3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
2EK9A 4TU0A 1NSAA 2ZEOA 3VARA 3L2NA 3KHXA 1VHUA 3KASA 3IFEA 4JCAA 4MCSA 4NGNA 4GVVA 1SPVA 3IEHA 3QNVA 3D67A 4X3RA 1TKJA 5JGFA 4GVWA 4P4FA 3RBUA 4Z65A 1ELLP 3PFEA 3SJXA 2ZOGA 5FSYA 4KYBA 2V8DA 4MHNA 3SI0A 4ZY1A 1DE4C 3GB0A 1F2PA 2PJ2A 4OMEA 2PJ9A 5HVHA 1OBRA 1VGYA 4GUAA 1CP6A 3D4UA 4PXBA 5LYLA 2Q43A 5FSVA 2AFUA 4ZI6A 1LAMA 5CMSA 2AFWA 2C6GA 4UIAA 4J5SA 3EWOA 3EKEA 1ZLHA 3D7DA 4OC4A 2PIYA 4UIBA 1QMUA 2PJ5A 2OOTA 3FECA 2V8HA 3D68A 2GLJA 1Q7LA 3PBBA 1LOKA 4EFDA 3V38A 3KZWA 2ZELA 3SIJA 2ZEDA 2AFZA 2FXKA 4PQAA 1LCPA 1XMBA 3EWPA 2AFOA 2AFMA 5LYDA 2XEJA 2POKA 4ZY2A 2RFHA 5D8NA 2PRQA 1KWMA 3K2KA 2ACFA 4NGQA 3LMSA 2O53A 2JEWA 3SI1A 3WT4A 2J9AA 3B3VA 2XEIA 2V8VA 3PB9X 4NGPA 1ZG8A 4B6ZA 3FMCA 3B7IA 4OP4A 4OC0A 2FVGA 2DX6A 1Y0RA 3NFZA 3VH9A 3PB7X 2EEEA 4FUUA 3TC8A 1BPMA 1ZLIA 2DEAA 3FH4A 1YW6A 3KQZA 1TF8A 2ZEMA 4MHPA 3NH8A 2ZEPA 4PPZA 4K0CA 3GQOA 4OC3A 3PBEA 3EJFA 3PB8X 3RZAA 2C6PA 4OC2A 3D66A 1ZG9A 8CPAA 3VFQA 5ELYA 2ANPA 2PJ1A 4P4DA 4YU9A 5FSUA 4ETKA 4UEFA 1Z8LA 4DYOA 2FAVA 4W9YA 4ZY0A 4MHYA 5K8MA 4GM5A 3IO1A 1QQ9A 1PCAA 3S9LA 5FSZA 1BLLE 1HJZA 4P6YA 1XRYA 3PB4X 4JLLA 5HVFA 3IC1A 3GPQA 4A38A 5CPAA 4R7MA 5LRGA 3CPXA 5LRKA 1AMPA 2O4HA 2AFXA 4MCRA 2PE3A 5LRJA 3EWQA 4KSIA 2CF4A 4ABKA 1H8LA 1CPXA 4R6TA 4P44A 2QJ8A 1ARLA 5K8PA 2V8GA 1TF9A 1Y0YA 3SJFA 4P4JA 3CPAA 2F7VA 2PVWA 4MCQA 4CPAA 1CX8A 5E3BA 1F2OA 2IMOA 4OC5A 2BFQA 4JGKA 4ONWA 4P10A 5FSXA 3FF3A 3N5FA 5HXDA 4H2KA 1YW4A 2C1CA 3Q6ZA 3DLJA 4JVVA 3D7HA 1XJOA 2ZEGA 3SJGA 4FAIA 5HVGA 3D7FA 4NGSA 3I1UA 1TXZA 4ZX9A 3WABA 3KI9A 1CG2A 3ISZA 4WWVA 3KR4A 4MMOA 1FNOA 1LAPA 4ZX8A 4P4EA 4IHMA 5LYIA 4F9UA 4IQYA 3K9TA 3KR5A 4K3NA 2PJ6A 1AYEA 3S9MA 3Q71A 1ZR5A 4FBEA 4TNUA 2F8HA 1NJRA 2QYVA 2PJ7A 2ZEHA 3SJEA 5AILA 3SIGA 1R3NA 4R76A 4OIDA 1IGBA 1ZG7A 3GLJA 2JBJA 2WZNA 3BI0A 5DUSA 1HDQA 3FX6A 4A39A 2PJCA 2ABZA 3CT9A 5D29A 4UF4A 3H8EA 3SI2A 2FG1A 4EWTA 2GREA 4NGTA 5J1QA 2ZEEA 2I3CA 1IY7A 2QVPA 4IAVA 3V2BA 4DUKA 4ABLA 2L8RA 1YMEA 3PEIA 3EJGA 3B3WA 2PCUA 3FEEA 2LGRA 3PRTA 1BAVA 2JBKA 2VRIA 4MHZA 3H8GA 2CIJA 3BI1A 2EWBA 3IIDA 4RUHA 2C6CA 3GUXA 5CB5A 1FT7A 5IB9A 3GQEA 1F57A 1LFWA 1TKHA 3B35A 4JYWA 2BOAA 4BD9A 2BFRA 1GYTA 4NFRA 3LWUA 2PJBA 5HIHA 5THWA 3KGQA 3TX8A 3IWWA 1CBXA 5LYFA 2VL1A 3IJ3A 3PFOA 2BCOA 1VHEA 2NSMA 4G1PA 2PJ0A 1HEEA 4J5QA 3GPOA 1ELMP 2PJAA 1LANA 3VATA 3NH5A 4JZ0A 2AFCA 2ZOFA 3B3SA 3KL9A 3B3TA 3GPGA 2ZEFA 2IJZA 1BPNA 3EWRA 3WC7A 4EMEA 4UMLA 4D86A 1XFOA 3V45A 1VIXA 4WJBA 2PVVA 3NA6A 2PJ3A 4MCPA 4DJLA 4PXEA 4PXDA 2AFSA 3BHXA 6CPAA 1ZR3A 3MN8A 1YLOA 2HC9A 4AXVA 2ZENA 3RAMA 4FWUA 3BXMA 3DGVA 3MRUA 4NJRA 3ISXA 5K8OA 2RB7A 4NJQA 3NH4A 4UEZA 4ESSA 2GLFA 3HUVA 4OKOA 3WC5A 5I4MA 4PXCA 2G9DA 4MXUA 5DS0A 1TY8A 1EE3P 3V7ZA 4IK2A 3KQXA 4UEEA 4TWEA 3SIHA 4MRIA 2BO9A 4X8IA 1CP7A 2NYQA 3JRUA 1YSJA 3FEDA 4F8ZA 3WC6A 1ARMA 4NGRA 4A37A 3EW5A 2CTBA 5CBMA 2PIZA 4OIWA 3B2YA 3D7GA 3IIFA 1XBUA 4J5RA 5F09A 1M4LA 5HOLA 4F9VA 1TXRA 2Q51A 4OC1A 1JQGA 4ZYQA 4Q7AA 3SIIA 2PJ8A 1R43A 4LQGA 1YD9A 2XEFA 2XD7A 3JZTA 1HDUA 3IIBA 2IQ6A 1UWYA 2PJ4A 4YWYA 2OR4A 3B3CA 4NGMA 3HLPA 2WYRA 4ETJA 4A94A 3ETIA 5K8NA 3KHZA 2X47A 1RTQA 1Y7EA 1Z2LA 4J4ZA 7CPAA 3FJUA 3T8WA 1PYTB 1Z5RA 2CTCA 4R8FA 1DTDA 3S9NA 4P45A 2Q4ZA 2XEGA 4P4IA 3FVLA 4X2TA 3PB6X 1CPSA 5CB3A 1VHOA 1TKFA 2GU2A 2V77A 4O23A 4P4BA 5JM6A 2EK8A 2HB6A 5JH9A 3CDXA 3H8FA
chains in the Genus database with same CATH superfamily
4MFQA 4CRYB 2EK9A 2G3TA 4CYOA 4TU0A 1NSAA 1UFHA 2ZEOA 4KSAA 4A33A 4A95A 1Z8TA 3VARA 3L2NA 5C82A 3D3SA 1LRZA 3KHXA 1VHUA 3S6KA 4HNYB 3KASA 3IFEA 4JCAA 4C7IA 1MJAA 1FY7A 3I9SA 4MCSA 4NGNA 2PR8A 1IU8A 1VKCA 1XF8A 4GVVA 1YLEA 4B12A 1SPVA 3CXPA 3N7ZA 3RO0A 3IEHA 4R57A 3QNVA 3D67A 4KS9A 4H6ZA 4XNHB 1TKJA 4X3RA 3S6HA 5KTDA 5JGFA 4GVWA 2R8VA 1Z8WA 4J3GA 4P4FA 4XNHC 4IUSA 4B14A 3RBUA 1NSLA 3TT2A 4Z65A 3P2HA 1ELLP 2P6EA 3PFEA 3SJXA 2ZOGA 5FSYA 4KYBA 2V8DA 4MHNA 3SI0A 3G3SA 5ISVA 4ZY1A 1DE4C 2FSRA 1F2PA 2PJ2A 2VI7A 3GB0A 4EVYA 4AVBA 4OMEA 1YVOA 2PJ9A 3T90A 1IB1E 5HVHA 1OBRA 1VGYA 4GUAA 1CP6A 3D4UA 4PXBA 4DNCA 5I0CA 5LYLA 1P4NA 4M6HA 2Q43A 2Q04A 5FSVA 2K5TA 2ZW4A 2AFUA 4ZI6A 1KUYA 2FE7A 5J8CA 1LAMA 5CMSA 4CS0B 2AFWA 1MJBA 2C6GA 3VWDA 1Y9WA 1XMTA 4KORA 4UIAA 3TCVA 4J5SA 3EWOA 3EKEA 2G3AA 1ZLHA 2WPWA 4R87A 4YGOA 3D7DA 