3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
4J5RA 1YLOA 3FMCA 4OC5A 1ZG7A 2V8HA 3NFZA 1LAPA 1CBXA 1Y7EA 4YU9A 1XMBA 3LWUA 2V8VA 5HIHA 3V2BA 4NGNA 1Y0RA 2FAVA 1TF8A 2O53A 3S9MA 3JZTA 4P10A 4UMLA 3SJFA 2QVPA 1Y0YA 3B3TA 3BI1A 1FT7A 2NSMA 3PBBA 1AMPA 1BPMA 4OC4A 4IHMA 1FNOA 2VRIA 4D86A 3PFOA 4MCPA 3VARA 4G1PA 5K8NA 2PCUA 2Q4ZA 4OP4A 1TKJA 1SPVA 3MN8A 4OMEA 3D4UA 2PVVA 4IK2A 4EMEA 5D8NA 4R7MA 3NA6A 3GPQA 5FSZA 3SIHA 3WC7A 4RUHA 3D7HA 4BD9A 3NH4A 3IEHA 3KR5A 2POKA 4EFDA 5K8PA 2BFRA 2ZEOA 2QYVA 3Q71A 3KASA 1QMUA 4OC2A 4X2TA 4GM5A 3NH8A 1YMEA 2HB6A 3H8EA 2BCOA 3VH9A 2ZEFA 3RBUA 3DLJA 3L2NA 1XBUA 3TC8A 2CF4A 3B35A 4P4DA 2PIYA 3JRUA 1BPNA 4B6ZA 4FAIA 4KSIA 4ZX8A 4UF4A 3GB0A 5J1QA 2ZOFA 1UWYA 2XEGA 4NGRA 3WC5A 2DEAA 2ZEEA 3PFEA 4ZY0A 1YD9A 5E3BA 4X3RA 2QJ8A 5LYIA 4CPAA 2PJ6A 3SJGA 3T8WA 4ZX9A 3I1UA 2PJ7A 3SI1A 1F2PA 4UEEA 1ZR3A 3GQOA 5JGFA 1BLLE 3V7ZA 4FBEA 2PJ3A 5FSVA 3CDXA 3PB8X 2XEJA 5DUSA 4F9VA 5LRJA 2XD7A 3SIIA 4WWVA 3GQEA 1QQ9A 2IJZA 2WZNA 2ZELA 4JCAA 4PXBA 3MRUA 2AFZA 3PBEA 2F8HA 3FJUA 2ZEDA 2XEIA 1ELLP 3KR4A 2PRQA 4EWTA 4PXCA 4MHZA 2HC9A 3PB4X 3FF3A 3IIDA 2PE3A 5HOLA 1VIXA 4PXEA 5DS0A 1PYTB 2AFUA 4MCRA 1YSJA 2PJBA 2O4HA 2PJ5A 1YW6A 1ZLIA 2JBJA 3KHXA 3RZAA 3WT4A 4O23A 1CP6A 3FEEA 4P6YA 5HVFA 3EJFA 2V8GA 2ZEHA 3FX6A 3LMSA 3IIFA 4KYBA 1XRYA 1VHUA 3PRTA 1ARLA 4OC1A 1KWMA 1LFWA 1TXRA 3SI0A 3SJEA 2EWBA 2ZENA 3IIBA 4MXUA 1TXZA 1EE3P 1BAVA 2IQ6A 5F09A 1F2OA 1AYEA 5FSYA 4UIBA 3HUVA 4MCSA 2AFXA 5JM6A 3EJGA 4YWYA 4ABLA 3D7FA 1Q7LA 1XFOA 1F57A 1R3NA 2C6GA 4GVWA 3QNVA 2ZEMA 1HEEA 4IQYA 4NGQA 1VHEA 4Q7AA 1CG2A 3PEIA 2AFWA 4K0CA 3ISXA 5LYFA 4GUAA 4P4EA 4UEFA 4MMOA 5IB9A 4WJBA 5K8MA 3CPAA 4JVVA 2PJ9A 2ZEGA 1CP7A 2F7VA 4NFRA 1ZLHA 2ABZA 4NGSA 1IY7A 5ELYA 4R8FA 1VHOA 4NJRA 2PIZA 4NGPA 2CTCA 4P4FA 3SIGA 2GU2A 4K3NA 3H8FA 2VL1A 4ZI6A 2ANPA 4P4JA 4DYOA 3ETIA 2C6PA 2EK8A 4J4ZA 4ZYQA 4MHPA 4P44A 3B3CA 3BHXA 2PJ0A 2BOAA 3BXMA 3WC6A 2ZOGA 2GLFA 4OIDA 3D7DA 2BFQA 3FEDA 4X8IA 2GLJA 2CIJA 3S9NA 2FXKA 2L8RA 3B3WA 3B7IA 2V8DA 2PJAA 3KHZA 3PB6X 1Z5RA 5LYDA 1DTDA 3EKEA 3GPOA 2JEWA 2Q51A 3CPXA 1IGBA 3V45A 5D29A 2PJ1A 3BI0A 3IFEA 4NJQA 4ZY2A 5THWA 4PXDA 3FVLA 4JZ0A 2V77A 4A39A 5CB5A 3FH4A 3IWWA 4ZY1A 3RAMA 4OC3A 1ELMP 2J9AA 2LGRA 2JBKA 2FG1A 3EWQA 3DGVA 2X47A 1R43A 2RB7A 3HLPA 2EEEA 1XJOA 3NH5A 5FSXA 1YW4A 4PQAA 3SIJA 2EK9A 3EWOA 4P4BA 3GPGA 1DE4C 2I3CA 5HVHA 1PCAA 2AFCA 3IC1A 3H8GA 2IMOA 4ETJA 2XEFA 4FUUA 4J5QA 1TY8A 3SJXA 3B3SA 2AFSA 1ZG8A 1LCPA 3EWPA 1ARMA 1OBRA 5CBMA 4DJLA 4A38A 4DUKA 2PJCA 3CT9A 5HVGA 2BO9A 3SI2A 5CB3A 2G9DA 3GLJA 4FWUA 2PJ4A 1LAMA 2FVGA 2OOTA 3KQXA 2RFHA 3K9TA 6CPAA 1HJZA 5I4MA 3VFQA 2OR4A 3KI9A 4JYWA 2PJ8A 3B3VA 3V38A 4A37A 3WABA 2DX6A 4P45A 2Q43A 4ESSA 4F9UA 3IJ3A 4IAVA 3FECA 3K2KA 4F8ZA 3VATA 4W9YA 5AILA 1TF9A 1VGYA 3KL9A 5FSUA 3D7GA 4NGTA 4JGKA 4TU0A 5HXDA 4AXVA 4ABKA 4MRIA 5LRGA 4A94A 4J5SA 3EW5A 1TKHA 