3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
1EE3P 5CB5A 1BPMA 4MHZA 3ETIA 4GVVA 1OBRA 4TU0A 1XFOA 5K8PA 5F09A 2PJ4A 4W9YA 4GUAA 3JRUA 3D68A 3SJGA 2AFSA 3IO1A 2IQ6A 5K8MA 5LYIA 4ZY0A 3PRTA 1JQGA 2XEFA 2EWBA 3N5FA 1KWMA 3HLPA 3RAMA 1FT7A 3IC1A 5HIHA 1ZG9A 4IQYA 3IEHA 3BHXA 1Y7EA 4JLLA 1CG2A 2PJ5A 3MN8A 2QVPA 2VRIA 3KL9A 2DEAA 2PIZA 3EKEA 4P4BA 3VH9A 2Q43A 1Y0YA 3RZAA 4IHMA 3NFZA 5D8NA 1Z2LA 1R3NA 4O23A 2RB7A 3T8WA 2AFZA 3VATA 5D29A 5CB3A 1NSAA 4UEEA 2V8DA 2QJ8A 4PPZA 4NGQA 3EW5A 3WT4A 4PXDA 2C6PA 1BAVA 2FXKA 3GLJA 2VL1A 4OMEA 2ZOGA 2CTCA 2XEJA 1ZLIA 1PYTB 3EWOA 2POKA 4OC5A 1ELMP 4ABLA 3S9NA 2Q4ZA 4P4FA 4A38A 5LRKA 2HB6A 1HDQA 3NH4A 2GLFA 1RTQA 2AFUA 2CF4A 4TNUA 3Q71A 2BCOA 2XD7A 2EK8A 2PE3A 4J5SA 3I1UA 4RUHA 2ANPA 4DJLA 3BI0A 3GQEA 1CX8A 3DLJA 4NGNA 3PB9X 2PJCA 4Q7AA 1ZR5A 4ABKA 2I3CA 4ZY1A 3ISXA 4UEZA 4PQAA 3K2KA 5LRJA 5K8OA 5JM6A 1SPVA 2CTBA 5JGFA 4CPAA 4IAVA 5I4MA 3S9LA 3JZTA 2JBKA 4UIBA 1YD9A 3IFEA 4X3RA 2PJ9A 4DUKA 1M4LA 5FSXA 3PB7X 1TXRA 2ZEPA 1CPXA 2EEEA 4MCRA 2FAVA 2F8HA 4DYOA 4OC3A 1TXZA 3SIIA 4UIAA 1FNOA 3D66A 1VHEA 1XRYA 2O53A 4PXBA 3KGQA 1TF9A 3GPQA 3V2BA 1YLOA 3Q6ZA 4F9UA 4NFRA 3VARA 4FAIA 1LOKA 4P10A 2XEIA 3FH4A 2PJAA 4ONWA 3KQZA 1LFWA 2ZENA 4Z65A 4J5RA 3FF3A 4P4IA 2AFWA 1AMPA 5IB9A 3D4UA 4OKOA 4MCPA 3SI0A 2ZEGA 4P44A 3KI9A 2PJ6A 3NA6A 4YU9A 3SJEA 3B3TA 3FVLA 3SIHA 2G9DA 4D86A 4G1PA 5JH9A 1XJOA 3B3VA 4TWEA 2RFHA 3ISZA 4WJBA 2IMOA 4NGTA 4WWVA 4ZX9A 3BXMA 3CPAA 3B3SA 5FSZA 3FEEA 1TKFA 1Z5RA 2PJ7A 5ELYA 3MRUA 5CBMA 3K9TA 3D67A 4BD9A 3KR5A 1NJRA 1ZG8A 4MXUA 1LCPA 4NGSA 5HVHA 5AILA 5LYFA 1HJZA 4NJQA 1ARLA 2CIJA 4FUUA 1Y0RA 2F7VA 4P6YA 1TF8A 2ZEOA 1CBXA 3SJFA 1TY8A 4NGMA 5LYLA 4GVWA 3EWPA 2L8RA 2JEWA 4K0CA 1GYTA 2PJ0A 3D7DA 3KHXA 3IIDA 2PJBA 5HVGA 2XEGA 4JGKA 3PFEA 1TKHA 3B3WA 2GU2A 3D7FA 4ZY2A 2O4HA 1YMEA 5LYDA 5HVFA 4PXCA 1ARMA 1YW4A 4JVVA 2PJ2A 4A37A 2ACFA 1QQ9A 3CPXA 2X47A 1AYEA 2FG1A 4OC0A 4OC2A 4KYBA 3EJGA 3QNVA 4ETKA 5DS0A 1HDUA 3KHZA 5LRGA 3KR4A 5HOLA 3PEIA 2C6GA 4JYWA 4P45A 1TKJA 1YSJA 4EFDA 5FSUA 1IY7A 2ZEDA 3D7GA 4R8FA 4NJRA 4J4ZA 3H8EA 3PB4X 2IJZA 3GPOA 2NSMA 3EWRA 4UMLA 4ETJA 2C6CA 5E3BA 1F2OA 4P4JA 4JZ0A 4MHPA 1BPNA 3SIGA 4NGRA 3V38A 8CPAA 2BO9A 2NYQA 1ELLP 4FWUA 1VHOA 3KQXA 4MCSA 4UF4A 2AFXA 1CPSA 2ZEMA 1QMUA 4K3NA 1H8LA 3IIBA 4R7MA 2ZOFA 3L2NA 2PVWA 2PJ1A 2GREA 3B2YA 3PB6X 4MCQA 3GUXA 3EWQA 2PJ8A 1LANA 2BOAA 7CPAA 3IJ3A 5CMSA 3NH5A 2Q51A 3PFOA 4P4EA 1PCAA 1YW6A 3KZWA 3TC8A 4AXVA 3EJFA 3GPGA 2V8VA 2GLJA 4J5QA 4NGPA 5HXDA 5J1QA 4JCAA 4FBEA 3BI1A 4F8ZA 1R43A 1UWYA 1LAMA 4IK2A 2AFOA 4MMOA 2PVVA 3LWUA 2EK9A 2ZEEA 2LGRA 4KSIA 2WYRA 3FMCA 3V45A 2JBJA 3SIJA 2PIYA 3VFQA 2V77A 4OC4A 2BFRA 4LQGA 5K8NA 2AFCA 4ZYQA 1CP6A 2ZEFA 4P4DA 4A39A 3SI2A 4A94A 1ZG7A 3IWWA 3CT9A 3WC7A 4YWYA 2OOTA 1IGBA 1F2PA 1ZLHA 1Z8LA 4ZX8A 2PCUA 1DTDA 3H8FA 4X8IA 1VGYA 1XBUA 5DUSA 1VHUA 4ZI6A 2AFMA 4MRIA 5CPAA 1ZR3A 2PJ3A 3KASA 2HC9A 4MHNA 2PRQA 2ABZA 4OIWA 5THWA 3HUVA 3D7HA 4EWTA 4ESSA 3H8GA 3SJXA 3TX8A 4OC1A 4GM5A 3WC5A 4UEFA 2FVGA 2WZNA 2OR4A 2BFQA 1CP7A 5FSVA 3GB0A 1XMBA 4X2TA 3NH8A 3GQOA 2ZEHA 1DE4C 3FJUA 1BLLE 2QYVA 1HEEA 2J9AA 4PXEA 1VIXA 1Q7LA 4MHYA 4R76A 3B7IA 2V8GA 1F57A 3LMSA 6CPAA 4EMEA 5FSYA 3PB8X 3PBBA 3FECA 3B3CA 3B35A 3IIFA 4R6TA 3WABA 3WC6A 2V8HA 3RBUA 4OP4A 2ZELA 4B6ZA 4F9VA 2C1CA 3SI1A 4OIDA 3S9MA 3PBEA 3FEDA 4H2KA 2DX6A 3FX6A 3CDXA 1LAPA 3V7ZA 3DGVA
chains in the Genus database with same CATH superfamily
1EE3P 1XMTA 4UWJA 5CB5A 1WWZA 1BPMA 4JWPA 1B6BA 4KOXA 4KVME 2PQ8A 3ETIA 4GVVA 1KUVA 4MHZA 2FT0A 3BLNA 5IX3A 5GCNA 1OBRA 4TU0A 1XFOA 5K8PA 5F09A 4YFJA 4AVAA 3R96A 2OZGA 1S7NA 2WSAA 4FD7A 3T9YA 2PJ4A 3OWCA 4GUAA 4W9YA 1BOBA 3JVNA 3JRUA 3D68A 3JTKA 3SJGA 2AFSA 2ZW7A 3IO1A 4Q38A 4CAXA 3TCVA 2IQ6A 5K8MA 1J4JA 5LYIA 4ZY0A 2P0WA 2JZEA 3DR6A 3IWGA 3PRTA 1JQGA 2XEFA 5DWMA 3H4QA 4B5OA 2EWBA 2YGWA 3N5FA 1KWMA 4MFJA 1JWQA 3HLPA 3LACA 3RAMA 1FT7A 4HNXB 3IC1A 2IL4A 2CNMA 5HIHA 2R8VA 1ZG9A 4AB7A 4IQYA 3IEHA 3BHXA 4CGMA 1Y7EA 4B5PB 4JLLA 1CG2A 2PJ5A 4KOYA 2REEA 3MN8A 1S7KA 1PU9A 1KUYA 3GKRA 2QVPA 3KKWA 1FY7A 5EBVA 2VRIA 3GYAA 3QB8A 2WUUA 4KUBA 3KL9A 5KTAA 2ATRA 3TO7A 1M44A 4RN7A 2DEAA 1YGHA 4H89A 1P0HA 3GY9A 1IYKA 2PIZA 3EKEA 4P4BA 3VH9A 2P6GA 3V8IA 1Z8WA 2Q43A 1R57A 4FD5A 2I00A 1Y0YA 4MFLA 2B3VA 3FBUA 4IHMA 2B3UA 4KLVA 