3SXNA 1SQHA 4OC4A 2PIYA 2PR1A 4UIBA 1QMUA 2PJ5A 2QIRA 3FECA 1YGHA 2OOTA 4AB7A 2V8HA 3D68A 1RXTA 4Y49B 1M4GA 2GLJA 3FRMA 1Q7LA 1XEBA 2R1IA 3F5BA 2BL1A 3PBBA 1LOKA 2IL4A 4EFDA 4Y49C 2Q4YA 3V38A 3KZWA 2ZELA 3SIJA 2ZEDA 2AFZA 5EMIA 2FXKA 4UWJA 1M4IA 2D4OA 1LCPA 1XMBA 4PQAA 3SHPA 3EWPA 3F8KA 2AFOA 2AFMA 2VEZA 5LYDA 2Z10A 4ONUA 1I12A 4KLWA 2WPXA 4B13A 2FIAA 2XEJA 2POKA 4ZY2A 2RFHA 4CAVA 5D8NA 2PRQA 3KKWA 4RN7A 1WK4A 1KWMA 3C26A 3K2KA 4RS2A 4HKFA 3R95A 1Z8XA 3VWEA 4QBJA 2ACFA 4NGQA 3LMSA 2B3UA 2JEWA 2O53A 2REEA 3P2FA 4M6IA 2J9AA 3B3VA 4PK2A 3SI1A 5GCNA 3WT4A 2XEIA 5F46A 2V8VA 4CGPA 2OH1A 2REFA 1ZG8A 3BLNA 3EO4A 3PB9X 3FMCA 4NGPA 3B7IA 4OP4A 4OC0A 4B6ZA 5F47A 2FVGA 2DX6A 1Q2CA 3TFYA 5AG7A 1ON0A 1Y0RA 3LD2A 4C2ZA 3NFZA 3VH9A 5EBVA 3PB7X 2P0WA 2EEEA 4FUUA 3TC8A 1BPMA 1V0CA 3W6SA 2D4PA 4KOUA 1ZLIA 4UFWA 2DEAA 3FH4A 1YW6A 4UFXA 3KQZA 1TF8A 2ZEMA 4B5PA 4MHPA 3NH8A 2ZEPA 2JZFA 4PPZA 4MFLA 4K0CA 5CNPA 3T9YA 3GQOA 1JWQA 4QC6A 4OC3A 1YQEA 4CAWA 3PBEA 3R1KA 3EJFA 1IOIA 3PB8X 3RZAA 3ZZIA 4F0YA 2C6PA 4OC2A 3D66A 1OZPA 2WCTA 1ZG9A 4L8AA 8CPAA 3VFQA 5ELYA 2ANPA 2ARHA 3K9UA 2FL4A 2J8MA 2PJ1A 4P4DA 4YU9A 2ODFA 5FSUA 1BOBA 2PC1A 4ETKA 3CXQA 4KOXA 2RC4A 4UEFA 2C27A 4C7HA 4MY3A 1Z8LA 4MHDA 4AG7A 2FAVA 4DYOA 1S60A 4R3KA 4II9A 4W9YA 2OZHA 4BINA 2JZDA 4ZY0A 3QAYA 4MHYA 5K8MA 4GM5A 1YREA 1YVKA 3IO1A 4C68A 1QQ9A 1PCAA 3S9LA 5FSZA 2QECA 1BLLE 1HJZA 4P6YA 1XRYA 5AG5A 4R9MA 3PB4X 4JLLA 5HVFA 3IC1A 3V8IA 3GPQA 3TOAA 4A38A 2JDDA 4Q38A 5CPAA 4R7MA 4AVCA 3PGPA 1L0CA 3MGDA 2Z3PA 4M85A 5LRGA 5G1ZA 3CPXA 1YX0A 5LRKA 1AMPA 1NMTA 2O4HA 4JXQA 3DNSA 4BMHA 2AFXA 3IU1A 2RNKA 2YNCC 4MCRA 2YNDA 2CXAA 1QSOA 2PE3A 5LRJA 3EWQA 4KSIA 2CF4A 4JXRA 2KCWA 2PRBA 3F0AA 4ABKA 2OB0A 2AE6A 2HV2A 1H8LA 1CPXA 4R6TA 4P44A 2QJ8A 1ARLA 4XPKA 5K8PA 2V8GA 1TF9A 1Y0YA 1Y7RA 4LUAA 4U9ZA 3NE8A 3SJFA 4A30A 4P4JA 3CPAA 2F7VA 5F48A 1Z4RA 2PVWA 4MCQA 2DF5A 2P6FA 1PUAA 2A4NA 2BSWA 4CPAA 5A28A 3FIXA 1CX8A 5E3BA 2JDCA 2EO8A 1M1DA 1KUXA 2H5MA 4L89A 2ZW5A 1F2OA 3TE4A 2IMOA 4MFZA 4IF5A 4OC5A 2BFQA 1M44A 4FD6A 5G22A 3QAHA 4FD4A 4KOTA 2PQ8A 4JGKA 4ONWA 4P10A 5FSXA 3FF3A 3N5FA 4RI1A 4H2KA 5HXDA 4MBUA 5IX3A 2AJ6A 4LX9A 4FD7A 1YW4A 1K4JA 2Z3KA 1IYLA 3Q6ZA 2C1CA 3DLJA 3FNCA 4JVVA 3D7HA 4CYNA 1XJOA 3IWEA 4UBRA 2ZEGA 3W6XA 4F0XA 3S6FA 3D2PA 3BJ8A 5HH1A 1IYKA 3SJGA 4FAIA 1B87A 4CYPA 1CM0A 5IB0A 5HVGA 3D7FA 1X10A 3FBUA 3H5ZA 3I1UA 1TXZA 4NGSA 4UCMA 3JUWA 4ZX9A 2BUEA 3WABA 1A2ZA 2QMLA 4BBHA 3KI9A 1ZO0A 2PDOA 1CG2A 1CJWA 3IU2A 2YNEA 3ISZA 4WWVA 4B10A 4X5KA 3KR4A 4MMOA 4NXYA 5G21A 1FNOA 1LAPA 4ZX8A 4P4EA 4IHMA 1N71A 5LYIA 4C2XA 4F9UA 4IQYA 3K9TA 3KR5A 4K3NA 2PJ6A 1AYEA 2ZW6A 3G8WA 3OWCA 3S9MA 3Q71A 1ZR5A 4FBEA 4TNUA 4MFJA 4PK3A 1TIQA 2J8NA 2OU2A 2F8HA 1NJRA 2JEVA 2PJ7A 2QYVA 2ZEHA 3SJEA 5AILA 3SIGA 3R9FA 1R3NA 1R57A 3PP9A 4ZBGA 4CYQA 4R76A 3CZXA 4OIDA 4YRHA 1IGBA 3DR8A 4GXHA 4M6GA 1ZG7A 3GLJA 3PZJA 4U5YA 2JBJA 2WZNA 3BI0A 3FB3A 5HMNA 2HQYA 5DUSA 1HDQA 5AG4A 3FX6A 4A39A 2PJCA 2ABZA 4FD5A 4CGLA 3CT9A 2F5IA 5IV0A 5H84A 5D29A 4UF4A 2W2GA 3H8EA 4XPLA 3SI2A 2GFQA 2FG1A 4EWTA 2GREA 4CGOA 3GYAA 1KZFA 4KLVA 2DPSA 4NGTA 4Q36A 5J1QA 2ZEEA 3EC4A 5H86A 2B58A 1QSNA 4CAFA 4CAXA 2PSWA 2I3CA 3TO6A 4GS4A 1IY7A 1S7LA 2QVPA 3V2BA 4IAVA 5FVJA 1AUGA 1Z4EA 4DUKA 4F6AA 4ABLA 2L8RA 1YMEA 3PEIA 4UFVA 3EJGA 4OLLA 4NSQA 3GIUA 3B3WA 1MJ9A 5EC4A 3D2MA 2PCUA 3FEEA 5AG6A 3FXTA 4HNXB 2LGRA 4UA3A 3R9GA 3PRTA 3DDDA 4OADA 4KUAA 2Z0ZA 1Z9UA 1BAVA 1WWZA 5KTCA 4PSWA 2GANA 2HUZA 2JBKA 2VRIA 2B5GA 3H8GA 4M3SA 2CIJA 4MHZA 3BI1A 4UCPA 4CGMA 2B5GB 2Z3LA 2EWBA 3IIDA 4A32A 4NF1A 4RUHA 2EVNA 2CNTA 3R96A 2C6CA 3GUXA 5CB5A 1FT7A 3WR7A 2EUIA 2CNMA 5JPHA 5IB9A 3GQEA 1F57A 2NMTA 1LFWA 2FIWA 2YNCA 2VXKA 4JJXA 2Q44A 1TKHA 3B35A 3TO9A 2Q0YA 4JYWA 4UWIA 2BOAA 1X12A 2BFRA 2ZXVA 3I3GA 4BD9A 1GYTA 4NFRA 2CY2A 4MFPA 3LWUA 2PJBA 5HIHA 5THWA 4MJ8A 3KGQA 3TX8A 2Q7BA 3IWWA 2Q4VA 3D8PA 1CBXA 5LYFA 2VL1A 3DSBA 3IJ3A 3CXSA 3PFOA 2BCOA 1Q2YA 1VHEA 2NSMA 4G1PA 2I00A 2YGWA 2PJ0A 3DR6A 1HEEA 4J5QA 3GPOA 4YFJA 5KTAA 1ELMP 2PJAA 1LANA 1S7NA 1I21A 2B3VA 3EFAA 4PV6A 3VATA 3NH5A 4JZ0A 2AFCA 2R98A 2ZOFA 3B3SA 2ZPAA 4A2ZA 3TTHA 3KL9A 3GPGA 2ZEFA 3B3TA 2IJZA 1BPNA 4H89A 3EWRA 4MFKA 4E8OA 2O28A 3WC7A 4EMEA 3H4QA 2Q7SA 4UMLA 3A9LA 3E0KA 2GIVA 4D86A 1XFOA 3V45A 1VIXA 4WJBA 2GE3A 2PVVA 3S6GA 3NA6A 