1CPXA 3KQZA 4MCQA 4UIAA 2PJ2A 3D68A 4UEZA 1Z2LA 4OKOA 1RTQA 3IO1A 4OC0A 2C6CA 3S9LA 2C1CA 3PB7X 3ISZA 5CPAA 1CX8A 8CPAA 2WYRA 3PB9X 3Q6ZA 4TNUA 5LRKA 2ZEPA 1H8LA 3TX8A 3D67A 3EWRA 4NGMA 1LOKA 4MHNA 2AFOA 1TKFA 2PVWA 1HDQA 4GVVA 1CPSA 3D66A 3GUXA 3N5FA 2ACFA 5CMSA 4R76A 1Z8LA 7CPAA 2AFMA 4Z65A 3KGQA 4R6TA 1NSAA 1ZG9A 1LANA 4OIWA 4H2KA 5K8OA 1ZR5A 2CTBA 3KZWA 4LQGA 4PPZA 4ETKA 4MHYA 4TWEA 5JH9A 1NJRA 2NYQA 1M4LA 2GREA 5LYLA 4ONWA 4JLLA 1HDUA 1JQGA 1GYTA 3B2YA 4P4IA
chains in the Genus database with same CATH superfamily
4J5RA 1YLOA 2Y0MA 3BJ7A 3BJ8A 1NE9A 1ZG7A 3FMCA 2V8HA 3NFZA 4KS9A 1LAPA 4OC5A 1CBXA 1WK4A 1Y7EA 1Z9UA 4YU9A 4J3GA 1XMBA 3LWUA 2JEVA 2V8VA 3GY9A 1X10A 2EBJA 2J8RA 1OZPA 5C88A 5HIHA 2RC4A 3V2BA 4M6IA 4KORA 4NGNA 1Y0RA 2FAVA 1TF8A 2O53A 2ATRA 4MHDA 4MY3A 3S9MA 3TO6A 1YR0A 3JZTA 1QSOA 4P10A 2BSWA 2Z3KA 4NCZA 5DWNA 4UMLA 3PP9A 3SJFA 5AG7A 4CAXA 2QVPA 1Y0YA 5AGEA 3B3TA 2HV2A 5J8FA 3BI1A 1FT7A 5EBVA 2P0WA 4IUSA 2NSMA 3PBBA 3JVNA 1AMPA 4KVME 4Q36A 1BPMA 4RN7A 4A33A 3TE4A 3TO9A 4OC4A 5IX3A 1Z4RA 4IHMA 3FNCA 1FNOA 3CXQA 3QAHA 4ONUA 2VRIA 3R96A 4D86A 3PFOA 4MCPA 4UFWA 3VARA 4A2ZA 5HMNA 2FIAA 3W6SA 2R7HA 4QC6A 4CGOA 4JD6A 4G1PA 3SXOA 5K8NA 2PCUA 1IYLA 2NMTA 2Q4ZA 4OP4A 1TKJA 1SPVA 3MN8A 4OMEA 4R87A 3R9EA 4E0AA 5A28A 1ZO0A 2PVVA 3D4UA 4IK2A 4II9A 4EMEA 2B58A 5D8NA 3EC4A 3R1KA 4R7MA 1Y7RA 3GPQA 5FSZA 3NA6A 4JLYA 3SIHA 1MJAA 3WC7A 4RUHA 2X7BA 3D7HA 3R9FA 1A2ZA 3EFAA 2Q0YA 3LACA 3NH4A 2DPTA 4BD9A 3IEHA 1X12A 1VKCA 3KR5A 2POKA 5C82A 4EFDA 5K8PA 2BFRA 2ZEOA 2QYVA 4NEXA 3KKWA 3Q71A 1LRZA 4KVOE 3KASA 3S6GA 4LQ6A 1QMUA 4YFJA 4OC2A 4X2TA 4GM5A 1M4DA 3NH8A 1YMEA 3GKRA 2Q44A 2HB6A 2YNCC 3H8EA 2BCOA 3H5ZA 4KOVA 1S7LA 1XE4A 4FD4A 3VH9A 2ZEFA 3RBUA 5E96A 1V0CA 3DLJA 3L2NA 1IOIA 1XBUA 1M4GA 2OU2A 3TC8A 2CF4A 1XEBA 3B35A 1Y9KA 2ZW5A 4P4DA 2PIYA 2G3AA 3JRUA 2QMLA 1BPNA 4Y49B 3C26A 4B6ZA 1Q2CA 4CAVA 4FAIA 3D3SA 4KSIA 3G3SA 5ISVA 5F49A 4ZX8A 2BL1A 4HNYB 4UF4A 3I3GA 2B3UA 3GB0A 4CAEA 5J1QA 2Q7SA 2VXKA 4B13A 2ZOFA 4F6AA 5F48A 1UWYA 2XEGA 3NE7A 4NGRA 3WC5A 4BINA 2DEAA 2ZEEA 5H86A 3D2MA 3PFEA 4KOYA 1XIXA 4ZY0A 1RO5A 1YD9A 4GS4A 3DSBA 5E3BA 4X3RA 4CYQA 2QJ8A 4UFXA 4UA3A 1IIDA 3DDDA 3TOAA 5KTDA 5LYIA 2GE3A 2O28A 2PRBA 4CPAA 3K9UA 4HNWB 1UFHA 4CAWA 5IV0A 2I79A 2PJ6A 3N7ZA 3SJGA 2BUEA 4QBJA 3T8WA 4ZX9A 4KUAA 2PC1A 3I1UA 2PJ7A 3SI1A 1F2PA 4KOTA 4UEEA 1ZR3A 3GQOA 5JGFA 1BLLE 4FD7A 2PSWA 4XPDB 2FL4A 3V7ZA 4FBEA 4B5PB 2PJ3A 5FSVA 3CDXA 1IOFA 3PB8X 2ODFA 2XEJA 4UCNA 1GHEA 5DUSA 4F9VA 5LRJA 2XD7A 3SIIA 4WWVA 3GQEA 1QQ9A 2IJZA 2WZNA 4MJ8A 2DXQA 2CNTA 2AE6A 4JCAA 2ZELA 2B4DA 4PXBA 3R95A 3RYOA 4E8OA 3MRUA 4M3SA 3R9GA 2AFZA 3PBEA 2F8HA 3FJUA 2ZEDA 3MGDA 4CGNA 4C7HA 4E2AA 2K5TA 1ELLP 3KR4A 2G3TA 2PRQA 2REFA 1M44A 2XEIA 3FXTA 4B5PA 4EWTA 4PXCA 2ARHA 4MHZA 5GCNA 2HC9A 3PB4X 4A95A 3FF3A 3IIDA 2PE3A 4KUBA 2JDCA 2WSAA 5HOLA 1VIXA 2BEIA 4PXEA 