3NFZA 4MJ8A 5G1ZA 1PUAA 3K9UA 4NSQA 3UY5A 4F0XA 1TIQA 4KOVA 5D8NA 1Z2LA 3A9LA 1R3NA 4O23A 2RB7A 4IF5A 3T8WA 1S7LA 2AFZA 3H5ZA 3VATA 5D29A 2YNEA 5CB3A 1NSAA 2Q0YA 4UEEA 4PSXA 2Y0MA 3LD2A 2V8DA 2QJ8A 4PPZA 4NGQA 3PZJA 3EW5A 3WT4A 4PXDA 2A4NA 2C6PA 1BAVA 2FXKA 3GLJA 2BEIA 3IU2A 2VL1A 1Z8XA 5IB0A 2EBJA 4OMEA 2ZOGA 4A2ZA 2CTCA 4HPSA 2G3AA 5E96A 2XEJA 2Q44A 4L89A 4XNHB 1ZLIA 1YQEA 2ZW5A 1PYTB 5C88A 4JJXA 3EWOA 1S3ZA 2POKA 4OC5A 1ELMP 4ABLA 3S9NA 2Q4ZA 2H5MA 4P4FA 4A38A 4B12A 3F5BA 4KZTA 4MY0A 5LRKA 4MFZA 2HB6A 2ZPAA 1HDQA 4U5YA 4C68A 3NH4A 2GLFA 1RTQA 2B4DA 3DDDA 2AFUA 2CF4A 2D4OA 4TNUA 2YNCA 3Q71A 2BCOA 2XD7A 2EK8A 2PE3A 4J5SA 3FXTA 3I1UA 2QIRA 4RUHA 1QSTA 2ANPA 4DJLA 3GQEA 3BI0A 5IV0A 1CX8A 3DLJA 3BJ7A 5CNPA 1CM0A 4NGNA 2WPXA 3PB9X 3R95A 2PJCA 4HNWB 1IU8A 2D4PA 4HNYB 4Q7AA 1ZR5A 5DWNA 4C7IA 4ABKA 2I3CA 4ZY1A 3ISXA 4UEZA 4PQAA 3G8WA 3V7ZA 3K2KA 2J8RA 4U9ZA 5LRJA 5K8OA 1KZFA 5JM6A 1SPVA 1Q2YA 2CTBA 5JGFA 4CPAA 4IAVA 2ZXVA 5I4MA 3S6GA 3S9LA 3G3SA 3TE4A 3JZTA 3SXOA 2JBKA 4UIBA 2REFA 2B58A 1YD9A 3IFEA 4X3RA 2G0BA 2PJ9A 4DUKA 4KVOE 1M4LA 5FSXA 2WCTA 3R9GA 3PB7X 1TXRA 2CNSA 1CPXA 2ZEPA 4CYQA 4A30A 2EEEA 3CXPA 1Y9KA 2ZW6A 4MCRA 2FAVA 2F8HA 4B14A 4DYOA 5ISVA 4FD6A 4OC3A 1TXZA 4YGOA 3SIIA 2O28A 4NCZA 1S5KA 2Z3PA 4OAEA 4UIAA 1Q2DA 1FNOA 3D66A 4E0AA 2NMTA 2YNDA 1VHEA 1XRYA 2O53A 3CXSA 3W6SA 4PXBA 5H86A 3KGQA 1TF9A 2FS5A 3GPQA 4UBRA 3V2BA 1YLOA 3I9SA 3Q6ZA 4E8OA 4F9UA 2JDDA 2PC1A 4NFRA 3VARA 3TOAA 1RXTA 1LOKA 4P10A 4U9YA 4FD4A 5KTCA 3FIXA 2XEIA 3FH4A 3ZJ0A 3TO6A 2PJAA 4ONWA 3KQZA 1LFWA 2X7BA 2Z3MA 2ZENA 4Z65A 1MK4A 4J5RA 2VEZA 4MFKA 4MI4A 4UCNA 3D2PA 3FF3A 4P4IA 3IU1A 2AFWA 1AMPA 4E2AA 5IB9A 3D4UA 4OKOA 4NXYA 4MCPA 2DF5A 3SI0A 4UA3A 3IGRA 2ZEGA 4P44A 4XPLA 1Z9UA 5A27A 4XPDC 3KI9A 2PJ6A 4NEXA 3NA6A 4QC6A 3SXNA 5FVJA 4YU9A 3SJEA 1SQHA 5AG5A 3B3TA 3FVLA 3SIHA 2G9DA 4D86A 1UFHA 2OU2A 3BJ8A 3NE7A 4G1PA 4XPDB 2OZUA 3FB3A 1XJOA 2B4BA 3TT2A 1CJWA 3B3VA 4IUSA 3R9EA 4TWEA 2RFHA 3ISZA 4WJBA 4PK2A 4CGLA 5I0CA 2B5GA 2IMOA 1YR0A 3NE8A 2PRBA 4NGTA 2J8NA 4J3GA 4UFWA 4WWVA 4ZX9A 2OB0A 3BXMA 3B3SA 3CPAA 5FSZA 3FEEA 4C2ZA 1TKFA 4KOSA 4BMHA 2Z0ZA 3GIUA 4K30A 1Z5RA 4R87A 2PJ7A 4XPKA 4R57A 5ELYA 1OZPA 2JLMA 3SHPA 3TO9A 3MRUA 3QAHA 5CBMA 3K9TA 4CYOA 3D67A 2YNCC 4BD9A 3KR5A 4M6GA 1NJRA 2GIVA 1ZG8A 4MXUA 1I1DA 1KUXA 1LCPA 4NGSA 1N71A 1QSRA 5HVHA 5AILA 2B5GB 2VZYA 3FNCA 1IB1E 2R7HA 5LYFA 1HJZA 3D2MA 1XE4A 4NJQA 3EC4A 1ARLA 4R3KA 2CIJA 2DPTA 3JUWA 1X12A 3CZXA 4FUUA 2EUIA 1Y0RA 2F7VA 4B5PA 3EXNA 4P6YA 2GFQA 1TF8A 1YVKA 1M4GA 2ZEOA 4H6UA 1M4DA 4H6ZA 4CGNA 1CBXA 1IYLA 4B13A 1I21A 3SJFA 1TY8A 4NGMA 5LYLA 5EMIA 4GVWA 3VWEA 1LRZA 2EO8A 3EWPA 1S60A 3DR8A 2P6FA 2L8RA 2JEWA 1U6MA 3D3SA 4K0CA 4RS2A 3N7ZA 1GYTA 2PJ0A 1L0CA 2ZW4A 3D7DA 3KHXA 4Y49B 3IIDA 2JZDA 2PJBA 2VQYA 4I49A 3CXQA 2XEGA 4KS9A 4MBUA 5HVGA 4JGKA 3EO4A 5C82A 2ARHA 3PFEA 1TKHA 3B3WA 5J8FA 2GU2A 1ON0A 2Z3LA 3D7FA 4ZY2A 2O4HA 1YMEA 5LYDA 2RC4A 5HVFA 1QSMA 4PXCA 2WPWA 1ARMA 1YW4A 4JVVA 1XIXA 2PJ2A 1MJ9A 4A37A 2FE7A 2ACFA 1QQ9A 3CPXA 2X47A 2Q4VA 4JD6A 1AYEA 3T90A 2FG1A 4OC0A 4OC2A 2VZZA 2FXFA 3F8KA 1P4NA 3P2FA 4C2XA 4KYBA 4QVTA 3EJGA 3QNVA 4ETKA 1M1DA 1HDUA 4PSWA 5DS0A 1QSOA 3KHZA 5LRGA 2PR1A 3B8GA 3FRMA 2F5IA 3KR4A 5HOLA 3PEIA 2OH1A 5F47A 2C6GA 4JYWA 4P45A 1NE9A 2Q04A 1TKJA 1YSJA 4R9MA 4EFDA 1AUGA 5FSUA 1IY7A 2HV2A 2ZEDA 3D7GA 4R8FA 2Q7BA 4PV6A 4NJRA 4J4ZA 3H8EA 1YVOA 4KSFA 3S6FA 2BSWA 3PB4X 4OADA 2IJZA 2KCWA 3GPOA 3TFYA 2NSMA 5JPHA 3EWRA 4UMLA 4ETJA 1B87A 5E3BA 1F2OA 2C6CA 2FIAA 4MFQA 4PK3A 4P4JA 1NSLA 4JZ0A 4MHPA 1BPNA 3SIGA 4NGRA 3V38A 8CPAA 1NMTA 2BO9A 2NYQA 1ELLP 2Z3OA 4FWUA 1IICA 2KQVA 1VHOA 2PDOA 4B11A 3E0KA 4HKFA 3KQXA 4JXQA 1YLEA 1YREA 4MCSA 2AFXA 4UF4A 2Z3NA 5AG6A 1CPSA 2ZEMA 1IIDA 5HH1A 3DSBA 2VI7A 1QMUA 5H84A 4C7HA 2DPSA 2JEVA 4A31A 4K3NA 1H8LA 2I79A 2Q7SA 3IIBA 4R7MA 4II9A 2R98A 4ZBGA 2ZOFA 3L2NA 2PVWA 2PJ1A 4OLLA 3RZAA 2GREA 3B2YA 3PB6X 4MCQA 4A33A 4QBJA 3GUXA 3EWQA 2EVNA 2GANA 4AVBA 1I12A 3F0AA 4F6AA 2PJ8A 1LANA 4CS0B 3I3GA 2BOAA 4MY3A 1Y7RA 4LX9A 3W6XA 2ODFA 7CPAA 3IJ3A 5CMSA 3NH5A 2Q51A 5JQ4A 2CY2A 3PFOA 1K4JA 1IOFA 4P4EA 1PCAA 1YW6A 2G3TA 3KZWA 4YRHA 4JXRA 1IOIA 3LODA 3TC8A 2HUZA 3EJFA 3GPGA 2QMLA 4KOUA 4AXVA 5KTDA 2V8VA 4J5QA 2GLJA 4NGPA 5HXDA 5J1QA 3R1KA 4Y49C 4JCAA 4F0YA 2PSWA 2Z11A 1M4IA 3BI1A 