2G0BA 4A31A 1IIDA 2PJ3A 4MCPA 4DJLA 3GY9A 4PXEA 4PXDA 2AFSA 5E96A 1IICA 2Z3OA 4CAEA 3GKRA 5A27A 3BHXA 6CPAA 1ZR3A 4E2AA 4E0AA 3MN8A 1YLOA 2HC9A 4AXVA 2ZENA 3RAMA 4FWUA 1Q2DA 4UCNA 3BXMA 3IGRA 1I1DA 3DGVA 3B8GA 3MRUA 2VBQA 3ISXA 4NJRA 5J8FA 2RB7A 5G20A 5K8OA 4NJQA 3NH4A 1VHSA 4UEZA 4KVOE 2FCKA 1PU9A 2DXQA 3NE7A 4ESSA 4JD6A 4KVXA 2FS5A 4U9YA 2GLFA 3HUVA 1GHEA 4I49A 4KVME 4OKOA 2WUUA 3WC5A 5I4MA 4PXCA 2G9DA 4MXUA 3R9EA 5DS0A 2Z3NA 1YK3A 1QSTA 3JVNA 1TY8A 1J4JA 1EE3P 1NE9A 1QSMA 2X7BA 3V7ZA 2FT0A 4IK2A 3KQXA 4HPSA 2R7HA 4UEEA 2P6GA 2B4BA 3SIHA 2ZW7A 4TWEA 4MRIA 2BO9A 4R3LA 4ORFA 4LQ6A 1QSRA 4X8IA 1CP7A 2ATRA 2NYQA 1S7FA 4OAEA 3JRUA 4CGNA 5JQ4A 3TOBA 1RO5A 2DPTA 2VQYA 4QUSA 1YSJA 3FEDA 3LACA 5F49A 3WC6A 4AVAA 1ARMA 4F8ZA 4NGRA 2J8RA 3EW5A 4A37A 4NCZA 1KUVA 1IOFA 2CTBA 5CBMA 2PIZA 4K30A 1S3ZA 3TO7A 5DWNA 2FXFA 4OIWA 4NEXA 3EXNA 1S5KA 2Z3MA 2Y0MA 3B2YA 3D7GA 3JTKA 3IIFA 1XBUA 4J5RA 5F09A 1M4LA 4KOSA 5HOLA 2B4DA 3ZJ0A 4F9VA 1BO4A 1TXRA 2B4DB 2Q51A 2WSAA 4MI4A 4OC1A 1JQGA 2I79A 4HNWB 4ZYQA 4Q7AA 4XPDB 3RNZA 3RYOA 3SIIA 4JWPA 1XIXA 3SXOA 3FYNA 2PJ8A 1R43A 2VZYA 4KSFA 4LQGA 1YD9A 2JLMA 2XEFA 3IWGA 4XPDC 3QB8A 2XD7A 4H6UA 4QB9A 3JZTA 1HDUA 3IIBA 4B5PB 2IQ6A 1B6BA 4AG9A 1MK4A 1UWYA 2PJ4A 3EY5A 2OR4A 4YWYA 4B11A 3B3CA 3LODA 3W91A 1S7KA 1YR0A 4KOWA 4NGMA 4KOVA 5DWMA 4KOYA 3UY5A 3HLPA 5AGEA 4ETJA 2WYRA 4A94A 3ETIA 4ZGYB 5K8NA 3KHZA 2X47A 2KQVA 1RTQA 1XE4A 1Y7EA 2CNSA 4CRZB 1Z2LA 4J4ZA 1M4DA 3BJ7A 7CPAA 4KZTA 3FJUA 3T8WA 1PYTB 1Z5RA 2VZZA 4PSXA 2CTCA 4R8FA 5BWAB 1DTDA 3S9NA 1P0HA 2Q4ZA 4P45A 2BEIA 2XEGA 3FVLA 4P4IA 4JLYA 1XOVA 4X2TA 3PB6X 5C88A 2EBJA 1CPSA 2JZEA 1Y9KA 5CB3A 4C2YA 1VHOA 4QVTA 1TKFA 2GU2A 2Z11A 2V77A 4O23A 4P4BA 2OZGA 5JM6A 4B5OA 2EK8A 2OZUA 2HB6A 4KUBA 4MY0A 1U6MA 5JH9A 3CDXA 3H8FA
chains in the Genus database with same CATH topology
2EK9A 4TU0A 1NSAA 2ZEOA 3VARA 3L2NA 3KHXA 1VHUA 3KASA 3IFEA 4JCAA 4MCSA 4NGNA 4GVVA 1SPVA 3IEHA 3QNVA 3D67A 4X3RA 1TKJA 5JGFA 4GVWA 4P4FA 3RBUA 4Z65A 1ELLP 3PFEA 3SJXA 2ZOGA 5FSYA 4KYBA 2V8DA 4MHNA 3SI0A 4ZY1A 1DE4C 3GB0A 1F2PA 2PJ2A 4OMEA 2PJ9A 5HVHA 1OBRA 1VGYA 4GUAA 1CP6A 3D4UA 4PXBA 5LYLA 2Q43A 5FSVA 2AFUA 4ZI6A 1LAMA 5CMSA 2AFWA 2C6GA 4UIAA 4J5SA 3EWOA 3EKEA 1ZLHA 3D7DA 4OC4A 2PIYA 4UIBA 1QMUA 2PJ5A 2OOTA 3FECA 2V8HA 3D68A 2GLJA 1Q7LA 3PBBA 1LOKA 4EFDA 3V38A 3KZWA 2ZELA 3SIJA 2ZEDA 2AFZA 2FXKA 4PQAA 1LCPA 1XMBA 3EWPA 2AFOA 2AFMA 5LYDA 2XEJA 2POKA 4ZY2A 2RFHA 5D8NA 2PRQA 1KWMA 3K2KA 2ACFA 4NGQA 3LMSA 2O53A 2JEWA 3SI1A 3WT4A 2J9AA 3B3VA 2XEIA 2V8VA 3PB9X 4NGPA 1ZG8A 4B6ZA 3FMCA 3B7IA 4OP4A 4OC0A 2FVGA 2DX6A 1Y0RA 3NFZA 3VH9A 3PB7X 2EEEA 4FUUA 3TC8A 1BPMA 1ZLIA 2DEAA 3FH4A 1YW6A 3KQZA 1TF8A 2ZEMA 4MHPA 3NH8A 2ZEPA 4PPZA 4K0CA 3GQOA 4OC3A 3PBEA 3EJFA 3PB8X 3RZAA 2C6PA 4OC2A 3D66A 1ZG9A 8CPAA 3VFQA 5ELYA 2ANPA 2PJ1A 4P4DA 4YU9A 5FSUA 4ETKA 4UEFA 1Z8LA 4DYOA 2FAVA 4W9YA 4ZY0A 4MHYA 5K8MA 4GM5A 3IO1A 1QQ9A 1PCAA 3S9LA 5FSZA 1BLLE 1HJZA 4P6YA 1XRYA 3PB4X 4JLLA 5HVFA 3IC1A 3GPQA 4A38A 5CPAA 4R7MA 5LRGA 3CPXA 5LRKA 1AMPA 2O4HA 2AFXA 4MCRA 2PE3A 5LRJA 3EWQA 4KSIA 2CF4A 4ABKA 1H8LA 1CPXA 4R6TA 4P44A 2QJ8A 1ARLA 5K8PA 2V8GA 1TF9A 1Y0YA 3SJFA 4P4JA 3CPAA 2F7VA 2PVWA 4MCQA 4CPAA 1CX8A 5E3BA 1F2OA 2IMOA 4OC5A 2BFQA 4JGKA 4ONWA 4P10A 5FSXA 3FF3A 3N5FA 5HXDA 4H2KA 1YW4A 2C1CA 3Q6ZA 3DLJA 4JVVA 3D7HA 1XJOA 2ZEGA 3SJGA 4FAIA 5HVGA 3D7FA 4NGSA 3I1UA 1TXZA 4ZX9A 3WABA 3KI9A 1CG2A 3ISZA 4WWVA 3KR4A 4MMOA 1FNOA 1LAPA 4ZX8A 4P4EA 4IHMA 5LYIA 4F9UA 4IQYA 3K9TA 3KR5A 4K3NA 2PJ6A 1AYEA 3S9MA 3Q71A 1ZR5A 4FBEA 4TNUA 2F8HA 1NJRA 2QYVA 2PJ7A 2ZEHA 3SJEA 5AILA 3SIGA 1R3NA 4R76A 4OIDA 1IGBA 1ZG7A 3GLJA 2JBJA 2WZNA 3BI0A 5DUSA 1HDQA 3FX6A 4A39A 2PJCA 2ABZA 3CT9A 5D29A 4UF4A 3H8EA 3SI2A 2FG1A 4EWTA 2GREA 4NGTA 5J1QA 2ZEEA 2I3CA 1IY7A 2QVPA 4IAVA 3V2BA 4DUKA 4ABLA 2L8RA 1YMEA 3PEIA 3EJGA 3B3WA 2PCUA 3FEEA 2LGRA 3PRTA 1BAVA 2JBKA 2VRIA 4MHZA 3H8GA 2CIJA 3BI1A 2EWBA 3IIDA 4RUHA 2C6CA 3GUXA 5CB5A 1FT7A 5IB9A 3GQEA 1F57A 1LFWA 1TKHA 3B35A 4JYWA 2BOAA 4BD9A 2BFRA 1GYTA 4NFRA 3LWUA 2PJBA 5HIHA 5THWA 3KGQA 3TX8A 3IWWA 1CBXA 5LYFA 2VL1A 3IJ3A 3PFOA 2BCOA 1VHEA 2NSMA 4G1PA 2PJ0A 1HEEA 4J5QA 3GPOA 1ELMP 2PJAA 1LANA 3VATA 3NH5A 4JZ0A 2AFCA 2ZOFA 3B3SA 3KL9A 3B3TA 3GPGA 2ZEFA 2IJZA 1BPNA 3EWRA 3WC7A 4EMEA 4UMLA 4D86A 1XFOA 3V45A 1VIXA 