2Q04A 5DS0A 2CNMA 1PYTB 2AFUA 4MCRA 2OH1A 1XOVA 1KUVA 2EVNA 1YSJA 2PJBA 2O4HA 1XMTA 2J8NA 4KLWA 2PJ5A 1YW6A 1ZLIA 5EMIA 2JBJA 2GFQA 5KTAA 2F5IA 3KHXA 4XPLA 3RZAA 3WT4A 4O23A 2R98A 2CNSA 1CP6A 3FEEA 2H5MA 2FE7A 5FVJA 4P6YA 5HVFA 3GIUA 2WCTA 3EJFA 4U9YA 1S3ZA 2V8GA 2ZEHA 1Z4EA 3FX6A 3LMSA 4MFKA 4A32A 4C7IA 4XNHB 1Q2DA 4M6GA 3B8GA 3IIFA 3I9SA 4KYBA 1XRYA 2DPSA 3FBUA 1VHUA 2Z0ZA 1ARLA 2PR1A 2GANA 3PRTA 2FCKA 1B87A 3FIXA 1KUYA 4OC1A 4R3KA 1KWMA 1BOBA 1LFWA 1TXRA 3SI0A 3SJEA 2EWBA 4CS0B 1Y9WA 5HH1A 2ZENA 3IIBA 4MXUA 1TXZA 1EE3P 4PK2A 1BAVA 2IQ6A 2R8VA 1F2OA 3TT2A 5F09A 1AYEA 5FSYA 5G1ZA 2G0BA 4KOUA 3T90A 2D4OA 2ZW4A 4UIBA 3HUVA 2PQ8A 4MCSA 2AFXA 4CRZB 5JM6A 3EJGA 4YWYA 4ABLA 4CGLA 3D7FA 4F0YA 4CYOA 1S7KA 1Q7LA 3QB8A 2RNKA 4KVXA 4DNCA 1XFOA 1F57A 1R3NA 4X5KA 3TOBA 2C6GA 4Y49C 4F0XA 4GVWA 3TCVA 3QNVA 2ZEMA 1HEEA 1S7FA 4NSQA 1QSMA 4IQYA 4YGOA 1KZFA 4NGQA 5EC4A 1VHEA 3EXNA 4JWPA 4L8AA 4Q7AA 1CG2A 3PEIA 2AFWA 4K0CA 2WUUA 3ISXA 5LYFA 4GUAA 4P4EA 4UEFA 4MMOA 4AVCA 1JWQA 5IB9A 4WJBA 1B6BA 3P2HA 5K8MA 1I1DA 4JVVA 2PJ9A 3CPAA 2ZEGA 1CP7A 2F7VA 4LUAA 4NFRA 3E0KA 4PV6A 1ZLHA 2ABZA 4NGSA 1IY7A 1YQEA 4MFZA 5ELYA 3TTHA 2OB0A 3PGPA 4R8FA 1VHOA 1QSRA 4AG9A 2OZHA 4C2YA 4NJRA 2PIZA 4H89A 4NGPA 1M4IA 2CTCA 3EY5A 1MJBA 4R3LA 3RO0A 4P4FA 1MJ9A 5I0CA 4MI4A 3SIGA 2GU2A 4K3NA 3H8FA 2VL1A 3LD2A 3GYAA 4ZI6A 2ANPA 4P4JA 3VWDA 4DYOA 3ETIA 4XNHC 2C6PA 2EK8A 4J4ZA 1QSTA 1XF8A 3F5BA 5DWMA 4ZGYB 4ZYQA 4MFPA 2ZXVA 2FT0A 5KTCA 2VZYA 4MHPA 4P44A 3B3CA 3BHXA 2PJ0A 2BOAA 3BXMA 4NF1A 2JDDA 2Z3LA 2GLFA 2ZOGA 3DR6A 4OIDA 3OWCA 3WC6A 3D7DA 2BFQA 3FEDA 4X8IA 2GLJA 5CNPA 2CIJA 3S9NA 2VEZA 3IWEA 2FXKA 2L8RA 3B3WA 3B7IA 3WR7A 1IB1E 2V8DA 5G22A 2PJAA 3KHZA 3PB6X 4MY0A 1Z5RA 4UBRA 3H4QA 5AG6A 5LYDA 1DTDA 4I49A 2YGWA 3EKEA 4OADA 3GPOA 2JEWA 3QAYA 2Q51A 3DR8A 3CPXA 4OLLA 4B14A 1IGBA 4MBUA 3V45A 5D29A 2B3VA 2PJ1A 3F8KA 3IU1A 1ON0A 3BI0A 3IFEA 4QVTA 1L0CA 4NJQA 4C2XA 1N71A 2P6EA 4ZY2A 5THWA 4KSAA 4PXDA 3FVLA 4JZ0A 3S6HA 3ZJ0A 4CAFA 2V77A 2CXAA 4A39A 5CB5A 1S7NA 3FH4A 3CZXA 3IWWA 4ZY1A 3RAMA 4UWIA 1S5KA 1IU8A 4OC3A 3FB3A 1ELMP 4C68A 3S6FA 2Z11A 2J9AA 2LGRA 1I21A 3CXSA 2JBKA 2AJ6A 2KCWA 2FG1A 4XPKA 3EWQA 2VZZA 3DGVA 2X47A 3P2FA 3ZZIA 1R43A 1P4NA 2R1IA 2RB7A 4KZTA 4PK3A 3HLPA 4U9ZA 2EEEA 4CYNA 1XJOA 1PU9A 5JQ4A 2Q7BA 3NH5A 2JZDA 1RXTA 2FSRA 5FSXA 1YW4A 1Q2YA 4JXQA 3SIJA 2EK9A 4PQAA 4CYPA 4AB7A 2PR8A 3EWOA 4NXYA 2KQVA 2OZUA 4MFLA 2C27A 2JZFA 4JJXA 3JTKA 4P4BA 2I00A 4A30A 4BBHA 3GPGA 1DE4C 2I3CA 2J8MA 1PCAA 2AFCA 4FD5A 5HVHA 3IC1A 3H8GA 4JXRA 4M85A 5AG5A 3PZJA 2IMOA 4ETJA 2XEFA 4MFQA 2WPWA 1BO4A 3NE8A 3IGRA 4FUUA 4J5QA 3D2PA 1TY8A 2Z3OA 3SJXA 3B3SA 2AFSA 1ZG8A 1LCPA 4XPDC 3RNZA 3EWPA 4QUSA 5H84A 4OAEA 4AVBA 5G21A 4BMHA 1ARMA 1SQHA 1OBRA 4B5OA 5CBMA 4DJLA 4L89A 3A9LA 4A38A 1NMTA 5A27A 4DUKA 2PJCA 3BLNA 3CT9A 5HVGA 1Z8XA 2ZW7A 3LODA 1QSNA 2BO9A 3SI2A 5CB3A 2G9DA 4IF5A 