1R43A 1UWYA 3RYOA 4F8ZA 4FBEA 2CXAA 2VXKA 1LAMA 4IK2A 2AFOA 4MMOA 2DXQA 2HQYA 5F46A 2PVVA 3R9FA 4GXHA 2C27A 3PP9A 3RNZA 3LWUA 2AE6A 2EK9A 2ZEEA 4CRZB 3TOBA 2LGRA 4KSIA 2WYRA 3FMCA 4UCPA 3V45A 2JBJA 4MHDA 4CAVA 3SIJA 2FCKA 2PIYA 3VFQA 1A2ZA 4KUAA 2V77A 4GS4A 2VBQA 2BFRA 3EY5A 4LQGA 4OC4A 5K8NA 2AFCA 4ZYQA 2OZHA 2BUEA 2BL1A 1CP6A 2ZEFA 4UFVA 4P4DA 2CNTA 4A39A 1VHSA 5HMNA 1MJAA 3SI2A 4A94A 1ZG7A 2B4DB 4UWIA 3IWWA 4ZGYB 3EFAA 3CT9A 1Z4RA 4FAIA 3WC7A 1XEBA 4Q36A 4YWYA 2JZFA 2OOTA 3S6HA 1IGBA 1F2PA 1ZLHA 1Z8LA 2AJ6A 4ZX8A 4A32A 2PCUA 1DTDA 4B10A 3H8FA 1XOVA 1VGYA 4X8IA 4EVYA 2Z3KA 1XBUA 4KORA 5DUSA 4KVXA 4CGOA 2FSRA 1VHUA 4ZI6A 4KOTA 2AFMA 4MRIA 5AG7A 1ZR3A 2PJ3A 3KASA 5CPAA 4CYNA 2HC9A 4MHNA 3PGPA 3RO0A 4AVCA 4C2YA 1Y9WA 2PRQA 5BWAB 1BO4A 2ABZA 4OIWA 2GE3A 5A28A 1V0CA 5THWA 2RNKA 4JLYA 4UCMA 2K5TA 3HUVA 1X10A 3MGDA 3QAYA 5EC4A 4NF1A 3D7HA 3WR7A 4EWTA 4ESSA 3P2HA 3H8GA 4QUSA 3SJXA 4OC1A 3TX8A 1S7FA 1VKCA 4GM5A 4CAFA 3WC5A 4CAWA 4CRYB 4UEFA 2FVGA 1Z8TA 2WZNA 2OR4A 4BBHA 3DNSA 5G20A 5AG4A 2BFQA 1CP7A 4BINA 5FSVA 4CAEA 3GB0A 1XMBA 4X2TA 3NH8A 2FL4A 4A95A 1GHEA 3GQOA 2ZEHA 5G22A 5JH9A 1DE4C 2QECA 2J8MA 4KSAA 5G21A 4M6HA 3TTHA 3ZZIA 4L8AA 3FJUA 1BLLE 2QYVA 1HEEA 2J9AA 2Q4YA 1WK4A 2PR8A 4PXEA 3S6KA 4AG9A 4M6IA 4MFPA 1VIXA 4UFXA 1Z4EA 4LUAA 5F49A 1QSNA 4R3LA 1Q7LA 4KOWA 4MHYA 4XNHC 3VWDA 1XF8A 4R76A 4RI1A 3B7IA 4M85A 2V8GA 1F57A 1YX0A 1ZO0A 2P6EA 3LMSA 4EMEA 4CYPA 6CPAA 5FSYA 4ORFA 3PB8X 3PBBA 2FIWA 4CGPA 3FECA 3B3CA 5J8CA 2Z10A 3B35A 3IIFA 4R6TA 4LQ6A 1RO5A 5F48A 2V8HA 1Q2CA 3WABA 3WC6A 5AGEA 3RBUA 1MJBA 4OP4A 2ZELA 2R1IA 3C26A 3FYNA 4B6ZA 3IWEA 2C1CA 4X5KA 1YK3A 3SI1A 4F9VA 2W2GA 4OIDA 4ONUA 4QB9A 3S9MA 3PBEA 4AG7A 4DNCA 3FEDA 3D8PA 4H2KA 2DX6A 2JDCA 3FX6A 3W91A 3CDXA 1LAPA 4KLWA 4M3SA 3DGVA
chains in the Genus database with same CATH topology
1EE3P 5CB5A 1BPMA 4MHZA 3ETIA 4GVVA 1OBRA 4TU0A 1XFOA 5K8PA 5F09A 2PJ4A 4W9YA 4GUAA 3JRUA 3D68A 3SJGA 2AFSA 3IO1A 2IQ6A 5K8MA 5LYIA 4ZY0A 3PRTA 1JQGA 2XEFA 2EWBA 3N5FA 1KWMA 3HLPA 3RAMA 1FT7A 3IC1A 5HIHA 1ZG9A 4IQYA 3IEHA 3BHXA 1Y7EA 4JLLA 1CG2A 2PJ5A 3MN8A 2QVPA 2VRIA 3KL9A 2DEAA 2PIZA 3EKEA 4P4BA 3VH9A 2Q43A 1Y0YA 3RZAA 4IHMA 3NFZA 5D8NA 1Z2LA 1R3NA 4O23A 2RB7A 3T8WA 2AFZA 3VATA 5D29A 5CB3A 1NSAA 4UEEA 2V8DA 2QJ8A 4PPZA 4NGQA 3EW5A 3WT4A 4PXDA 2C6PA 1BAVA 2FXKA 3GLJA 2VL1A 4OMEA 2ZOGA 2CTCA 2XEJA 1ZLIA 1PYTB 3EWOA 2POKA 4OC5A 1ELMP 4ABLA 3S9NA 2Q4ZA 4P4FA 4A38A 5LRKA 2HB6A 1HDQA 3NH4A 2GLFA 1RTQA 2AFUA 2CF4A 4TNUA 3Q71A 2BCOA 2XD7A 2EK8A 2PE3A 4J5SA 3I1UA 4RUHA 2ANPA 4DJLA 3BI0A 3GQEA 1CX8A 3DLJA 4NGNA 3PB9X 2PJCA 4Q7AA 1ZR5A 4ABKA 2I3CA 4ZY1A 3ISXA 4UEZA 4PQAA 3K2KA 5LRJA 5K8OA 5JM6A 1SPVA 2CTBA 5JGFA 4CPAA 4IAVA 5I4MA 3S9LA 3JZTA 2JBKA 4UIBA 1YD9A 3IFEA 4X3RA 2PJ9A 4DUKA 1M4LA 5FSXA 3PB7X 1TXRA 2ZEPA 1CPXA 2EEEA 4MCRA 2FAVA 2F8HA 4DYOA 4OC3A 1TXZA 3SIIA 4UIAA 1FNOA 3D66A 1VHEA 1XRYA 2O53A 4PXBA 3KGQA 1TF9A 3GPQA 3V2BA 1YLOA 3Q6ZA 4F9UA 4NFRA 3VARA 4FAIA 1LOKA 4P10A 2XEIA 3FH4A 2PJAA 4ONWA 3KQZA 1LFWA 2ZENA 4Z65A 4J5RA 3FF3A 4P4IA 2AFWA 1AMPA 5IB9A 3D4UA 4OKOA 4MCPA 3SI0A 2ZEGA 4P44A 3KI9A 2PJ6A 3NA6A 4YU9A 3SJEA 3B3TA 3FVLA 3SIHA 2G9DA 4D86A 4G1PA 5JH9A 1XJOA 3B3VA 4TWEA 2RFHA 3ISZA 4WJBA 2IMOA 4NGTA 4WWVA 4ZX9A 3BXMA 3CPAA 3B3SA 5FSZA 3FEEA 1TKFA 1Z5RA 2PJ7A 5ELYA 3MRUA 5CBMA 3K9TA 3D67A 4BD9A 3KR5A 1NJRA 1ZG8A 4MXUA 1LCPA 4NGSA 5HVHA 5AILA 5LYFA 1HJZA 4NJQA 1ARLA 2CIJA 4FUUA 1Y0RA 2F7VA 4P6YA 1TF8A 2ZEOA 1CBXA 3SJFA 1TY8A 4NGMA 5LYLA 4GVWA 3EWPA 2L8RA 2JEWA 4K0CA 1GYTA 2PJ0A 3D7DA 3KHXA 3IIDA 2PJBA 5HVGA 2XEGA 4JGKA 3PFEA 1TKHA 3B3WA 2GU2A 3D7FA 4ZY2A 2O4HA 1YMEA 5LYDA 5HVFA 4PXCA 1ARMA 1YW4A 4JVVA 2PJ2A 4A37A 2ACFA 1QQ9A 3CPXA 2X47A 1AYEA 2FG1A 4OC0A 4OC2A 4KYBA 3EJGA 3QNVA 4ETKA 5DS0A 1HDUA 3KHZA 5LRGA 3KR4A 5HOLA 3PEIA 2C6GA 4JYWA 4P45A 1TKJA 1YSJA 4EFDA 5FSUA 1IY7A 2ZEDA 3D7GA 4R8FA 4NJRA 4J4ZA 3H8EA 3PB4X 2IJZA 3GPOA 2NSMA 3EWRA 4UMLA 4ETJA 2C6CA 5E3BA 1F2OA 4P4JA 4JZ0A 4MHPA 1BPNA 3SIGA 4NGRA 3V38A 8CPAA 2BO9A 2NYQA 1ELLP 4FWUA 1VHOA 3KQXA 4MCSA 4UF4A 2AFXA 1CPSA 2ZEMA 1QMUA 4K3NA 1H8LA 3IIBA 4R7MA 2ZOFA 3L2NA 2PVWA 2PJ1A 2GREA 3B2YA 3PB6X 4MCQA 3GUXA 3EWQA 2PJ8A 1LANA 2BOAA 7CPAA 3IJ3A 5CMSA 3NH5A 2Q51A 3PFOA 4P4EA 1PCAA 1YW6A 3KZWA 3TC8A 4AXVA 3EJFA 3GPGA 2V8VA 2GLJA 4J5QA 4NGPA 