABL A;  1ZR3 A;  4K3N A;  5FSU A;  2X47 A;  3EKE A;  5CMS A;  4J5R A;  3SIJ A;  4ETJ A;  2EWB A;  4ZYQ A;  5E3B A;  2XD7 A;  3Q6Z A;  4ZX9 A;  1BPM A;  5CBM A;  3EWQ A;  4ABK A;  1YD9 A;  4GVW A;  5HOL A;  3IIF A;  3EW5 A;  3H8F A;  3T8W A;  3KR4 A;  4ZY0 A;  4R6T A;  1BPN A;  1TY8 A;  3IID A;  4GUA A;  2ACF A;  3GPG A;  1GYT A;  4ZY1 A;  3JZT A;  4UML A;  4IQY A;  2EEE A;  3GQO A;  4R76 A;  4JCA A;  4ETK A;  5FSX A;  2J9A A;  3GPQ A;  1VHU A;  3EWP A;  4J4Z A;  1HJZ A;  1LAN A;  4K0C A;  5FSZ A;  3SIG A;  1BLL E;  3IJ3 A;  3GPO A;  4JVV A;  3JRU A;  1LAM A;  4ESS A;  3EJG A;  3EWR A;  2LGR A;  2DX6 A;  2AFC A;  4D86 A;  3EWO A;  1LCP A;  4J5S A;  3SII A;  4TU0 A;  4JLL A;  4KSI A;  3PEI A;  1LAP A;  2VRI A;  5CB5 A;  4ZX8 A;  4X2T A;  3H8G A;  4R7M A;  1ZR5 A;  2FG1 A;  2BFQ A;  3KZW A;  4ZY2 A;  5DUS A;  3KR5 A;  3V2B A;  1NJR A;  1TXZ A;  5AIL A;  3Q71 A;  5CB3 A;  2FAV A;  3KQX A; 
#chains in the Genus database with same CATH topology
 4ZI6 A;  4KYB A;  3V45 A;  3VFQ A;  2BFR A;  1SPV A;  2FXK A;  4GVV A;  3ETI A;  2L8R A;  5FSY A;  3SIH A;  4JGK A;  5HIH A;  3GQE A;  5D8N A;  3EJF A;  5FSV A;  4J5Q A;  3KQZ A;  3H8E A;  4ABL A;  1ZR3 A;  4K3N A;  5FSU A;  2KQV A;  2X47 A;  3EKE A;  5CMS A;  4J5R A;  3SIJ A;  4ETJ A;  2EWB A;  4ZYQ A;  5E3B A;  2XD7 A;  3Q6Z A;  4ZX9 A;  1BPM A;  5CBM A;  3EWQ A;  4ABK A;  1YD9 A;  4GVW A;  5HOL A;  3IIF A;  3EW5 A;  3H8F A;  3T8W A;  3KR4 A;  2JZE A;  4ZY0 A;  4R6T A;  1BPN A;  1TY8 A;  3IID A;  4GUA A;  2ACF A;  3GPG A;  1GYT A;  4ZY1 A;  3JZT A;  4UML A;  4IQY A;  2EEE A;  3GQO A;  4R76 A;  4JCA A;  4ETK A;  5FSX A;  2J9A A;  3GPQ A;  1VHU A;  3EWP A;  4J4Z A;  1HJZ A;  1LAN A;  2JZD A;  4K0C A;  5FSZ A;  3SIG A;  1BLL E;  3IJ3 A;  3GPO A;  4JVV A;  3JRU A;  1LAM A;  4ESS A;  3EJG A;  2WCT A;  3EWR A;  2LGR A;  2DX6 A;  2JZF A;  2AFC A;  4D86 A;  3EWO A;  1LCP A;  4J5S A;  3SII A;  4TU0 A;  2RNK A;  4JLL A;  4KSI A;  3PEI A;  1LAP A;  2VRI A;  5CB5 A;  4ZX8 A;  4X2T A;  3H8G A;  4R7M A;  1ZR5 A;  2FG1 A;  2BFQ A;  3KZW A;  4ZY2 A;  5DUS A;  3KR5 A;  3V2B A;  1NJR A;  1TXZ A;  5AIL A;  3Q71 A;  5CB3 A;  2FAV A;  2W2G A;  3KQX A; 
#chains in the Genus database with same CATH homology
 4ZI6 A;  4KYB A;  3V45 A;  3VFQ A;  2BFR A;  1SPV A;  2FXK A;  4GVV A;  3ETI A;  2L8R A;  5FSY A;  3SIH A;  4JGK A;  5HIH A;  3GQE A;  5D8N A;  3EJF A;  5FSV A;  4J5Q A;  3KQZ A;  3H8E A;  4ABL A;  1ZR3 A;  4K3N A;  5FSU A;  2X47 A;  3EKE A;  5CMS A;  4J5R A;  3SIJ A;  4ETJ A;  2EWB A;  4ZYQ A;  5E3B A;  2XD7 A;  3Q6Z A;  4ZX9 A;  1BPM A;  5CBM A;  3EWQ A;  4ABK A;  1YD9 A;  4GVW A;  5HOL A;  3IIF A;  3EW5 A;  3H8F A;  3T8W A;  3KR4 A;  4ZY0 A;  4R6T A;  1BPN A;  1TY8 A;  3IID A;  4GUA A;  2ACF A;  3GPG A;  1GYT A;  4ZY1 A;  3JZT A;  4UML A;  4IQY A;  2EEE A;  3GQO A;  4R76 A;  4JCA A;  4ETK A;  5FSX A;  2J9A A;  3GPQ A;  1VHU A;  3EWP A;  4J4Z A;  1HJZ A;  1LAN A;  4K0C A;  5FSZ A;  3SIG A;  1BLL E;  3IJ3 A;  3GPO A;  4JVV A;  3JRU A;  1LAM A;  4ESS A;  3EJG A;  3EWR A;  2LGR A;  2DX6 A;  2AFC A;  4D86 A;  3EWO A;  1LCP A;  4J5S A;  3SII A;  4TU0 A;  4JLL A;  4KSI A;  3PEI A;  1LAP A;  2VRI A;  5CB5 A;  4ZX8 A;  4X2T A;  3H8G A;  4R7M A;  1ZR5 A;  2FG1 A;  2BFQ A;  3KZW A;  4ZY2 A;  5DUS A;  3KR5 A;  3V2B A;  1NJR A;  1TXZ A;  5AIL A;  3Q71 A;  5CB3 A;  2FAV A;  3KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...