3GLJA 4FWUA 4B11A 2W2GA 1VHSA 2PJ4A 4UFVA 1LAMA 3V8IA 4ORFA 2FVGA 2OOTA 3KQXA 2RFHA 3K9TA 4HKFA 1HJZA 2D4PA 3JUWA 6CPAA 5I4MA 3VFQA 2OR4A 2EO8A 2JLMA 1IICA 4U5YA 3KI9A 3FYNA 4B12A 4KLVA 2PJ8A 4JYWA 4K30A 3B3VA 3V38A 4A37A 3VWEA 3WABA 4KSFA 5IB0A 1R57A 2DX6A 1I12A 2PDOA 4EVYA 2REEA 4Q38A 3SHPA 4P45A 2Q43A 3S6KA 1YVOA 4UCPA 4ESSA 2HQYA 3W91A 4B10A 4F9UA 3IJ3A 4FD6A 4IAVA 3FECA 3K2KA 4F8ZA 4HPSA 2EUIA 4MFJA 4YRHA 1YGHA 3W6XA 3VATA 4QB9A 4C2ZA 2B4DB 2P6FA 5AILA 1TF9A 2B4BA 4PSXA 3G8WA 4W9YA 1VGYA 2DF5A 2FS5A 4CRYB 3KL9A 5FSUA 1CJWA 2OZGA 1Z8TA 1AUGA 2QECA 2YNDA 3D7GA 3TO7A 4NGTA 4JGKA 4TU0A 3TFYA 4HNXB 5HXDA 1MK4A 3IWGA 2B5GA 4AXVA 4ABKA 2A4NA 2GIVA 4LX9A 4UCMA 4MRIA 5LRGA 4A94A 3EO4A 3D8PA 4J5SA 3EW5A 1TKHA 1CPXA 1YK3A 3DNSA 3SXNA 3KQZA 1M1DA 2WPXA 2PJ2A 4MCQA 3D68A 4UIAA 4UEZA 1Z2LA 4OKOA 1RTQA 5AG4A 1WWZA 1J4JA 3UY5A 1FY7A 3IO1A 4CGMA 2Z10A 2CY2A 4OC0A 4R9MA 3IU2A 1Z8WA 2VBQA 2C6CA 2FXFA 2YNEA 1NSLA 2ZPAA 1YREA 4RS2A 2Z3MA 3S9LA 2C1CA 3PB7X 1K4JA 2HUZA 3ISZA 5CPAA 1CX8A 4KOSA 2Z3NA 8CPAA 2WYRA 3PB9X 3Q6ZA 4TNUA 5J8CA 5LRKA 2FIWA 2ZEPA 1H8LA 3TX8A 3D67A 3EWRA 4NGMA 1LOKA 1P0HA 4M6HA 4MHNA 2VQYA 4CGPA 5F46A 2AFOA 1TKFA 4AVAA 1KUXA 1PUAA 2PVWA 1HDQA 4GVVA 2B5GB 2VI7A 1CPSA 3D66A 3GUXA 4PSWA 3N5FA 1TIQA 2ACFA 5CMSA 2IL4A 2QIRA 3CXPA 4H6UA 2Q4VA 5G20A 5JPHA 2Z3PA 4ZBGA 4R76A 1YX0A 2Q4YA 4KOWA 1Z8LA 7CPAA 1YLEA 2AFMA 1YVKA 2YNCA 4Z65A 3KGQA 5F47A 4R6TA 1NSAA 1U6MA 1CM0A 1ZG9A 1LANA 4OIWA 3T9YA 4H2KA 4RI1A 1ZR5A 5K8OA 2CTBA 3KZWA 2JZEA 4LQGA 4PPZA 2ZW6A 3F0AA 4R57A 4KOXA 4A31A 4ETKA 4MHYA 4TWEA 5JH9A 1NJRA 2NYQA 4H6ZA 2P6GA 4GXHA 1M4LA 5BWAB 1IYKA 2GREA 5LYLA 4ONWA 4JLLA 4AG7A 1HDUA 3FRMA 1JQGA 1GYTA 4UWJA 1S60A 3B2YA 4P4IA
chains in the Genus database with same CATH topology
4J5RA 1YLOA 3FMCA 4OC5A 1ZG7A 2V8HA 3NFZA 1LAPA 1CBXA 1Y7EA 4YU9A 1XMBA 3LWUA 2V8VA 5HIHA 3V2BA 4NGNA 1Y0RA 2FAVA 1TF8A 2O53A 3S9MA 3JZTA 4P10A 4UMLA 3SJFA 2QVPA 1Y0YA 3B3TA 3BI1A 1FT7A 2NSMA 3PBBA 1AMPA 1BPMA 4OC4A 4IHMA 1FNOA 2VRIA 4D86A 3PFOA 4MCPA 3VARA 4G1PA 5K8NA 2PCUA 2Q4ZA 4OP4A 1TKJA 1SPVA 3MN8A 4OMEA 3D4UA 2PVVA 4IK2A 4EMEA 5D8NA 4R7MA 3NA6A 3GPQA 5FSZA 3SIHA 3WC7A 4RUHA 3D7HA 4BD9A 3NH4A 3IEHA 3KR5A 2POKA 4EFDA 5K8PA 2BFRA 2ZEOA 2QYVA 3Q71A 3KASA 1QMUA 4OC2A 4X2TA 4GM5A 3NH8A 1YMEA 2HB6A 3H8EA 2BCOA 3VH9A 2ZEFA 3RBUA 3DLJA 3L2NA 1XBUA 3TC8A 2CF4A 3B35A 4P4DA 2PIYA 3JRUA 1BPNA 4B6ZA 4FAIA 4KSIA 4ZX8A 4UF4A 3GB0A 5J1QA 2ZOFA 1UWYA 2XEGA 4NGRA 3WC5A 2DEAA 2ZEEA 3PFEA 4ZY0A 1YD9A 5E3BA 4X3RA 2QJ8A 5LYIA 4CPAA 2PJ6A 3SJGA 3T8WA 4ZX9A 3I1UA 2PJ7A 3SI1A 1F2PA 4UEEA 1ZR3A 3GQOA 5JGFA 1BLLE 3V7ZA 4FBEA 2PJ3A 5FSVA 3CDXA 3PB8X 2XEJA 5DUSA 4F9VA 5LRJA 2XD7A 3SIIA 4WWVA 3GQEA 1QQ9A 2IJZA 2WZNA 2ZELA 4JCAA 4PXBA 3MRUA 2AFZA 3PBEA 2F8HA 3FJUA 2ZEDA 2XEIA 1ELLP 3KR4A 2PRQA 4EWTA 4PXCA 4MHZA 2HC9A 3PB4X 3FF3A 3IIDA 2PE3A 5HOLA 1VIXA 4PXEA 5DS0A 