5HXDA 5J1QA 4JCAA 4FBEA 3BI1A 4F8ZA 1R43A 1UWYA 1LAMA 4IK2A 2AFOA 4MMOA 2PVVA 3LWUA 2EK9A 2ZEEA 2LGRA 4KSIA 2WYRA 3FMCA 3V45A 2JBJA 3SIJA 2PIYA 3VFQA 2V77A 4OC4A 2BFRA 4LQGA 5K8NA 2AFCA 4ZYQA 1CP6A 2ZEFA 4P4DA 4A39A 3SI2A 4A94A 1ZG7A 3IWWA 3CT9A 3WC7A 4YWYA 2OOTA 1IGBA 1F2PA 1ZLHA 1Z8LA 4ZX8A 2PCUA 1DTDA 3H8FA 4X8IA 1VGYA 1XBUA 5DUSA 1VHUA 4ZI6A 2AFMA 4MRIA 5CPAA 1ZR3A 2PJ3A 3KASA 2HC9A 4MHNA 2PRQA 2ABZA 4OIWA 5THWA 3HUVA 3D7HA 4EWTA 4ESSA 3H8GA 3SJXA 3TX8A 4OC1A 4GM5A 3WC5A 4UEFA 2FVGA 2WZNA 2OR4A 2BFQA 1CP7A 5FSVA 3GB0A 1XMBA 4X2TA 3NH8A 3GQOA 2ZEHA 1DE4C 3FJUA 1BLLE 2QYVA 1HEEA 2J9AA 4PXEA 1VIXA 1Q7LA 4MHYA 4R76A 3B7IA 2V8GA 1F57A 3LMSA 6CPAA 4EMEA 5FSYA 3PB8X 3PBBA 3FECA 3B3CA 3B35A 3IIFA 4R6TA 3WABA 3WC6A 2V8HA 3RBUA 4OP4A 2ZELA 4B6ZA 4F9VA 2C1CA 3SI1A 4OIDA 3S9MA 3PBEA 3FEDA 4H2KA 2DX6A 3FX6A 3CDXA 1LAPA 3V7ZA 3DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE3 P;  5CB5 A;  1BPM A;  4MHZ A;  3ETI A;  4GVV A;  1OBR A;  4TU0 A;  1XFO A;  5K8P A;  5F09 A;  2PJ4 A;  4W9Y A;  4GUA A;  3JRU A;  3D68 A;  3SJG A;  2AFS A;  3IO1 A;  2IQ6 A;  5K8M A;  5LYI A;  4ZY0 A;  3PRT A;  1JQG A;  2XEF A;  2EWB A;  3N5F A;  1KWM A;  3HLP A;  3RAM A;  1FT7 A;  3IC1 A;  5HIH A;  1ZG9 A;  4IQY A;  3IEH A;  3BHX A;  1Y7E A;  4JLL A;  1CG2 A;  2PJ5 A;  3MN8 A;  2QVP A;  2VRI A;  3KL9 A;  2DEA A;  2PIZ A;  3EKE A;  4P4B A;  3VH9 A;  2Q43 A;  1Y0Y A;  3RZA A;  4IHM A;  3NFZ A;  5D8N A;  1Z2L A;  1R3N A;  4O23 A;  2RB7 A;  3T8W A;  2AFZ A;  3VAT A;  5D29 A;  5CB3 A;  1NSA A;  4UEE A;  2V8D A;  2QJ8 A;  4PPZ A;  4NGQ A;  3EW5 A;  3WT4 A;  4PXD A;  2C6P A;  1BAV A;  2FXK A;  3GLJ A;  2VL1 A;  4OME A;  2ZOG A;  2CTC A;  2XEJ A;  1ZLI A;  1PYT B;  3EWO A;  2POK A;  4OC5 A;  1ELM P;  4ABL A;  3S9N A;  2Q4Z A;  4P4F A;  4A38 A;  5LRK A;  2HB6 A;  1HDQ A;  3NH4 A;  2GLF A;  1RTQ A;  2AFU A;  2CF4 A;  4TNU A;  3Q71 A;  2BCO A;  2XD7 A;  2EK8 A;  2PE3 A;  4J5S A;  3I1U A;  4RUH A;  2ANP A;  4DJL A;  3BI0 A;  3GQE A;  1CX8 A;  3DLJ A;  4NGN A;  3PB9 X;  2PJC A;  4Q7A A;  1ZR5 A;  4ABK A;  2I3C A;  4ZY1 A;  3ISX A;  4UEZ A;  4PQA A;  3K2K A;  5LRJ A;  5K8O A;  5JM6 A;  1SPV A;  2CTB A;  5JGF A;  4CPA A;  4IAV A;  5I4M A;  3S9L A;  3JZT A;  2JBK A;  4UIB A;  1YD9 A;  3IFE A;  4X3R A;  2PJ9 A;  4DUK A;  1M4L A;  5FSX A;  3PB7 X;  1TXR A;  2ZEP A;  1CPX A;  2EEE A;  4MCR A;  2FAV A;  2F8H A;  4DYO A;  4OC3 A;  1TXZ A;  3SII A;  4UIA A;  1FNO A;  3D66 A;  1VHE A;  1XRY A;  2O53 A;  4PXB A;  3KGQ A;  1TF9 A;  3GPQ A;  3V2B A;  1YLO A;  3Q6Z A;  4F9U A;  4NFR A;  3VAR A;  4FAI A;  1LOK A;  4P10 A;  2XEI A;  3FH4 A;  2PJA A;  4ONW A;  3KQZ A;  1LFW A;  2ZEN A;  4Z65 A;  4J5R A;  3FF3 A;  4P4I A;  2AFW A;  1AMP A;  5IB9 A;  3D4U A;  4OKO A;  4MCP A;  3SI0 A;  2ZEG A;  4P44 A;  3KI9 A;  2PJ6 A;  3NA6 A;  4YU9 A;  3SJE A;  3B3T A;  3FVL A;  3SIH A;  2G9D A;  4D86 A;  4G1P A;  5JH9 A;  1XJO A;  3B3V A;  4TWE A;  2RFH A;  3ISZ A;  4WJB A;  2IMO A;  4NGT A;  4WWV A;  4ZX9 A;  3BXM A;  3CPA A;  3B3S A;  5FSZ A;  3FEE A;  1TKF A;  1Z5R A;  2PJ7 A;  5ELY A;  3MRU A;  5CBM A;  3K9T A;  3D67 A;  4BD9 A;  3KR5 A;  1NJR A;  1ZG8 A;  4MXU A;  1LCP A;  4NGS A;  5HVH A;  5AIL A;  5LYF A;  1HJZ A;  4NJQ A;  1ARL A;  2CIJ A;  4FUU A;  1Y0R A;  2F7V A;  4P6Y A;  1TF8 A;  2ZEO A;  1CBX A;  3SJF A;  1TY8 A;  4NGM A;  5LYL A;  4GVW A;  3EWP A;  2L8R A;  2JEW A;  4K0C A;  1GYT A;  2PJ0 A;  3D7D A;  3KHX A;  3IID A;  2PJB A;  5HVG A;  2XEG A;  4JGK A;  3PFE A;  1TKH A;  3B3W A;  2GU2 A;  3D7F A;  4ZY2 A;  2O4H A;  1YME A;  5LYD A;  5HVF A;  4PXC A;  1ARM A;  1YW4 A;  4JVV A;  2PJ2 A;  4A37 A;  2ACF A;  1QQ9 A;  3CPX A;  2X47 A;  1AYE A;  2FG1 A;  4OC0 A;  4OC2 A;  4KYB A;  3EJG A;  3QNV A;  4ETK A;  5DS0 A;  1HDU A;  3KHZ A;  5LRG A;  3KR4 A;  5HOL A;  3PEI A;  2C6G A;  4JYW A;  4P45 A;  1TKJ A;  1YSJ A;  4EFD A;  5FSU A;  1IY7 A;  2ZED A;  3D7G A;  4R8F A;  4NJR A;  4J4Z A;  3H8E A;  3PB4 X;  2IJZ A;  3GPO A;  2NSM A;  3EWR A;  4UML A;  4ETJ A;  2C6C A;  5E3B A;  1F2O A;  4P4J A;  4JZ0 A;  4MHP A;  1BPN A;  3SIG A;  4NGR A;  3V38 A;  8CPA A;  2BO9 A;  2NYQ A;  1ELL P;  4FWU A;  1VHO A;  3KQX A;  4MCS A;  4UF4 A;  2AFX A;  1CPS A;  2ZEM A;  1QMU A;  4K3N A;  1H8L A;  3IIB A;  