4WJBA 2PVVA 3NA6A 2PJ3A 4MCPA 4DJLA 4PXEA 4PXDA 2AFSA 3BHXA 6CPAA 1ZR3A 3MN8A 1YLOA 2HC9A 4AXVA 2ZENA 3RAMA 4FWUA 3BXMA 3DGVA 3MRUA 4NJRA 3ISXA 5K8OA 2RB7A 4NJQA 3NH4A 4UEZA 4ESSA 2GLFA 3HUVA 4OKOA 3WC5A 5I4MA 4PXCA 2G9DA 4MXUA 5DS0A 1TY8A 1EE3P 3V7ZA 4IK2A 3KQXA 4UEEA 4TWEA 3SIHA 4MRIA 2BO9A 4X8IA 1CP7A 2NYQA 3JRUA 1YSJA 3FEDA 4F8ZA 3WC6A 1ARMA 4NGRA 4A37A 3EW5A 2CTBA 5CBMA 2PIZA 4OIWA 3B2YA 3D7GA 3IIFA 1XBUA 4J5RA 5F09A 1M4LA 5HOLA 4F9VA 1TXRA 2Q51A 4OC1A 1JQGA 4ZYQA 4Q7AA 3SIIA 2PJ8A 1R43A 4LQGA 1YD9A 2XEFA 2XD7A 3JZTA 1HDUA 3IIBA 2IQ6A 1UWYA 2PJ4A 4YWYA 2OR4A 3B3CA 4NGMA 3HLPA 2WYRA 4ETJA 4A94A 3ETIA 5K8NA 3KHZA 2X47A 1RTQA 1Y7EA 1Z2LA 4J4ZA 7CPAA 3FJUA 3T8WA 1PYTB 1Z5RA 2CTCA 4R8FA 1DTDA 3S9NA 4P45A 2Q4ZA 2XEGA 4P4IA 3FVLA 4X2TA 3PB6X 1CPSA 5CB3A 1VHOA 1TKFA 2GU2A 2V77A 4O23A 4P4BA 5JM6A 2EK8A 2HB6A 5JH9A 3CDXA 3H8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK9 A;  4TU0 A;  1NSA A;  2ZEO A;  3VAR A;  3L2N A;  3KHX A;  1VHU A;  3KAS A;  3IFE A;  4JCA A;  4MCS A;  4NGN A;  4GVV A;  1SPV A;  3IEH A;  3QNV A;  3D67 A;  4X3R A;  1TKJ A;  5JGF A;  4GVW A;  4P4F A;  3RBU A;  4Z65 A;  1ELL P;  3PFE A;  3SJX A;  2ZOG A;  5FSY A;  4KYB A;  2V8D A;  4MHN A;  3SI0 A;  4ZY1 A;  1DE4 C;  3GB0 A;  1F2P A;  2PJ2 A;  4OME A;  2PJ9 A;  5HVH A;  1OBR A;  1VGY A;  4GUA A;  1CP6 A;  3D4U A;  4PXB A;  5LYL A;  2Q43 A;  5FSV A;  2AFU A;  4ZI6 A;  1LAM A;  5CMS A;  2AFW A;  2C6G A;  4UIA A;  4J5S A;  3EWO A;  3EKE A;  1ZLH A;  3D7D A;  4OC4 A;  2PIY A;  4UIB A;  1QMU A;  2PJ5 A;  2OOT A;  3FEC A;  2V8H A;  3D68 A;  2GLJ A;  1Q7L A;  3PBB A;  1LOK A;  4EFD A;  3V38 A;  3KZW A;  2ZEL A;  3SIJ A;  2ZED A;  2AFZ A;  2FXK A;  4PQA A;  1LCP A;  1XMB A;  3EWP A;  2AFO A;  2AFM A;  5LYD A;  2XEJ A;  2POK A;  4ZY2 A;  2RFH A;  5D8N A;  2PRQ A;  1KWM A;  3K2K A;  2ACF A;  4NGQ A;  3LMS A;  2O53 A;  2JEW A;  3SI1 A;  3WT4 A;  2J9A A;  3B3V A;  2XEI A;  2V8V A;  3PB9 X;  4NGP A;  1ZG8 A;  4B6Z A;  3FMC A;  3B7I A;  4OP4 A;  4OC0 A;  2FVG A;  2DX6 A;  1Y0R A;  3NFZ A;  3VH9 A;  3PB7 X;  2EEE A;  4FUU A;  3TC8 A;  1BPM A;  1ZLI A;  2DEA A;  3FH4 A;  1YW6 A;  3KQZ A;  1TF8 A;  2ZEM A;  4MHP A;  3NH8 A;  2ZEP A;  4PPZ A;  4K0C A;  3GQO A;  4OC3 A;  3PBE A;  3EJF A;  3PB8 X;  3RZA A;  2C6P A;  4OC2 A;  3D66 A;  1ZG9 A;  8CPA A;  3VFQ A;  5ELY A;  2ANP A;  2PJ1 A;  4P4D A;  4YU9 A;  5FSU A;  4ETK A;  4UEF A;  1Z8L A;  4DYO A;  2FAV A;  4W9Y A;  4ZY0 A;  4MHY A;  5K8M A;  4GM5 A;  3IO1 A;  1QQ9 A;  1PCA A;  3S9L A;  5FSZ A;  1BLL E;  1HJZ A;  4P6Y A;  1XRY A;  3PB4 X;  4JLL A;  5HVF A;  3IC1 A;  3GPQ A;  4A38 A;  5CPA A;  4R7M A;  5LRG A;  3CPX A;  5LRK A;  1AMP A;  2O4H A;  2AFX A;  4MCR A;  2PE3 A;  5LRJ A;  3EWQ A;  4KSI A;  2CF4 A;  4ABK A;  1H8L A;  1CPX A;  4R6T A;  4P44 A;  2QJ8 A;  1ARL A;  5K8P A;  2V8G A;  1TF9 A;  1Y0Y A;  3SJF A;  4P4J A;  3CPA A;  2F7V A;  2PVW A;  4MCQ A;  4CPA A;  1CX8 A;  5E3B A;  1F2O A;  2IMO A;  4OC5 A;  2BFQ A;  4JGK A;  4ONW A;  4P10 A;  5FSX A;  3FF3 A;  3N5F A;  5HXD A;  4H2K A;  1YW4 A;  2C1C A;  3Q6Z A;  3DLJ A;  4JVV A;  3D7H A;  1XJO A;  2ZEG A;  3SJG A;  4FAI A;  5HVG A;  3D7F A;  4NGS A;  3I1U A;  1TXZ A;  4ZX9 A;  3WAB A;  3KI9 A;  1CG2 A;  3ISZ A;  4WWV A;  3KR4 A;  4MMO A;  1FNO A;  1LAP A;  4ZX8 A;  4P4E A;  4IHM A;  5LYI A;  4F9U A;  4IQY A;  3K9T A;  3KR5 A;  4K3N A;  2PJ6 A;  1AYE A;  3S9M A;  3Q71 A;  1ZR5 A;  4FBE A;  4TNU A;  2F8H A;  1NJR A;  2QYV A;  2PJ7 A;  2ZEH A;  3SJE A;  5AIL A;  3SIG A;  1R3N A;  4R76 A;  4OID A;  1IGB A;  1ZG7 A;  3GLJ A;  2JBJ A;  2WZN A;  3BI0 A;  5DUS A;  1HDQ A;  3FX6 A;  4A39 A;  2PJC A;  2ABZ A;  3CT9 A;  5D29 A;  4UF4 A;  3H8E A;  3SI2 A;  2FG1 A;  4EWT A;  2GRE A;  4NGT A;  5J1Q A;  2ZEE A;  2I3C A;  1IY7 A;  2QVP A;  4IAV A;  3V2B A;  4DUK A;  4ABL A;  2L8R A;  1YME A;  3PEI A;  3EJG A;  3B3W A;  2PCU A;  3FEE A;  2LGR A;  3PRT A;  1BAV A;  2JBK A;  2VRI A;  4MHZ A;  3H8G A;  2CIJ A;  3BI1 A;  2EWB A;  3IID A;  4RUH A;  2C6C A;  3GUX A;  5CB5 A;  1FT7 A;  5IB9 A;  3GQE A;  1F57 A;  1LFW A;  1TKH A;  3B35 A;  4JYW A;  2BOA A;  4BD9 A;  2BFR A;  1GYT A;  4NFR A;  3LWU A;  2PJB A;  5HIH A;  5THW A;  3KGQ A;  3TX8 A;  3IWW A;  1CBX A;  5LYF A;  2VL1 A;  3IJ3 A;  