1PYTB 2AFUA 4MCRA 1YSJA 2PJBA 2O4HA 2PJ5A 1YW6A 1ZLIA 2JBJA 3KHXA 3RZAA 3WT4A 4O23A 1CP6A 3FEEA 4P6YA 5HVFA 3EJFA 2V8GA 2ZEHA 3FX6A 3LMSA 3IIFA 4KYBA 1XRYA 1VHUA 3PRTA 1ARLA 4OC1A 1KWMA 1LFWA 1TXRA 3SI0A 3SJEA 2EWBA 2ZENA 3IIBA 4MXUA 1TXZA 1EE3P 1BAVA 2IQ6A 5F09A 1F2OA 1AYEA 5FSYA 4UIBA 3HUVA 4MCSA 2AFXA 5JM6A 3EJGA 4YWYA 4ABLA 3D7FA 1Q7LA 1XFOA 1F57A 1R3NA 2C6GA 4GVWA 3QNVA 2ZEMA 1HEEA 4IQYA 4NGQA 1VHEA 4Q7AA 1CG2A 3PEIA 2AFWA 4K0CA 3ISXA 5LYFA 4GUAA 4P4EA 4UEFA 4MMOA 5IB9A 4WJBA 5K8MA 3CPAA 4JVVA 2PJ9A 2ZEGA 1CP7A 2F7VA 4NFRA 1ZLHA 2ABZA 4NGSA 1IY7A 5ELYA 4R8FA 1VHOA 4NJRA 2PIZA 4NGPA 2CTCA 4P4FA 3SIGA 2GU2A 4K3NA 3H8FA 2VL1A 4ZI6A 2ANPA 4P4JA 4DYOA 3ETIA 2C6PA 2EK8A 4J4ZA 4ZYQA 4MHPA 4P44A 3B3CA 3BHXA 2PJ0A 2BOAA 3BXMA 3WC6A 2ZOGA 2GLFA 4OIDA 3D7DA 2BFQA 3FEDA 4X8IA 2GLJA 2CIJA 3S9NA 2FXKA 2L8RA 3B3WA 3B7IA 2V8DA 2PJAA 3KHZA 3PB6X 1Z5RA 5LYDA 1DTDA 3EKEA 3GPOA 2JEWA 2Q51A 3CPXA 1IGBA 3V45A 5D29A 2PJ1A 3BI0A 3IFEA 4NJQA 4ZY2A 5THWA 4PXDA 3FVLA 4JZ0A 2V77A 4A39A 5CB5A 3FH4A 3IWWA 4ZY1A 3RAMA 4OC3A 1ELMP 2J9AA 2LGRA 2JBKA 2FG1A 3EWQA 3DGVA 2X47A 1R43A 2RB7A 3HLPA 2EEEA 1XJOA 3NH5A 5FSXA 1YW4A 4PQAA 3SIJA 2EK9A 3EWOA 4P4BA 3GPGA 1DE4C 2I3CA 5HVHA 1PCAA 2AFCA 3IC1A 3H8GA 2IMOA 4ETJA 2XEFA 4FUUA 4J5QA 1TY8A 3SJXA 3B3SA 2AFSA 1ZG8A 1LCPA 3EWPA 1ARMA 1OBRA 5CBMA 4DJLA 4A38A 4DUKA 2PJCA 3CT9A 5HVGA 2BO9A 3SI2A 5CB3A 2G9DA 3GLJA 4FWUA 2PJ4A 1LAMA 2FVGA 2OOTA 3KQXA 2RFHA 3K9TA 6CPAA 1HJZA 5I4MA 3VFQA 2OR4A 3KI9A 4JYWA 2PJ8A 3B3VA 3V38A 4A37A 3WABA 2DX6A 4P45A 2Q43A 4ESSA 4F9UA 3IJ3A 4IAVA 3FECA 3K2KA 4F8ZA 3VATA 4W9YA 5AILA 1TF9A 1VGYA 3KL9A 5FSUA 3D7GA 4NGTA 4JGKA 4TU0A 5HXDA 4AXVA 4ABKA 4MRIA 5LRGA 4A94A 4J5SA 3EW5A 1TKHA 1CPXA 3KQZA 4MCQA 4UIAA 2PJ2A 3D68A 4UEZA 1Z2LA 4OKOA 1RTQA 3IO1A 4OC0A 2C6CA 3S9LA 2C1CA 3PB7X 3ISZA 5CPAA 1CX8A 8CPAA 2WYRA 3PB9X 3Q6ZA 4TNUA 5LRKA 2ZEPA 1H8LA 3TX8A 3D67A 3EWRA 4NGMA 1LOKA 4MHNA 2AFOA 1TKFA 2PVWA 1HDQA 4GVVA 1CPSA 3D66A 3GUXA 3N5FA 2ACFA 5CMSA 4R76A 1Z8LA 7CPAA 2AFMA 4Z65A 3KGQA 4R6TA 1NSAA 1ZG9A 1LANA 4OIWA 4H2KA 5K8OA 1ZR5A 2CTBA 3KZWA 4LQGA 4PPZA 4ETKA 4MHYA 4TWEA 5JH9A 1NJRA 2NYQA 1M4LA 2GREA 5LYLA 4ONWA 4JLLA 1HDUA 1JQGA 1GYTA 3B2YA 4P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5R A;  1YLO A;  3FMC A;  4OC5 A;  1ZG7 A;  2V8H A;  3NFZ A;  1LAP A;  1CBX A;  1Y7E A;  4YU9 A;  1XMB A;  3LWU A;  2V8V A;  5HIH A;  3V2B A;  4NGN A;  1Y0R A;  2FAV A;  1TF8 A;  2O53 A;  3S9M A;  3JZT A;  4P10 A;  4UML A;  3SJF A;  2QVP A;  1Y0Y A;  3B3T A;  3BI1 A;  1FT7 A;  2NSM A;  3PBB A;  1AMP A;  1BPM A;  4OC4 A;  4IHM A;  1FNO A;  2VRI A;  4D86 A;  3PFO A;  4MCP A;  3VAR A;  4G1P A;  5K8N A;  2PCU A;  2Q4Z A;  4OP4 A;  1TKJ A;  1SPV A;  3MN8 A;  4OME A;  3D4U A;  2PVV A;  4IK2 A;  4EME A;  5D8N A;  4R7M A;  3NA6 A;  3GPQ A;  5FSZ A;  3SIH A;  3WC7 A;  4RUH A;  3D7H A;  4BD9 A;  