4R7M A;  2ZOF A;  3L2N A;  2PVW A;  2PJ1 A;  2GRE A;  3B2Y A;  3PB6 X;  4MCQ A;  3GUX A;  3EWQ A;  2PJ8 A;  1LAN A;  2BOA A;  7CPA A;  3IJ3 A;  5CMS A;  3NH5 A;  2Q51 A;  3PFO A;  4P4E A;  1PCA A;  1YW6 A;  3KZW A;  3TC8 A;  4AXV A;  3EJF A;  3GPG A;  2V8V A;  2GLJ A;  4J5Q A;  4NGP A;  5HXD A;  5J1Q A;  4JCA A;  4FBE A;  3BI1 A;  4F8Z A;  1R43 A;  1UWY A;  1LAM A;  4IK2 A;  2AFO A;  4MMO A;  2PVV A;  3LWU A;  2EK9 A;  2ZEE A;  2LGR A;  4KSI A;  2WYR A;  3FMC A;  3V45 A;  2JBJ A;  3SIJ A;  2PIY A;  3VFQ A;  2V77 A;  4OC4 A;  2BFR A;  4LQG A;  5K8N A;  2AFC A;  4ZYQ A;  1CP6 A;  2ZEF A;  4P4D A;  4A39 A;  3SI2 A;  4A94 A;  1ZG7 A;  3IWW A;  3CT9 A;  3WC7 A;  4YWY A;  2OOT A;  1IGB A;  1F2P A;  1ZLH A;  1Z8L A;  4ZX8 A;  2PCU A;  1DTD A;  3H8F A;  4X8I A;  1VGY A;  1XBU A;  5DUS A;  1VHU A;  4ZI6 A;  2AFM A;  4MRI A;  5CPA A;  1ZR3 A;  2PJ3 A;  3KAS A;  2HC9 A;  4MHN A;  2PRQ A;  2ABZ A;  4OIW A;  5THW A;  3HUV A;  3D7H A;  4EWT A;  4ESS A;  3H8G A;  3SJX A;  3TX8 A;  4OC1 A;  4GM5 A;  3WC5 A;  4UEF A;  2FVG A;  2WZN A;  2OR4 A;  2BFQ A;  1CP7 A;  5FSV A;  3GB0 A;  1XMB A;  4X2T A;  3NH8 A;  3GQO A;  2ZEH A;  1DE4 C;  3FJU A;  1BLL E;  2QYV A;  1HEE A;  2J9A A;  4PXE A;  1VIX A;  1Q7L A;  4MHY A;  4R76 A;  3B7I A;  2V8G A;  1F57 A;  3LMS A;  6CPA A;  4EME A;  5FSY A;  3PB8 X;  3PBB A;  3FEC A;  3B3C A;  3B35 A;  3IIF A;  4R6T A;  3WAB A;  3WC6 A;  2V8H A;  3RBU A;  4OP4 A;  2ZEL A;  4B6Z A;  4F9V A;  2C1C A;  3SI1 A;  4OID A;  3S9M A;  3PBE A;  3FED A;  4H2K A;  2DX6 A;  3FX6 A;  3CDX A;  1LAP A;  3V7Z A;  3DGV A; 
#chains in the Genus database with same CATH topology
 1EE3 P;  1XMT A;  4UWJ A;  5CB5 A;  1WWZ A;  1BPM A;  4JWP A;  1B6B A;  4KOX A;  4KVM E;  2PQ8 A;  3ETI A;  4GVV A;  1KUV A;  4MHZ A;  2FT0 A;  3BLN A;  5IX3 A;  5GCN A;  1OBR A;  4TU0 A;  1XFO A;  5K8P A;  5F09 A;  4YFJ A;  4AVA A;  3R96 A;  2OZG A;  1S7N A;  2WSA A;  4FD7 A;  3T9Y A;  2PJ4 A;  3OWC A;  4GUA A;  4W9Y A;  1BOB A;  3JVN A;  3JRU A;  3D68 A;  3JTK A;  3SJG A;  2AFS A;  2ZW7 A;  3IO1 A;  4Q38 A;  4CAX A;  3TCV A;  2IQ6 A;  5K8M A;  1J4J A;  5LYI A;  4ZY0 A;  2P0W A;  2JZE A;  3DR6 A;  3IWG A;  3PRT A;  1JQG A;  2XEF A;  5DWM A;  3H4Q A;  4B5O A;  2EWB A;  2YGW A;  3N5F A;  1KWM A;  4MFJ A;  1JWQ A;  3HLP A;  3LAC A;  3RAM A;  1FT7 A;  4HNX B;  3IC1 A;  2IL4 A;  2CNM A;  5HIH A;  2R8V A;  1ZG9 A;  4AB7 A;  4IQY A;  3IEH A;  3BHX A;  4CGM A;  1Y7E A;  4B5P B;  4JLL A;  1CG2 A;  2PJ5 A;  4KOY A;  2REE A;  3MN8 A;  1S7K A;  1PU9 A;  1KUY A;  3GKR A;  2QVP A;  3KKW A;  1FY7 A;  5EBV A;  2VRI A;  3GYA A;  3QB8 A;  2WUU A;  4KUB A;  3KL9 A;  5KTA A;  2ATR A;  3TO7 A;  1M44 A;  4RN7 A;  2DEA A;  1YGH A;  4H89 A;  1P0H A;  3GY9 A;  1IYK A;  2PIZ A;  3EKE A;  4P4B A;  3VH9 A;  2P6G A;  3V8I A;  1Z8W A;  2Q43 A;  1R57 A;  4FD5 A;  2I00 A;  1Y0Y A;  4MFL A;  2B3V A;  3FBU A;  4IHM A;  2B3U A;  4KLV A;  3NFZ A;  4MJ8 A;  5G1Z A;  1PUA A;  3K9U A;  4NSQ A;  3UY5 A;  4F0X A;  1TIQ A;  4KOV A;  5D8N A;  1Z2L A;  3A9L A;  1R3N A;  4O23 A;  2RB7 A;  4IF5 A;  3T8W A;  1S7L A;  2AFZ A;  3H5Z A;  3VAT A;  5D29 A;  2YNE A;  5CB3 A;  1NSA A;  2Q0Y A;  4UEE A;  4PSX A;  2Y0M A;  3LD2 A;  2V8D A;  2QJ8 A;  4PPZ A;  4NGQ A;  3PZJ A;  3EW5 A;  3WT4 A;  4PXD A;  2A4N A;  2C6P A;  1BAV A;  2FXK A;  3GLJ A;  2BEI A;  3IU2 A;  2VL1 A;  1Z8X A;  5IB0 A;  2EBJ A;  4OME A;  2ZOG A;  4A2Z A;  2CTC A;  4HPS A;  2G3A A;  5E96 A;  2XEJ A;  2Q44 A;  4L89 A;  4XNH B;  1ZLI A;  1YQE A;  2ZW5 A;  1PYT B;  5C88 A;  4JJX A;  3EWO A;  1S3Z A;  2POK A;  4OC5 A;  1ELM P;  4ABL A;  3S9N A;  2Q4Z A;  2H5M A;  4P4F A;  4A38 A;  4B12 A;  3F5B A;  4KZT A;  4MY0 A;  5LRK A;  4MFZ A;  2HB6 A;  2ZPA A;  1HDQ A;  4U5Y A;  4C68 A;  3NH4 A;  2GLF A;  1RTQ A;  2B4D A;  3DDD A;  2AFU A;  2CF4 A;  2D4O A;  4TNU A;  2YNC A;  3Q71 A;  2BCO A;  2XD7 A;  2EK8 A;  2PE3 A;  4J5S A;  3FXT A;  3I1U A;  2QIR A;  4RUH A;  1QST A;  2ANP A;  4DJL A;  3GQE A;  3BI0 A;  5IV0 A;  1CX8 A;  3DLJ A;  3BJ7 A;  5CNP A;  1CM0 A;  4NGN A;  2WPX A;  3PB9 X;  3R95 A;  2PJC A;  4HNW B;  1IU8 A;  2D4P A;  4HNY B;  4Q7A A;  1ZR5 A;  5DWN A;  4C7I A;  4ABK A;  2I3C A;  4ZY1 A;  3ISX A;  4UEZ A;  4PQA A;  3G8W A;  3V7Z A;  3K2K A;  