3PFO A;  2BCO A;  1VHE A;  2NSM A;  4G1P A;  2PJ0 A;  1HEE A;  4J5Q A;  3GPO A;  1ELM P;  2PJA A;  1LAN A;  3VAT A;  3NH5 A;  4JZ0 A;  2AFC A;  2ZOF A;  3B3S A;  3KL9 A;  3B3T A;  3GPG A;  2ZEF A;  2IJZ A;  1BPN A;  3EWR A;  3WC7 A;  4EME A;  4UML A;  4D86 A;  1XFO A;  3V45 A;  1VIX A;  4WJB A;  2PVV A;  3NA6 A;  2PJ3 A;  4MCP A;  4DJL A;  4PXE A;  4PXD A;  2AFS A;  3BHX A;  6CPA A;  1ZR3 A;  3MN8 A;  1YLO A;  2HC9 A;  4AXV A;  2ZEN A;  3RAM A;  4FWU A;  3BXM A;  3DGV A;  3MRU A;  4NJR A;  3ISX A;  5K8O A;  2RB7 A;  4NJQ A;  3NH4 A;  4UEZ A;  4ESS A;  2GLF A;  3HUV A;  4OKO A;  3WC5 A;  5I4M A;  4PXC A;  2G9D A;  4MXU A;  5DS0 A;  1TY8 A;  1EE3 P;  3V7Z A;  4IK2 A;  3KQX A;  4UEE A;  4TWE A;  3SIH A;  4MRI A;  2BO9 A;  4X8I A;  1CP7 A;  2NYQ A;  3JRU A;  1YSJ A;  3FED A;  4F8Z A;  3WC6 A;  1ARM A;  4NGR A;  4A37 A;  3EW5 A;  2CTB A;  5CBM A;  2PIZ A;  4OIW A;  3B2Y A;  3D7G A;  3IIF A;  1XBU A;  4J5R A;  5F09 A;  1M4L A;  5HOL A;  4F9V A;  1TXR A;  2Q51 A;  4OC1 A;  1JQG A;  4ZYQ A;  4Q7A A;  3SII A;  2PJ8 A;  1R43 A;  4LQG A;  1YD9 A;  2XEF A;  2XD7 A;  3JZT A;  1HDU A;  3IIB A;  2IQ6 A;  1UWY A;  2PJ4 A;  4YWY A;  2OR4 A;  3B3C A;  4NGM A;  3HLP A;  2WYR A;  4ETJ A;  4A94 A;  3ETI A;  5K8N A;  3KHZ A;  2X47 A;  1RTQ A;  1Y7E A;  1Z2L A;  4J4Z A;  7CPA A;  3FJU A;  3T8W A;  1PYT B;  1Z5R A;  2CTC A;  4R8F A;  1DTD A;  3S9N A;  4P45 A;  2Q4Z A;  2XEG A;  4P4I A;  3FVL A;  4X2T A;  3PB6 X;  1CPS A;  5CB3 A;  1VHO A;  1TKF A;  2GU2 A;  2V77 A;  4O23 A;  4P4B A;  5JM6 A;  2EK8 A;  2HB6 A;  5JH9 A;  3CDX A;  3H8F A; 
#chains in the Genus database with same CATH topology
 4MFQ A;  4CRY B;  2EK9 A;  2G3T A;  4CYO A;  4TU0 A;  1NSA A;  1UFH A;  2ZEO A;  4KSA A;  4A33 A;  4A95 A;  1Z8T A;  3VAR A;  3L2N A;  5C82 A;  3D3S A;  1LRZ A;  3KHX A;  1VHU A;  3S6K A;  4HNY B;  3KAS A;  3IFE A;  4JCA A;  4C7I A;  1MJA A;  1FY7 A;  3I9S A;  4MCS A;  4NGN A;  2PR8 A;  1IU8 A;  1VKC A;  1XF8 A;  4GVV A;  1YLE A;  4B12 A;  1SPV A;  3CXP A;  3N7Z A;  3RO0 A;  3IEH A;  4R57 A;  3QNV A;  3D67 A;  4KS9 A;  4H6Z A;  4XNH B;  1TKJ A;  4X3R A;  3S6H A;  5KTD A;  5JGF A;  4GVW A;  2R8V A;  1Z8W A;  4J3G A;  4P4F A;  4XNH C;  4IUS A;  4B14 A;  3RBU A;  1NSL A;  3TT2 A;  4Z65 A;  3P2H A;  1ELL P;  2P6E A;  3PFE A;  3SJX A;  2ZOG A;  5FSY A;  4KYB A;  2V8D A;  4MHN A;  3SI0 A;  3G3S A;  5ISV A;  4ZY1 A;  1DE4 C;  2FSR A;  1F2P A;  2PJ2 A;  2VI7 A;  3GB0 A;  4EVY A;  4AVB A;  4OME A;  1YVO A;  2PJ9 A;  3T90 A;  1IB1 E;  5HVH A;  1OBR A;  1VGY A;  4GUA A;  1CP6 A;  3D4U A;  4PXB A;  4DNC A;  5I0C A;  5LYL A;  1P4N A;  4M6H A;  2Q43 A;  2Q04 A;  5FSV A;  2K5T A;  2ZW4 A;  2AFU A;  4ZI6 A;  1KUY A;  2FE7 A;  5J8C A;  1LAM A;  5CMS A;  4CS0 B;  2AFW A;  1MJB A;  2C6G A;  3VWD A;  1Y9W A;  1XMT A;  4KOR A;  4UIA A;  3TCV A;  4J5S A;  3EWO A;  3EKE A;  2G3A A;  1ZLH A;  2WPW A;  4R87 A;  4YGO A;  3D7D A;  3SXN A;  1SQH A;  4OC4 A;  2PIY A;  2PR1 A;  4UIB A;  1QMU A;  2PJ5 A;  2QIR A;  3FEC A;  1YGH A;  2OOT A;  4AB7 A;  2V8H A;  3D68 A;  1RXT A;  4Y49 B;  1M4G A;  2GLJ A;  3FRM A;  1Q7L A;  1XEB A;  2R1I A;  3F5B A;  2BL1 A;  3PBB A;  1LOK A;  2IL4 A;  4EFD A;  4Y49 C;  2Q4Y A;  3V38 A;  3KZW A;  2ZEL A;  3SIJ A;  2ZED A;  2AFZ A;  5EMI A;  2FXK A;  4UWJ A;  1M4I A;  2D4O A;  1LCP A;  1XMB A;  4PQA A;  3SHP A;  3EWP A;  3F8K A;  2AFO A;  2AFM A;  2VEZ A;  5LYD A;  2Z10 A;  4ONU A;  1I12 A;  4KLW A;  2WPX A;  4B13 A;  2FIA A;  2XEJ A;  2POK A;  4ZY2 A;  2RFH A;  4CAV A;  5D8N A;  2PRQ A;  3KKW A;  4RN7 A;  1WK4 A;  1KWM A;  3C26 A;  3K2K A;  4RS2 A;  4HKF A;  3R95 A;  1Z8X A;  3VWE A;  4QBJ A;  2ACF A;  4NGQ A;  3LMS A;  2B3U A;  2JEW A;  2O53 A;  2REE A;  3P2F A;  4M6I A;  2J9A A;  3B3V A;  4PK2 A;  3SI1 A;  5GCN A;  3WT4 A;  2XEI A;  5F46 A;  2V8V A;  4CGP A;  2OH1 A;  2REF A;  1ZG8 A;  3BLN A;  3EO4 A;  3PB9 X;  3FMC A;  4NGP A;  3B7I A;  4OP4 A;  4OC0 A;  4B6Z A;  5F47 A;  2FVG A;  2DX6 A;  1Q2C A;  3TFY A;  5AG7 A;  1ON0 A;  1Y0R A;  3LD2 A;  4C2Z A;  3NFZ A;  3VH9 A;  5EBV A;  3PB7 X;  2P0W A;  2EEE A;  4FUU A;  3TC8 A;  1BPM A;  1V0C A;  3W6S A;  2D4P A;  4KOU A;  1ZLI A;  4UFW A;  2DEA A;  3FH4 A;  1YW6 A;  4UFX A;  3KQZ A;  1TF8 A;  2ZEM A;  4B5P A;  