3NH4 A;  3IEH A;  3KR5 A;  2POK A;  4EFD A;  5K8P A;  2BFR A;  2ZEO A;  2QYV A;  3Q71 A;  3KAS A;  1QMU A;  4OC2 A;  4X2T A;  4GM5 A;  3NH8 A;  1YME A;  2HB6 A;  3H8E A;  2BCO A;  3VH9 A;  2ZEF A;  3RBU A;  3DLJ A;  3L2N A;  1XBU A;  3TC8 A;  2CF4 A;  3B35 A;  4P4D A;  2PIY A;  3JRU A;  1BPN A;  4B6Z A;  4FAI A;  4KSI A;  4ZX8 A;  4UF4 A;  3GB0 A;  5J1Q A;  2ZOF A;  1UWY A;  2XEG A;  4NGR A;  3WC5 A;  2DEA A;  2ZEE A;  3PFE A;  4ZY0 A;  1YD9 A;  5E3B A;  4X3R A;  2QJ8 A;  5LYI A;  4CPA A;  2PJ6 A;  3SJG A;  3T8W A;  4ZX9 A;  3I1U A;  2PJ7 A;  3SI1 A;  1F2P A;  4UEE A;  1ZR3 A;  3GQO A;  5JGF A;  1BLL E;  3V7Z A;  4FBE A;  2PJ3 A;  5FSV A;  3CDX A;  3PB8 X;  2XEJ A;  5DUS A;  4F9V A;  5LRJ A;  2XD7 A;  3SII A;  4WWV A;  3GQE A;  1QQ9 A;  2IJZ A;  2WZN A;  2ZEL A;  4JCA A;  4PXB A;  3MRU A;  2AFZ A;  3PBE A;  2F8H A;  3FJU A;  2ZED A;  2XEI A;  1ELL P;  3KR4 A;  2PRQ A;  4EWT A;  4PXC A;  4MHZ A;  2HC9 A;  3PB4 X;  3FF3 A;  3IID A;  2PE3 A;  5HOL A;  1VIX A;  4PXE A;  5DS0 A;  1PYT B;  2AFU A;  4MCR A;  1YSJ A;  2PJB A;  2O4H A;  2PJ5 A;  1YW6 A;  1ZLI A;  2JBJ A;  3KHX A;  3RZA A;  3WT4 A;  4O23 A;  1CP6 A;  3FEE A;  4P6Y A;  5HVF A;  3EJF A;  2V8G A;  2ZEH A;  3FX6 A;  3LMS A;  3IIF A;  4KYB A;  1XRY A;  1VHU A;  3PRT A;  1ARL A;  4OC1 A;  1KWM A;  1LFW A;  1TXR A;  3SI0 A;  3SJE A;  2EWB A;  2ZEN A;  3IIB A;  4MXU A;  1TXZ A;  1EE3 P;  1BAV A;  2IQ6 A;  5F09 A;  1F2O A;  1AYE A;  5FSY A;  4UIB A;  3HUV A;  4MCS A;  2AFX A;  5JM6 A;  3EJG A;  4YWY A;  4ABL A;  3D7F A;  1Q7L A;  1XFO A;  1F57 A;  1R3N A;  2C6G A;  4GVW A;  3QNV A;  2ZEM A;  1HEE A;  4IQY A;  4NGQ A;  1VHE A;  4Q7A A;  1CG2 A;  3PEI A;  2AFW A;  4K0C A;  3ISX A;  5LYF A;  4GUA A;  4P4E A;  4UEF A;  4MMO A;  5IB9 A;  4WJB A;  5K8M A;  3CPA A;  4JVV A;  2PJ9 A;  2ZEG A;  1CP7 A;  2F7V A;  4NFR A;  1ZLH A;  2ABZ A;  4NGS A;  1IY7 A;  5ELY A;  4R8F A;  1VHO A;  4NJR A;  2PIZ A;  4NGP A;  2CTC A;  4P4F A;  3SIG A;  2GU2 A;  4K3N A;  3H8F A;  2VL1 A;  4ZI6 A;  2ANP A;  4P4J A;  4DYO A;  3ETI A;  2C6P A;  2EK8 A;  4J4Z A;  4ZYQ A;  4MHP A;  4P44 A;  3B3C A;  3BHX A;  2PJ0 A;  2BOA A;  3BXM A;  3WC6 A;  2ZOG A;  2GLF A;  4OID A;  3D7D A;  2BFQ A;  3FED A;  4X8I A;  2GLJ A;  2CIJ A;  3S9N A;  2FXK A;  2L8R A;  3B3W A;  3B7I A;  2V8D A;  2PJA A;  3KHZ A;  3PB6 X;  1Z5R A;  5LYD A;  1DTD A;  3EKE A;  3GPO A;  2JEW A;  2Q51 A;  3CPX A;  1IGB A;  3V45 A;  5D29 A;  2PJ1 A;  3BI0 A;  3IFE A;  4NJQ A;  4ZY2 A;  5THW A;  4PXD A;  3FVL A;  4JZ0 A;  2V77 A;  4A39 A;  5CB5 A;  3FH4 A;  3IWW A;  4ZY1 A;  3RAM A;  4OC3 A;  1ELM P;  2J9A A;  2LGR A;  2JBK A;  2FG1 A;  3EWQ A;  3DGV A;  2X47 A;  1R43 A;  2RB7 A;  3HLP A;  2EEE A;  1XJO A;  3NH5 A;  5FSX A;  1YW4 A;  4PQA A;  3SIJ A;  2EK9 A;  3EWO A;  4P4B A;  3GPG A;  1DE4 C;  2I3C A;  5HVH A;  1PCA A;  2AFC A;  