2J8R A;  4U9Z A;  5LRJ A;  5K8O A;  1KZF A;  5JM6 A;  1SPV A;  1Q2Y A;  2CTB A;  5JGF A;  4CPA A;  4IAV A;  2ZXV A;  5I4M A;  3S6G A;  3S9L A;  3G3S A;  3TE4 A;  3JZT A;  3SXO A;  2JBK A;  4UIB A;  2REF A;  2B58 A;  1YD9 A;  3IFE A;  4X3R A;  2G0B A;  2PJ9 A;  4DUK A;  4KVO E;  1M4L A;  5FSX A;  2WCT A;  3R9G A;  3PB7 X;  1TXR A;  2CNS A;  1CPX A;  2ZEP A;  4CYQ A;  4A30 A;  2EEE A;  3CXP A;  1Y9K A;  2ZW6 A;  4MCR A;  2FAV A;  2F8H A;  4B14 A;  4DYO A;  5ISV A;  4FD6 A;  4OC3 A;  1TXZ A;  4YGO A;  3SII A;  2O28 A;  4NCZ A;  1S5K A;  2Z3P A;  4OAE A;  4UIA A;  1Q2D A;  1FNO A;  3D66 A;  4E0A A;  2NMT A;  2YND A;  1VHE A;  1XRY A;  2O53 A;  3CXS A;  3W6S A;  4PXB A;  5H86 A;  3KGQ A;  1TF9 A;  2FS5 A;  3GPQ A;  4UBR A;  3V2B A;  1YLO A;  3I9S A;  3Q6Z A;  4E8O A;  4F9U A;  2JDD A;  2PC1 A;  4NFR A;  3VAR A;  3TOA A;  1RXT A;  1LOK A;  4P10 A;  4U9Y A;  4FD4 A;  5KTC A;  3FIX A;  2XEI A;  3FH4 A;  3ZJ0 A;  3TO6 A;  2PJA A;  4ONW A;  3KQZ A;  1LFW A;  2X7B A;  2Z3M A;  2ZEN A;  4Z65 A;  1MK4 A;  4J5R A;  2VEZ A;  4MFK A;  4MI4 A;  4UCN A;  3D2P A;  3FF3 A;  4P4I A;  3IU1 A;  2AFW A;  1AMP A;  4E2A A;  5IB9 A;  3D4U A;  4OKO A;  4NXY A;  4MCP A;  2DF5 A;  3SI0 A;  4UA3 A;  3IGR A;  2ZEG A;  4P44 A;  4XPL A;  1Z9U A;  5A27 A;  4XPD C;  3KI9 A;  2PJ6 A;  4NEX A;  3NA6 A;  4QC6 A;  3SXN A;  5FVJ A;  4YU9 A;  3SJE A;  1SQH A;  5AG5 A;  3B3T A;  3FVL A;  3SIH A;  2G9D A;  4D86 A;  1UFH A;  2OU2 A;  3BJ8 A;  3NE7 A;  4G1P A;  4XPD B;  2OZU A;  3FB3 A;  1XJO A;  2B4B A;  3TT2 A;  1CJW A;  3B3V A;  4IUS A;  3R9E A;  4TWE A;  2RFH A;  3ISZ A;  4WJB A;  4PK2 A;  4CGL A;  5I0C A;  2B5G A;  2IMO A;  1YR0 A;  3NE8 A;  2PRB A;  4NGT A;  2J8N A;  4J3G A;  4UFW A;  4WWV A;  4ZX9 A;  2OB0 A;  3BXM A;  3B3S A;  3CPA A;  5FSZ A;  3FEE A;  4C2Z A;  1TKF A;  4KOS A;  4BMH A;  2Z0Z A;  3GIU A;  4K30 A;  1Z5R A;  4R87 A;  2PJ7 A;  4XPK A;  4R57 A;  5ELY A;  1OZP A;  2JLM A;  3SHP A;  3TO9 A;  3MRU A;  3QAH A;  5CBM A;  3K9T A;  4CYO A;  3D67 A;  2YNC C;  4BD9 A;  3KR5 A;  4M6G A;  1NJR A;  2GIV A;  1ZG8 A;  4MXU A;  1I1D A;  1KUX A;  1LCP A;  4NGS A;  1N71 A;  1QSR A;  5HVH A;  5AIL A;  2B5G B;  2VZY A;  3FNC A;  1IB1 E;  2R7H A;  5LYF A;  1HJZ A;  3D2M A;  1XE4 A;  4NJQ A;  3EC4 A;  1ARL A;  4R3K A;  2CIJ A;  2DPT A;  3JUW A;  1X12 A;  3CZX A;  4FUU A;  2EUI A;  1Y0R A;  2F7V A;  4B5P A;  3EXN A;  4P6Y A;  2GFQ A;  1TF8 A;  1YVK A;  1M4G A;  2ZEO A;  4H6U A;  1M4D A;  4H6Z A;  4CGN A;  1CBX A;  1IYL A;  4B13 A;  1I21 A;  3SJF A;  1TY8 A;  4NGM A;  5LYL A;  5EMI A;  4GVW A;  3VWE A;  1LRZ A;  2EO8 A;  3EWP A;  1S60 A;  3DR8 A;  2P6F A;  2L8R A;  2JEW A;  1U6M A;  3D3S A;  4K0C A;  4RS2 A;  3N7Z A;  1GYT A;  2PJ0 A;  1L0C A;  2ZW4 A;  3D7D A;  3KHX A;  4Y49 B;  3IID A;  2JZD A;  2PJB A;  2VQY A;  4I49 A;  3CXQ A;  2XEG A;  4KS9 A;  4MBU A;  5HVG A;  4JGK A;  3EO4 A;  5C82 A;  2ARH A;  3PFE A;  1TKH A;  3B3W A;  5J8F A;  2GU2 A;  1ON0 A;  2Z3L A;  3D7F A;  4ZY2 A;  2O4H A;  1YME A;  5LYD A;  2RC4 A;  5HVF A;  1QSM A;  4PXC A;  2WPW A;  1ARM A;  1YW4 A;  4JVV A;  1XIX A;  2PJ2 A;  1MJ9 A;  4A37 A;  2FE7 A;  2ACF A;  1QQ9 A;  3CPX A;  2X47 A;  2Q4V A;  4JD6 A;  1AYE A;  3T90 A;  2FG1 A;  4OC0 A;  4OC2 A;  2VZZ A;  2FXF A;  3F8K A;  1P4N A;  3P2F A;  4C2X A;  4KYB A;  4QVT A;  3EJG A;  3QNV A;  4ETK A;  1M1D A;  1HDU A;  4PSW A;  5DS0 A;  1QSO A;  3KHZ A;  5LRG A;  2PR1 A;  3B8G A;  3FRM A;  2F5I A;  3KR4 A;  5HOL A;  3PEI A;  2OH1 A;  5F47 A;  2C6G A;  4JYW A;  4P45 A;  1NE9 A;  2Q04 A;  1TKJ A;  1YSJ A;  4R9M A;  4EFD A;  1AUG A;  5FSU A;  1IY7 A;  2HV2 A;  2ZED A;  3D7G A;  4R8F A;  2Q7B A;  4PV6 A;  4NJR A;  4J4Z A;  3H8E A;  1YVO A;  4KSF A;  3S6F A;  2BSW A;  3PB4 X;  4OAD A;  2IJZ A;  2KCW A;  3GPO A;  3TFY A;  2NSM A;  5JPH A;  3EWR A;  4UML A;  4ETJ A;  1B87 A;  5E3B A;  1F2O A;  2C6C A;  2FIA A;  4MFQ A;  4PK3 A;  4P4J A;  1NSL A;  4JZ0 A;  4MHP A;  1BPN A;  3SIG A;  4NGR A;  3V38 A;  8CPA A;  1NMT A;  2BO9 A;  2NYQ A;  1ELL P;  2Z3O A;  4FWU A;  1IIC A;  2KQV A;  1VHO A;  2PDO A;  4B11 A;  3E0K A;  4HKF A;  3KQX A;  4JXQ A;  1YLE A;  1YRE A;  4MCS A;  2AFX A;  4UF4 A;  2Z3N A;  5AG6 A;  1CPS A;  2ZEM A;  1IID A;  5HH1 A;  3DSB A;  2VI7 A;  