4MHP A;  3NH8 A;  2ZEP A;  2JZF A;  4PPZ A;  4MFL A;  4K0C A;  5CNP A;  3T9Y A;  3GQO A;  1JWQ A;  4QC6 A;  4OC3 A;  1YQE A;  4CAW A;  3PBE A;  3R1K A;  3EJF A;  1IOI A;  3PB8 X;  3RZA A;  3ZZI A;  4F0Y A;  2C6P A;  4OC2 A;  3D66 A;  1OZP A;  2WCT A;  1ZG9 A;  4L8A A;  8CPA A;  3VFQ A;  5ELY A;  2ANP A;  2ARH A;  3K9U A;  2FL4 A;  2J8M A;  2PJ1 A;  4P4D A;  4YU9 A;  2ODF A;  5FSU A;  1BOB A;  2PC1 A;  4ETK A;  3CXQ A;  4KOX A;  2RC4 A;  4UEF A;  2C27 A;  4C7H A;  4MY3 A;  1Z8L A;  4MHD A;  4AG7 A;  2FAV A;  4DYO A;  1S60 A;  4R3K A;  4II9 A;  4W9Y A;  2OZH A;  4BIN A;  2JZD A;  4ZY0 A;  3QAY A;  4MHY A;  5K8M A;  4GM5 A;  1YRE A;  1YVK A;  3IO1 A;  4C68 A;  1QQ9 A;  1PCA A;  3S9L A;  5FSZ A;  2QEC A;  1BLL E;  1HJZ A;  4P6Y A;  1XRY A;  5AG5 A;  4R9M A;  3PB4 X;  4JLL A;  5HVF A;  3IC1 A;  3V8I A;  3GPQ A;  3TOA A;  4A38 A;  2JDD A;  4Q38 A;  5CPA A;  4R7M A;  4AVC A;  3PGP A;  1L0C A;  3MGD A;  2Z3P A;  4M85 A;  5LRG A;  5G1Z A;  3CPX A;  1YX0 A;  5LRK A;  1AMP A;  1NMT A;  2O4H A;  4JXQ A;  3DNS A;  4BMH A;  2AFX A;  3IU1 A;  2RNK A;  2YNC C;  4MCR A;  2YND A;  2CXA A;  1QSO A;  2PE3 A;  5LRJ A;  3EWQ A;  4KSI A;  2CF4 A;  4JXR A;  2KCW A;  2PRB A;  3F0A A;  4ABK A;  2OB0 A;  2AE6 A;  2HV2 A;  1H8L A;  1CPX A;  4R6T A;  4P44 A;  2QJ8 A;  1ARL A;  4XPK A;  5K8P A;  2V8G A;  1TF9 A;  1Y0Y A;  1Y7R A;  4LUA A;  4U9Z A;  3NE8 A;  3SJF A;  4A30 A;  4P4J A;  3CPA A;  2F7V A;  5F48 A;  1Z4R A;  2PVW A;  4MCQ A;  2DF5 A;  2P6F A;  1PUA A;  2A4N A;  2BSW A;  4CPA A;  5A28 A;  3FIX A;  1CX8 A;  5E3B A;  2JDC A;  2EO8 A;  1M1D A;  1KUX A;  2H5M A;  4L89 A;  2ZW5 A;  1F2O A;  3TE4 A;  2IMO A;  4MFZ A;  4IF5 A;  4OC5 A;  2BFQ A;  1M44 A;  4FD6 A;  5G22 A;  3QAH A;  4FD4 A;  4KOT A;  2PQ8 A;  4JGK A;  4ONW A;  4P10 A;  5FSX A;  3FF3 A;  3N5F A;  4RI1 A;  4H2K A;  5HXD A;  4MBU A;  5IX3 A;  2AJ6 A;  4LX9 A;  4FD7 A;  1YW4 A;  1K4J A;  2Z3K A;  1IYL A;  3Q6Z A;  2C1C A;  3DLJ A;  3FNC A;  4JVV A;  3D7H A;  4CYN A;  1XJO A;  3IWE A;  4UBR A;  2ZEG A;  3W6X A;  4F0X A;  3S6F A;  3D2P A;  3BJ8 A;  5HH1 A;  1IYK A;  3SJG A;  4FAI A;  1B87 A;  4CYP A;  1CM0 A;  5IB0 A;  5HVG A;  3D7F A;  1X10 A;  3FBU A;  3H5Z A;  3I1U A;  1TXZ A;  4NGS A;  4UCM A;  3JUW A;  4ZX9 A;  2BUE A;  3WAB A;  1A2Z A;  2QML A;  4BBH A;  3KI9 A;  1ZO0 A;  2PDO A;  1CG2 A;  1CJW A;  3IU2 A;  2YNE A;  3ISZ A;  4WWV A;  4B10 A;  4X5K A;  3KR4 A;  4MMO A;  4NXY A;  5G21 A;  1FNO A;  1LAP A;  4ZX8 A;  4P4E A;  4IHM A;  1N71 A;  5LYI A;  4C2X A;  4F9U A;  4IQY A;  3K9T A;  3KR5 A;  4K3N A;  2PJ6 A;  1AYE A;  2ZW6 A;  3G8W A;  3OWC A;  3S9M A;  3Q71 A;  1ZR5 A;  4FBE A;  4TNU A;  4MFJ A;  4PK3 A;  1TIQ A;  2J8N A;  2OU2 A;  2F8H A;  1NJR A;  2JEV A;  2PJ7 A;  2QYV A;  2ZEH A;  3SJE A;  5AIL A;  3SIG A;  3R9F A;  1R3N A;  1R57 A;  3PP9 A;  4ZBG A;  4CYQ A;  4R76 A;  3CZX A;  4OID A;  4YRH A;  1IGB A;  3DR8 A;  4GXH A;  4M6G A;  1ZG7 A;  3GLJ A;  3PZJ A;  4U5Y A;  2JBJ A;  2WZN A;  3BI0 A;  3FB3 A;  5HMN A;  2HQY A;  5DUS A;  1HDQ A;  5AG4 A;  3FX6 A;  4A39 A;  2PJC A;  2ABZ A;  4FD5 A;  4CGL A;  3CT9 A;  2F5I A;  5IV0 A;  5H84 A;  5D29 A;  4UF4 A;  2W2G A;  3H8E A;  4XPL A;  3SI2 A;  2GFQ A;  2FG1 A;  4EWT A;  2GRE A;  4CGO A;  3GYA A;  1KZF A;  4KLV A;  2DPS A;  4NGT A;  4Q36 A;  5J1Q A;  2ZEE A;  3EC4 A;  5H86 A;  2B58 A;  1QSN A;  4CAF A;  4CAX A;  2PSW A;  2I3C A;  3TO6 A;  4GS4 A;  1IY7 A;  1S7L A;  2QVP A;  3V2B A;  4IAV A;  5FVJ A;  1AUG A;  1Z4E A;  4DUK A;  4F6A A;  4ABL A;  2L8R A;  1YME A;  3PEI A;  4UFV A;  3EJG A;  4OLL A;  4NSQ A;  3GIU A;  3B3W A;  1MJ9 A;  5EC4 A;  3D2M A;  2PCU A;  3FEE A;  5AG6 A;  3FXT A;  4HNX B;  2LGR A;  4UA3 A;  3R9G A;  3PRT A;  3DDD A;  4OAD A;  4KUA A;  2Z0Z A;  1Z9U A;  1BAV A;  1WWZ A;  5KTC A;  4PSW A;  2GAN A;  2HUZ A;  2JBK A;  2VRI A;  2B5G A;  3H8G A;  4M3S A;  2CIJ A;  4MHZ A;  3BI1 A;  4UCP A;  4CGM A;  2B5G B;  2Z3L A;  2EWB A;  3IID A;  4A32 A;  4NF1 A;  4RUH A;  2EVN A;  2CNT A;  3R96 A;  2C6C A;  3GUX A;  5CB5 A;  1FT7 A;  3WR7 A;  2EUI A;  2CNM A;  5JPH A;  5IB9 A;  3GQE A;  1F57 A;  2NMT A;  1LFW A;  2FIW A;  2YNC A;  2VXK A;  4JJX A;  2Q44 A;  1TKH A;  3B35 A;  3TO9 A;  2Q0Y A;  4JYW A;  4UWI A;  2BOA A;  1X12 A;  2BFR A;  2ZXV A;  3I3G A;  4BD9 A;  1GYT A;  4NFR A;  2CY2 A;  4MFP A;  3LWU A;  2PJB A;  5HIH A;  5THW A;  4MJ8 A;  3KGQ A;  3TX8 A;  2Q7B A;  3IWW A;  2Q4V A;  3D8P A;  1CBX A;  5LYF A;  2VL1 A;  3DSB A;  3IJ3 A;  3CXS A;  3PFO A;  2BCO A;  1Q2Y A;  1VHE A;  2NSM A;  4G1P A;  2I00 A;  2YGW A;  2PJ0 A;  3DR6 A;  1HEE A;  4J5Q A;  3GPO A;  4YFJ A;  5KTA A;  1ELM P;  2PJA A;  1LAN A;  1S7N A;  1I21 A;  2B3V A;  3EFA A;  4PV6 A;  3VAT A;  3NH5 A;  4JZ0 A;  2AFC A;  2R98 A;  2ZOF A;  3B3S A;  2ZPA A;  4A2Z A;  3TTH A;  3KL9 A;  3GPG A;  2ZEF A;  3B3T A;  2IJZ A;  1BPN A;  4H89 A;  3EWR A;  4MFK A;  4E8O A;  2O28 A;  3WC7 A;  4EME A;  3H4Q A;  2Q7S A;  4UML A;  3A9L A;  3E0K A;  2GIV A;  4D86 A;  1XFO A;  3V45 A;  1VIX A;  4WJB A;  2GE3 A;  2PVV A;  3S6G A;  3NA6 A;  2G0B A;  4A31 A;  1IID A;  2PJ3 A;  4MCP A;  4DJL A;  3GY9 A;  4PXE A;  4PXD A;  2AFS A;  5E96 A;  1IIC A;  2Z3O A;  4CAE A;  3GKR A;  5A27 A;  3BHX A;  6CPA A;  1ZR3 A;  4E2A A;  4E0A A;  3MN8 A;  1YLO A;  2HC9 A;  4AXV A;  2ZEN A;  3RAM A;  4FWU A;  1Q2D A;  4UCN A;  3BXM A;  3IGR A;  1I1D A;  3DGV A;  3B8G A;  3MRU A;  2VBQ A;  3ISX A;  4NJR A;  5J8F A;  2RB7 A;  5G20 A;  5K8O A;  4NJQ A;  3NH4 A;  1VHS A;  4UEZ A;  4KVO E;  2FCK A;  1PU9 A;  2DXQ A;  3NE7 A;  4ESS A;  4JD6 A;  4KVX A;  2FS5 A;  4U9Y A;  2GLF A;  3HUV A;  1GHE A;  4I49 A;  4KVM E;  4OKO A;  2WUU A;  3WC5 A;  5I4M A;  4PXC A;  2G9D A;  4MXU A;  3R9E A;  5DS0 A;  2Z3N A;  1YK3 A;  1QST A;  3JVN A;  1TY8 A;  1J4J A;  1EE3 P;  1NE9 A;  1QSM A;  2X7B A;  3V7Z A;  2FT0 A;  4IK2 A;  3KQX A;  4HPS A;  2R7H A;  4UEE A;  2P6G A;  2B4B A;  3SIH A;  2ZW7 A;  4TWE A;  4MRI A;  2BO9 A;  4R3L A;  4ORF A;  4LQ6 A;  1QSR A;  4X8I A;  1CP7 A;  2ATR A;  2NYQ A;  1S7F A;  4OAE A;  3JRU A;  4CGN A;  5JQ4 A;  3TOB A;  1RO5 A;  2DPT A;  2VQY A;  4QUS A;  1YSJ A;  3FED A;  3LAC A;  5F49 A;  3WC6 A;  4AVA A;  1ARM A;  4F8Z A;  4NGR A;  2J8R A;  3EW5 A;  4A37 A;  4NCZ A;  1KUV A;  1IOF A;  2CTB A;  5CBM A;  2PIZ A;  4K30 A;  1S3Z A;  3TO7 A;  5DWN A;  2FXF A;  4OIW A;  4NEX A;  3EXN A;  1S5K A;  2Z3M A;  2Y0M A;  3B2Y A;  3D7G A;  3JTK A;  3IIF A;  1XBU A;  4J5R A;  5F09 A;  1M4L A;  4KOS A;  5HOL A;  2B4D A;  3ZJ0 A;  4F9V A;  1BO4 A;  1TXR A;  2B4D B;  2Q51 A;  2WSA A;  4MI4 A;  4OC1 A;  1JQG A;  2I79 A;  4HNW B;  4ZYQ A;  4Q7A A;  4XPD B;  3RNZ A;  3RYO A;  3SII A;  4JWP A;  1XIX A;  3SXO A;  3FYN A;  2PJ8 A;  1R43 A;  2VZY A;  4KSF A;  4LQG A;  1YD9 A;  2JLM A;  2XEF A;  3IWG A;  4XPD C;  3QB8 A;  2XD7 A;  4H6U A;  4QB9 A;  3JZT A;  1HDU A;  3IIB A;  4B5P B;  2IQ6 A;  1B6B A;  4AG9 A;  1MK4 A;  1UWY A;  2PJ4 A;  3EY5 A;  2OR4 A;  4YWY A;  4B11 A;  3B3C A;  3LOD A;  3W91 A;  1S7K A;  1YR0 A;  4KOW A;  4NGM A;  4KOV A;  5DWM A;  4KOY A;  3UY5 A;  3HLP A;  5AGE A;  4ETJ A;  2WYR A;  4A94 A;  3ETI A;  4ZGY B;  5K8N A;  3KHZ A;  2X47 A;  2KQV A;  1RTQ A;  1XE4 A;  1Y7E A;  2CNS A;  4CRZ B;  1Z2L A;  4J4Z A;  1M4D A;  3BJ7 A;  7CPA A;  4KZT A;  3FJU A;  3T8W A;  1PYT B;  1Z5R A;  2VZZ A;  4PSX A;  2CTC A;  4R8F A;  5BWA B;  1DTD A;  3S9N A;  1P0H A;  2Q4Z A;  4P45 A;  2BEI A;  2XEG A;  3FVL A;  4P4I A;  4JLY A;  1XOV A;  4X2T A;  3PB6 X;  5C88 A;  2EBJ A;  1CPS A;  2JZE A;  1Y9K A;  5CB3 A;  4C2Y A;  1VHO A;  4QVT A;  1TKF A;  2GU2 A;  2Z11 A;  2V77 A;  4O23 A;  4P4B A;  2OZG A;  5JM6 A;  4B5O A;  2EK8 A;  2OZU A;  2HB6 A;  4KUB A;  4MY0 A;  1U6M A;  5JH9 A;  3CDX A;  3H8F A; 
#chains in the Genus database with same CATH homology
 2EK9 A;  4TU0 A;  1NSA A;  2ZEO A;  3VAR A;  3L2N A;  3KHX A;  1VHU A;  3KAS A;  3IFE A;  4JCA A;  4MCS A;  4NGN A;  4GVV A;  1SPV A;  3IEH A;  3QNV A;  3D67 A;  4X3R A;  1TKJ A;  5JGF A;  4GVW A;  4P4F A;  3RBU A;  4Z65 A;  1ELL P;  3PFE A;  3SJX A;  2ZOG A;  5FSY A;  4KYB A;  2V8D A;  4MHN A;  3SI0 A;  4ZY1 A;  1DE4 C;  3GB0 A;  1F2P A;  2PJ2 A;  4OME A;  2PJ9 A;  5HVH A;  1OBR A;  1VGY A;  4GUA A;  1CP6 A;  3D4U A;  4PXB A;  5LYL A;  2Q43 A;  5FSV A;  2AFU A;  4ZI6 A;  1LAM A;  5CMS A;  2AFW A;  2C6G A;  4UIA A;  4J5S A;  3EWO A;  3EKE A;  1ZLH A;  3D7D A;  4OC4 A;  2PIY A;  4UIB A;  1QMU A;  2PJ5 A;  2OOT A;  3FEC A;  2V8H A;  3D68 A;  2GLJ A;  1Q7L A;  3PBB A;  1LOK A;  4EFD A;  3V38 A;  3KZW