3IC1 A;  3H8G A;  2IMO A;  4ETJ A;  2XEF A;  4FUU A;  4J5Q A;  1TY8 A;  3SJX A;  3B3S A;  2AFS A;  1ZG8 A;  1LCP A;  3EWP A;  1ARM A;  1OBR A;  5CBM A;  4DJL A;  4A38 A;  4DUK A;  2PJC A;  3CT9 A;  5HVG A;  2BO9 A;  3SI2 A;  5CB3 A;  2G9D A;  3GLJ A;  4FWU A;  2PJ4 A;  1LAM A;  2FVG A;  2OOT A;  3KQX A;  2RFH A;  3K9T A;  6CPA A;  1HJZ A;  5I4M A;  3VFQ A;  2OR4 A;  3KI9 A;  4JYW A;  2PJ8 A;  3B3V A;  3V38 A;  4A37 A;  3WAB A;  2DX6 A;  4P45 A;  2Q43 A;  4ESS A;  4F9U A;  3IJ3 A;  4IAV A;  3FEC A;  3K2K A;  4F8Z A;  3VAT A;  4W9Y A;  5AIL A;  1TF9 A;  1VGY A;  3KL9 A;  5FSU A;  3D7G A;  4NGT A;  4JGK A;  4TU0 A;  5HXD A;  4AXV A;  4ABK A;  4MRI A;  5LRG A;  4A94 A;  4J5S A;  3EW5 A;  1TKH A;  1CPX A;  3KQZ A;  4MCQ A;  4UIA A;  2PJ2 A;  3D68 A;  4UEZ A;  1Z2L A;  4OKO A;  1RTQ A;  3IO1 A;  4OC0 A;  2C6C A;  3S9L A;  2C1C A;  3PB7 X;  3ISZ A;  5CPA A;  1CX8 A;  8CPA A;  2WYR A;  3PB9 X;  3Q6Z A;  4TNU A;  5LRK A;  2ZEP A;  1H8L A;  3TX8 A;  3D67 A;  3EWR A;  4NGM A;  1LOK A;  4MHN A;  2AFO A;  1TKF A;  2PVW A;  1HDQ A;  4GVV A;  1CPS A;  3D66 A;  3GUX A;  3N5F A;  2ACF A;  5CMS A;  4R76 A;  1Z8L A;  7CPA A;  2AFM A;  4Z65 A;  3KGQ A;  4R6T A;  1NSA A;  1ZG9 A;  1LAN A;  4OIW A;  4H2K A;  5K8O A;  1ZR5 A;  2CTB A;  3KZW A;  4LQG A;  4PPZ A;  4ETK A;  4MHY A;  4TWE A;  5JH9 A;  1NJR A;  2NYQ A;  1M4L A;  2GRE A;  5LYL A;  4ONW A;  4JLL A;  1HDU A;  1JQG A;  1GYT A;  3B2Y A;  4P4I A; 
#chains in the Genus database with same CATH topology
 4J5R A;  1YLO A;  2Y0M A;  3BJ7 A;  3BJ8 A;  1NE9 A;  1ZG7 A;  3FMC A;  2V8H A;  3NFZ A;  4KS9 A;  1LAP A;  4OC5 A;  1CBX A;  1WK4 A;  1Y7E A;  1Z9U A;  4YU9 A;  4J3G A;  1XMB A;  3LWU A;  2JEV A;  2V8V A;  3GY9 A;  1X10 A;  2EBJ A;  2J8R A;  1OZP A;  5C88 A;  5HIH A;  2RC4 A;  3V2B A;  4M6I A;  4KOR A;  4NGN A;  1Y0R A;  2FAV A;  1TF8 A;  2O53 A;  2ATR A;  4MHD A;  4MY3 A;  3S9M A;  3TO6 A;  1YR0 A;  3JZT A;  1QSO A;  4P10 A;  2BSW A;  2Z3K A;  4NCZ A;  5DWN A;  4UML A;  3PP9 A;  3SJF A;  5AG7 A;  4CAX A;  2QVP A;  1Y0Y A;  5AGE A;  3B3T A;  2HV2 A;  5J8F A;  3BI1 A;  1FT7 A;  5EBV A;  2P0W A;  4IUS A;  2NSM A;  3PBB A;  3JVN A;  1AMP A;  4KVM E;  4Q36 A;  1BPM A;  4RN7 A;  4A33 A;  3TE4 A;  3TO9 A;  4OC4 A;  5IX3 A;  1Z4R A;  4IHM A;  3FNC A;  1FNO A;  3CXQ A;  3QAH A;  4ONU A;  2VRI A;  3R96 A;  4D86 A;  3PFO A;  4MCP A;  4UFW A;  3VAR A;  4A2Z A;  5HMN A;  2FIA A;  3W6S A;  2R7H A;  4QC6 A;  4CGO A;  4JD6 A;  4G1P A;  3SXO A;  5K8N A;  2PCU A;  1IYL A;  2NMT A;  2Q4Z A;  4OP4 A;  1TKJ A;  1SPV A;  3MN8 A;  4OME A;  4R87 A;  3R9E A;  4E0A A;  5A28 A;  1ZO0 A;  2PVV A;  3D4U A;  4IK2 A;  4II9 A;  4EME A;  2B58 A;  5D8N A;  3EC4 A;  3R1K A;  4R7M A;  1Y7R A;  3GPQ A;  5FSZ A;  3NA6 A;  4JLY A;  3SIH A;  1MJA A;  3WC7 A;  4RUH A;  2X7B A;  3D7H A;  3R9F A;  1A2Z A;  3EFA