1QMU A;  5H84 A;  4C7H A;  2DPS A;  2JEV A;  4A31 A;  4K3N A;  1H8L A;  2I79 A;  2Q7S A;  3IIB A;  4R7M A;  4II9 A;  2R98 A;  4ZBG A;  2ZOF A;  3L2N A;  2PVW A;  2PJ1 A;  4OLL A;  3RZA A;  2GRE A;  3B2Y A;  3PB6 X;  4MCQ A;  4A33 A;  4QBJ A;  3GUX A;  3EWQ A;  2EVN A;  2GAN A;  4AVB A;  1I12 A;  3F0A A;  4F6A A;  2PJ8 A;  1LAN A;  4CS0 B;  3I3G A;  2BOA A;  4MY3 A;  1Y7R A;  4LX9 A;  3W6X A;  2ODF A;  7CPA A;  3IJ3 A;  5CMS A;  3NH5 A;  2Q51 A;  5JQ4 A;  2CY2 A;  3PFO A;  1K4J A;  1IOF A;  4P4E A;  1PCA A;  1YW6 A;  2G3T A;  3KZW A;  4YRH A;  4JXR A;  1IOI A;  3LOD A;  3TC8 A;  2HUZ A;  3EJF A;  3GPG A;  2QML A;  4KOU A;  4AXV A;  5KTD A;  2V8V A;  4J5Q A;  2GLJ A;  4NGP A;  5HXD A;  5J1Q A;  3R1K A;  4Y49 C;  4JCA A;  4F0Y A;  2PSW A;  2Z11 A;  1M4I A;  3BI1 A;  1R43 A;  1UWY A;  3RYO A;  4F8Z A;  4FBE A;  2CXA A;  2VXK A;  1LAM A;  4IK2 A;  2AFO A;  4MMO A;  2DXQ A;  2HQY A;  5F46 A;  2PVV A;  3R9F A;  4GXH A;  2C27 A;  3PP9 A;  3RNZ A;  3LWU A;  2AE6 A;  2EK9 A;  2ZEE A;  4CRZ B;  3TOB A;  2LGR A;  4KSI A;  2WYR A;  3FMC A;  4UCP A;  3V45 A;  2JBJ A;  4MHD A;  4CAV A;  3SIJ A;  2FCK A;  2PIY A;  3VFQ A;  1A2Z A;  4KUA A;  2V77 A;  4GS4 A;  2VBQ A;  2BFR A;  3EY5 A;  4LQG A;  4OC4 A;  5K8N A;  2AFC A;  4ZYQ A;  2OZH A;  2BUE A;  2BL1 A;  1CP6 A;  2ZEF A;  4UFV A;  4P4D A;  2CNT A;  4A39 A;  1VHS A;  5HMN A;  1MJA A;  3SI2 A;  4A94 A;  1ZG7 A;  2B4D B;  4UWI A;  3IWW A;  4ZGY B;  3EFA A;  3CT9 A;  1Z4R A;  4FAI A;  3WC7 A;  1XEB A;  4Q36 A;  4YWY A;  2JZF A;  2OOT A;  3S6H A;  1IGB A;  1F2P A;  1ZLH A;  1Z8L A;  2AJ6 A;  4ZX8 A;  4A32 A;  2PCU A;  1DTD A;  4B10 A;  3H8F A;  1XOV A;  1VGY A;  4X8I A;  4EVY A;  2Z3K A;  1XBU A;  4KOR A;  5DUS A;  4KVX A;  4CGO A;  2FSR A;  1VHU A;  4ZI6 A;  4KOT A;  2AFM A;  4MRI A;  5AG7 A;  1ZR3 A;  2PJ3 A;  3KAS A;  5CPA A;  4CYN A;  2HC9 A;  4MHN A;  3PGP A;  3RO0 A;  4AVC A;  4C2Y A;  1Y9W A;  2PRQ A;  5BWA B;  1BO4 A;  2ABZ A;  4OIW A;  2GE3 A;  5A28 A;  1V0C A;  5THW A;  2RNK A;  4JLY A;  4UCM A;  2K5T A;  3HUV A;  1X10 A;  3MGD A;  3QAY A;  5EC4 A;  4NF1 A;  3D7H A;  3WR7 A;  4EWT A;  4ESS A;  3P2H A;  3H8G A;  4QUS A;  3SJX A;  4OC1 A;  3TX8 A;  1S7F A;  1VKC A;  4GM5 A;  4CAF A;  3WC5 A;  4CAW A;  4CRY B;  4UEF A;  2FVG A;  1Z8T A;  2WZN A;  2OR4 A;  4BBH A;  3DNS A;  5G20 A;  5AG4 A;  2BFQ A;  1CP7 A;  4BIN A;  5FSV A;  4CAE A;  3GB0 A;  1XMB A;  4X2T A;  3NH8 A;  2FL4 A;  4A95 A;  1GHE A;  3GQO A;  2ZEH A;  5G22 A;  5JH9 A;  1DE4 C;  2QEC A;  2J8M A;  4KSA A;  5G21 A;  4M6H A;  3TTH A;  3ZZI A;  4L8A A;  3FJU A;  1BLL E;  2QYV A;  1HEE A;  2J9A A;  2Q4Y A;  1WK4 A;  2PR8 A;  4PXE A;  3S6K A;  4AG9 A;  4M6I A;  4MFP A;  1VIX A;  4UFX A;  1Z4E A;  4LUA A;  5F49 A;  1QSN A;  4R3L A;  1Q7L A;  4KOW A;  4MHY A;  4XNH C;  3VWD A;  1XF8 A;  4R76 A;  4RI1 A;  3B7I A;  4M85 A;  2V8G A;  1F57 A;  1YX0 A;  1ZO0 A;  2P6E A;  3LMS A;  4EME A;  4CYP A;  6CPA A;  5FSY A;  4ORF A;  3PB8 X;  3PBB A;  2FIW A;  4CGP A;  3FEC A;  3B3C A;  5J8C A;  2Z10 A;  3B35 A;  3IIF A;  4R6T A;  4LQ6 A;  1RO5 A;  5F48 A;  2V8H A;  1Q2C A;  3WAB A;  3WC6 A;  5AGE A;  3RBU A;  1MJB A;  4OP4 A;  2ZEL A;  2R1I A;  3C26 A;  3FYN A;  4B6Z A;  3IWE A;  2C1C A;  4X5K A;  1YK3 A;  3SI1 A;  4F9V A;  2W2G A;  4OID A;  4ONU A;  4QB9 A;  3S9M A;  3PBE A;  4AG7 A;  4DNC A;  3FED A;  3D8P A;  4H2K A;  2DX6 A;  2JDC A;  3FX6 A;  3W91 A;  3CDX A;  1LAP A;  4KLW A;  4M3S A;  3DGV A; 
#chains in the Genus database with same CATH homology
 1EE3 P;  5CB5 A;  1BPM A;  4MHZ A;  3ETI A;  4GVV A;  1OBR A;  4TU0 A;  1XFO A;  5K8P A;  5F09 A;  2PJ4 A;  4W9Y A;  4GUA A;  3JRU A;  3D68 A;  3SJG A;  2AFS A;  3IO1 A;  2IQ6 A;  5K8M A;  5LYI A;  4ZY0 A;  3PRT A;  1JQG A;  2XEF A;  2EWB A;  3N5F A;  1KWM A;  3HLP A;  3RAM A;  1FT7 A;  3IC1 A;  5HIH A;  1ZG9 A;  4IQY A;  3IEH A;  3BHX A;  1Y7E A;  4JLL A;  1CG2 A;  2PJ5 A;  3MN8 A;  2QVP A;  2VRI A;  3KL9 A;  2DEA A;  2PIZ A;  3EKE A;  4P4B A;  3VH9 A;  2Q43 A;  1Y0Y A;  3RZA A;  4IHM A;  3NFZ A;  5D8N A;  1Z2L A;  1R3N A;  4O23 A;  2RB7 A;  3T8W A;  2AFZ A;  3VAT A;  5D29 A;  5CB3 A;  1NSA A;  4UEE A;  2V8D A;  2QJ8 A;  4PPZ A;  4NGQ A;  3EW5 A;  3WT4 A;  4PXD A;  2C6P A;  1BAV A;  2FXK A;  3GLJ A;  2VL1 A;  4OME A;  2ZOG A;  2CTC A;  2XEJ A;  1ZLI A;  1PYT B;  3EWO A;  2POK A;  4OC5 A;  1ELM P;  4ABL A;  3S9N A;  2Q4Z A;  4P4F A;  4A38 A;  5LRK A;  2HB6 A;  1HDQ A;  3NH4 A;  2GLF A;  1RTQ A;  2AFU A;  2CF4 A;  4TNU A;  3Q71 A;  2BCO A;  2XD7 A;  2EK8 A;  2PE3 A;  4J5S A;  3I1U A;  4RUH A;  2ANP A;  4DJL A;  3BI0 A;  3GQE A;  1CX8 A;  3DLJ A;  4NGN A;  3PB9 X;  2PJC A;  4Q7A A;  1ZR5 A;  4ABK A;  2I3C A;  4ZY1 A;  3ISX A;  4UEZ A;  4PQA A;  3K2K A;  5LRJ A;  5K8O A;  5JM6 A;  1SPV A;  2CTB A;  5JGF A;  4CPA A;  4IAV A;  5I4M A;  3S9L A;  3JZT A;  2JBK A;  4UIB A;  1YD9 A;  3IFE A;  4X3R A;  2PJ9 A;  4DUK A;  1M4L A;  5FSX A;  3PB7 X;  1TXR A;  2ZEP A;  1CPX A;  2EEE A;  4MCR A;  2FAV A;  2F8H A;  4DYO A;  4OC3 A;  1TXZ A;  3SII A;  4UIA A;  1FNO A;  3D66 A;  1VHE A;  1XRY A;  2O53 A;  4PXB A;  3KGQ A;  1TF9 A;  3GPQ A;  3V2B A;  1YLO A;  3Q6Z A;  4F9U A;  4NFR A;  3VAR A;  4FAI A;  1LOK A;  4P10 A;  2XEI A;  3FH4 A;  2PJA A;  4ONW A;  3KQZ A;  1LFW A;  2ZEN A;  4Z65 A;  4J5R A;  3FF3 A;  4P4I A;  2AFW A;  1AMP A;  5IB9 A;  3D4U A;  4OKO A;  4MCP A;  3SI0 A;  2ZEG A;  4P44 A;  3KI9 A;  2PJ6 A;  3NA6 A;  4YU9 A;  3SJE A;  3B3T A;  3FVL A;  3SIH A;  2G9D A;  4D86 A;  4G1P A;  5JH9 A;  1XJO A;  3B3V A;  4TWE A;  2RFH A;  3ISZ A;  4WJB A;  2IMO A;  4NGT A;  4WWV A;  4ZX9 A;  3BXM A;  3CPA A;  3B3S A;  5FSZ A;  3FEE A;  1TKF A;  1Z5R A;  2PJ7 A;  5ELY A;  3MRU A;  5CBM A;  3K9T A;  3D67 A;  4BD9 A;  3KR5 A;  1NJR A;  1ZG8 A;  4MXU A;  1LCP A;  4NGS A;  5HVH A;  5AIL A;  5LYF A;  1HJZ A;  4NJQ A;  1ARL A;  2CIJ A;  4FUU A;  1Y0R A;  2F7V A;  4P6Y A;  1TF8 A;  2ZEO A;  1CBX A;  3SJF A;  1TY8 A;  4NGM A;  5LYL A;  4GVW A;  3EWP A;  2L8R A;  2JEW A;  4K0C A;  1GYT A;  2PJ0 A;  3D7D A;  3KHX A;  3IID A;  2PJB A;  5HVG A;  2XEG A;  4JGK A;  3PFE A;  1TKH A;  3B3W A;  2GU2 A;  3D7F A;  4ZY2 A;  2O4H A;  1YME A;  5LYD A;  5HVF A;  4PXC A;  1ARM A;  1YW4 A;  4JVV A;  2PJ2 A;  4A37 A;  2ACF A;  1QQ9 A;  3CPX A;  2X47 A;  1AYE A;  2FG1 A;  4OC0 A;  4OC2 A;  4KYB A;  3EJG A;  3QNV A;  4ETK A;  5DS0 A;  1HDU A;  3KHZ A;  5LRG A;  3KR4 A;  5HOL A;  3PEI A;  2C6G A;  4JYW A;  4P45 A;  1TKJ A;  1YSJ A;  4EFD A;  5FSU A;  1IY7 A;  2ZED A;  3D7G A;  4R8F A;  4NJR A;  4J4Z A;  3H8E A;  3PB4 X;  2IJZ A;  3GPO A;  2NSM A;  3EWR A;  4UML A;  4ETJ A;  2C6C A;  5E3B A;  1F2O A;  4P4J A;  4JZ0 A;  4MHP A;  1BPN A;  3SIG A;  4NGR A;  3V38 A;  8CPA A;  2BO9 A;  2NYQ A;  1ELL P;  4FWU A;  1VHO A;  3KQX A;  4MCS A;  4UF4 A;  2AFX A;  1CPS A;  2ZEM A;  1QMU A;  4K3N A;  1H8L A;  3IIB A;  4R7M A;  2ZOF A;  3L2N A;  2PVW A;  2PJ1 A;  2GRE A;  3B2Y A;  3PB6 X;  4MCQ A;  3GUX A;  3EWQ A;  2PJ8 A;  1LAN A;  2BOA A;  7CPA A;  3IJ3 A;  5CMS A;  3NH5 A;  2Q51 A;  3PFO A;  4P4E A;  1PCA A;  1YW6 A;  3KZW A;  3TC8 A;  4AXV A;  3EJF A;  3GPG A;  2V8V A;  2GLJ A;  4J5Q A;  4NGP A;  5HXD A;  5J1Q A;  4JCA A;  4FBE A;  3BI1 A;  4F8Z A;  1R43 A;  1UWY A;  1LAM A;  4IK2 A;  2AFO A;  4MMO A;  2PVV A;  3LWU A;  2EK9 A;  2ZEE A;  2LGR A;  4KSI A;  2WYR A;  3FMC A;  3V45 A;  2JBJ A;  3SIJ A;  2PIY A;  3VFQ A;  2V77 A;  4OC4 A;  2BFR A;  4LQG A;  5K8N A;  2AFC A;  4ZYQ A;  1CP6 A;  2ZEF A;  4P4D A;  4A39 A;  3SI2 A;  4A94 A;  1ZG7 A;  3IWW A;  3CT9 A;  3WC7 A;  4YWY A;  2OOT A;  1IGB A;  1F2P A;  1ZLH A;  1Z8L A;  4ZX8 A;  2PCU A;  1DTD A;  3H8F A;  4X8I A;  1VGY A;  1XBU A;  5DUS A;  1VHU A;  4ZI6 A;  2AFM A;  4MRI A;  5CPA A;  1ZR3 A;  2PJ3 A;  3KAS A;  2HC9 A;  4MHN A;  2PRQ A;  2ABZ A;  4OIW A;  5THW A;  3HUV A;  3D7H A;  4EWT A;  4ESS A;  3H8G A;  3SJX A;  3TX8 A;  4OC1 A;  4GM5 A;  3WC5 A;  4UEF A;  2FVG A;  2WZN A;  2OR4 A;  2BFQ A;  1CP7 A;  5FSV A;  3GB0 A;  1XMB A;  4X2T A;  3NH8 A;  3GQO A;  2ZEH A;  1DE4 C;  3FJU A;  1BLL E;  2QYV A;  1HEE A;  2J9A A;  4PXE A;  1VIX A;  1Q7L A;  4MHY A;  4R76 A;  3B7I A;  2V8G A;  1F57 A;  3LMS A;  6CPA A;  4EME A;  5FSY A;  3PB8 X;  3PBB A;  3FEC A;  3B3C A;  3B35 A;  3IIF A;  4R6T A;  3WAB A;  3WC6 A;  2V8H A;  3RBU A;  4OP4 A;  2ZEL A;  4B6Z A;  4F9V A;  2C1C A;  3SI1 A;  4OID A;  3S9M A;  3PBE A;  3FED A;  4H2K A;  2DX6 A;  3FX6 A;  3CDX A;  1LAP A;  3V7Z A;  3DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...