A;  2ZEL A;  3SIJ A;  2ZED A;  2AFZ A;  2FXK A;  4PQA A;  1LCP A;  1XMB A;  3EWP A;  2AFO A;  2AFM A;  5LYD A;  2XEJ A;  2POK A;  4ZY2 A;  2RFH A;  5D8N A;  2PRQ A;  1KWM A;  3K2K A;  2ACF A;  4NGQ A;  3LMS A;  2O53 A;  2JEW A;  3SI1 A;  3WT4 A;  2J9A A;  3B3V A;  2XEI A;  2V8V A;  3PB9 X;  4NGP A;  1ZG8 A;  4B6Z A;  3FMC A;  3B7I A;  4OP4 A;  4OC0 A;  2FVG A;  2DX6 A;  1Y0R A;  3NFZ A;  3VH9 A;  3PB7 X;  2EEE A;  4FUU A;  3TC8 A;  1BPM A;  1ZLI A;  2DEA A;  3FH4 A;  1YW6 A;  3KQZ A;  1TF8 A;  2ZEM A;  4MHP A;  3NH8 A;  2ZEP A;  4PPZ A;  4K0C A;  3GQO A;  4OC3 A;  3PBE A;  3EJF A;  3PB8 X;  3RZA A;  2C6P A;  4OC2 A;  3D66 A;  1ZG9 A;  8CPA A;  3VFQ A;  5ELY A;  2ANP A;  2PJ1 A;  4P4D A;  4YU9 A;  5FSU A;  4ETK A;  4UEF A;  1Z8L A;  4DYO A;  2FAV A;  4W9Y A;  4ZY0 A;  4MHY A;  5K8M A;  4GM5 A;  3IO1 A;  1QQ9 A;  1PCA A;  3S9L A;  5FSZ A;  1BLL E;  1HJZ A;  4P6Y A;  1XRY A;  3PB4 X;  4JLL A;  5HVF A;  3IC1 A;  3GPQ A;  4A38 A;  5CPA A;  4R7M A;  5LRG A;  3CPX A;  5LRK A;  1AMP A;  2O4H A;  2AFX A;  4MCR A;  2PE3 A;  5LRJ A;  3EWQ A;  4KSI A;  2CF4 A;  4ABK A;  1H8L A;  1CPX A;  4R6T A;  4P44 A;  2QJ8 A;  1ARL A;  5K8P A;  2V8G A;  1TF9 A;  1Y0Y A;  3SJF A;  4P4J A;  3CPA A;  2F7V A;  2PVW A;  4MCQ A;  4CPA A;  1CX8 A;  5E3B A;  1F2O A;  2IMO A;  4OC5 A;  2BFQ A;  4JGK A;  4ONW A;  4P10 A;  5FSX A;  3FF3 A;  3N5F A;  5HXD A;  4H2K A;  1YW4 A;  2C1C A;  3Q6Z A;  3DLJ A;  4JVV A;  3D7H A;  1XJO A;  2ZEG A;  3SJG A;  4FAI A;  5HVG A;  3D7F A;  4NGS A;  3I1U A;  1TXZ A;  4ZX9 A;  3WAB A;  3KI9 A;  1CG2 A;  3ISZ A;  4WWV A;  3KR4 A;  4MMO A;  1FNO A;  1LAP A;  4ZX8 A;  4P4E A;  4IHM A;  5LYI A;  4F9U A;  4IQY A;  3K9T A;  3KR5 A;  4K3N A;  2PJ6 A;  1AYE A;  3S9M A;  3Q71 A;  1ZR5 A;  4FBE A;  4TNU A;  2F8H A;  1NJR A;  2QYV A;  2PJ7 A;  2ZEH A;  3SJE A;  5AIL A;  3SIG A;  1R3N A;  4R76 A;  4OID A;  1IGB A;  1ZG7 A;  3GLJ A;  2JBJ A;  2WZN A;  3BI0 A;  5DUS A;  1HDQ A;  3FX6 A;  4A39 A;  2PJC A;  2ABZ A;  3CT9 A;  5D29 A;  4UF4 A;  3H8E A;  3SI2 A;  2FG1 A;  4EWT A;  2GRE A;  4NGT A;  5J1Q A;  2ZEE A;  2I3C A;  1IY7 A;  2QVP A;  4IAV A;  3V2B A;  4DUK A;  4ABL A;  2L8R A;  1YME A;  3PEI A;  3EJG A;  3B3W A;  2PCU A;  3FEE A;  2LGR A;  3PRT A;  1BAV A;  2JBK A;  2VRI A;  4MHZ A;  3H8G A;  2CIJ A;  3BI1 A;  2EWB A;  3IID A;  4RUH A;  2C6C A;  3GUX A;  5CB5 A;  1FT7 A;  5IB9 A;  3GQE A;  1F57 A;  1LFW A;  1TKH A;  3B35 A;  4JYW A;  2BOA A;  4BD9 A;  2BFR A;  1GYT A;  4NFR A;  3LWU A;  2PJB A;  5HIH A;  5THW A;  3KGQ A;  3TX8 A;  3IWW A;  1CBX A;  5LYF A;  2VL1 A;  3IJ3 A;  3PFO A;  2BCO A;  1VHE A;  2NSM A;  4G1P A;  2PJ0 A;  1HEE A;  4J5Q A;  3GPO A;  1ELM P;  2PJA A;  1LAN A;  3VAT A;  3NH5 A;  4JZ0 A;  2AFC A;  2ZOF A;  3B3S A;  3KL9 A;  3B3T A;  3GPG A;  2ZEF A;  2IJZ A;  1BPN A;  3EWR A;  3WC7 A;  4EME A;  4UML A;  4D86 A;  1XFO A;  3V45 A;  1VIX A;  4WJB A;  2PVV A;  3NA6 A;  2PJ3 A;  4MCP A;  4DJL A;  4PXE A;  4PXD A;  2AFS A;  3BHX A;  6CPA A;  1ZR3 A;  3MN8 A;  1YLO A;  2HC9 A;  4AXV A;  2ZEN A;  3RAM A;  4FWU A;  3BXM A;  3DGV A;  3MRU A;  4NJR A;  3ISX A;  5K8O A;  2RB7 A;  4NJQ A;  3NH4 A;  4UEZ A;  4ESS A;  2GLF A;  3HUV A;  4OKO A;  3WC5 A;  5I4M A;  4PXC A;  2G9D A;  4MXU A;  5DS0 A;  1TY8 A;  1EE3 P;  3V7Z A;  4IK2 A;  3KQX A;  4UEE A;  4TWE A;  3SIH A;  4MRI A;  2BO9 A;  4X8I A;  1CP7 A;  2NYQ A;  3JRU A;  1YSJ A;  3FED A;  4F8Z A;  3WC6 A;  1ARM A;  4NGR A;  4A37 A;  3EW5 A;  2CTB A;  5CBM A;  2PIZ A;  4OIW A;  3B2Y A;  3D7G A;  3IIF A;  1XBU A;  4J5R A;  5F09 A;  1M4L A;  5HOL A;  4F9V A;  1TXR A;  2Q51 A;  4OC1 A;  1JQG A;  4ZYQ A;  4Q7A A;  3SII A;  2PJ8 A;  1R43 A;  4LQG A;  1YD9 A;  2XEF A;  2XD7 A;  3JZT A;  1HDU A;  3IIB A;  2IQ6 A;  1UWY A;  2PJ4 A;  4YWY A;  2OR4 A;  3B3C A;  4NGM A;  3HLP A;  2WYR A;  4ETJ A;  4A94 A;  3ETI A;  5K8N A;  3KHZ A;  2X47 A;  1RTQ A;  1Y7E A;  1Z2L A;  4J4Z A;  7CPA A;  3FJU A;  3T8W A;  1PYT B;  1Z5R A;  2CTC A;  4R8F A;  1DTD A;  3S9N A;  4P45 A;  2Q4Z A;  2XEG A;  4P4I A;  3FVL A;  4X2T A;  3PB6 X;  1CPS A;  5CB3 A;  1VHO A;  1TKF A;  2GU2 A;  2V77 A;  4O23 A;  4P4B A;  5JM6 A;  2EK8 A;  2HB6 A;  5JH9 A;  3CDX A;  3H8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...