A;  2Q0Y A;  3LAC A;  3NH4 A;  2DPT A;  4BD9 A;  3IEH A;  1X12 A;  1VKC A;  3KR5 A;  2POK A;  5C82 A;  4EFD A;  5K8P A;  2BFR A;  2ZEO A;  2QYV A;  4NEX A;  3KKW A;  3Q71 A;  1LRZ A;  4KVO E;  3KAS A;  3S6G A;  4LQ6 A;  1QMU A;  4YFJ A;  4OC2 A;  4X2T A;  4GM5 A;  1M4D A;  3NH8 A;  1YME A;  3GKR A;  2Q44 A;  2HB6 A;  2YNC C;  3H8E A;  2BCO A;  3H5Z A;  4KOV A;  1S7L A;  1XE4 A;  4FD4 A;  3VH9 A;  2ZEF A;  3RBU A;  5E96 A;  1V0C A;  3DLJ A;  3L2N A;  1IOI A;  1XBU A;  1M4G A;  2OU2 A;  3TC8 A;  2CF4 A;  1XEB A;  3B35 A;  1Y9K A;  2ZW5 A;  4P4D A;  2PIY A;  2G3A A;  3JRU A;  2QML A;  1BPN A;  4Y49 B;  3C26 A;  4B6Z A;  1Q2C A;  4CAV A;  4FAI A;  3D3S A;  4KSI A;  3G3S A;  5ISV A;  5F49 A;  4ZX8 A;  2BL1 A;  4HNY B;  4UF4 A;  3I3G A;  2B3U A;  3GB0 A;  4CAE A;  5J1Q A;  2Q7S A;  2VXK A;  4B13 A;  2ZOF A;  4F6A A;  5F48 A;  1UWY A;  2XEG A;  3NE7 A;  4NGR A;  3WC5 A;  4BIN A;  2DEA A;  2ZEE A;  5H86 A;  3D2M A;  3PFE A;  4KOY A;  1XIX A;  4ZY0 A;  1RO5 A;  1YD9 A;  4GS4 A;  3DSB A;  5E3B A;  4X3R A;  4CYQ A;  2QJ8 A;  4UFX A;  4UA3 A;  1IID A;  3DDD A;  3TOA A;  5KTD A;  5LYI A;  2GE3 A;  2O28 A;  2PRB A;  4CPA A;  3K9U A;  4HNW B;  1UFH A;  4CAW A;  5IV0 A;  2I79 A;  2PJ6 A;  3N7Z A;  3SJG A;  2BUE A;  4QBJ A;  3T8W A;  4ZX9 A;  4KUA A;  2PC1 A;  3I1U A;  2PJ7 A;  3SI1 A;  1F2P A;  4KOT A;  4UEE A;  1ZR3 A;  3GQO A;  5JGF A;  1BLL E;  4FD7 A;  2PSW A;  4XPD B;  2FL4 A;  3V7Z A;  4FBE A;  4B5P B;  2PJ3 A;  5FSV A;  3CDX A;  1IOF A;  3PB8 X;  2ODF A;  2XEJ A;  4UCN A;  1GHE A;  5DUS A;  4F9V A;  5LRJ A;  2XD7 A;  3SII A;  4WWV A;  3GQE A;  1QQ9 A;  2IJZ A;  2WZN A;  4MJ8 A;  2DXQ A;  2CNT A;  2AE6 A;  4JCA A;  2ZEL A;  2B4D A;  4PXB A;  3R95 A;  3RYO A;  4E8O A;  3MRU A;  4M3S A;  3R9G A;  2AFZ A;  3PBE A;  2F8H A;  3FJU A;  2ZED A;  3MGD A;  4CGN A;  4C7H A;  4E2A A;  2K5T A;  1ELL P;  3KR4 A;  2G3T A;  2PRQ A;  2REF A;  1M44 A;  2XEI A;  3FXT A;  4B5P A;  4EWT A;  4PXC A;  2ARH A;  4MHZ A;  5GCN A;  2HC9 A;  3PB4 X;  4A95 A;  3FF3 A;  3IID A;  2PE3 A;  4KUB A;  2JDC A;  2WSA A;  5HOL A;  1VIX A;  2BEI A;  4PXE A;  2Q04 A;  5DS0 A;  2CNM A;  1PYT B;  2AFU A;  4MCR A;  2OH1 A;  1XOV A;  1KUV A;  2EVN A;  1YSJ A;  2PJB A;  2O4H A;  1XMT A;  2J8N A;  4KLW A;  2PJ5 A;  1YW6 A;  1ZLI A;  5EMI A;  2JBJ A;  2GFQ A;  5KTA A;  2F5I A;  3KHX A;  4XPL A;  3RZA A;  3WT4 A;  4O23 A;  2R98 A;  2CNS A;  1CP6 A;  3FEE A;  2H5M A;  2FE7 A;  5FVJ A;  4P6Y A;  5HVF A;  3GIU A;  2WCT A;  3EJF A;  4U9Y A;  1S3Z A;  2V8G A;  2ZEH A;  1Z4E A;  3FX6 A;  3LMS A;  4MFK A;  4A32 A;  4C7I A;  4XNH B;  1Q2D A;  4M6G A;  3B8G A;  3IIF A;  3I9S A;  4KYB A;  1XRY A;  2DPS A;  3FBU A;  1VHU A;  2Z0Z A;  1ARL A;  2PR1 A;  2GAN A;  3PRT A;  2FCK A;  1B87 A;  3FIX A;  1KUY A;  4OC1 A;  4R3K A;  1KWM A;  1BOB A;  1LFW A;  1TXR A;  3SI0 A;  3SJE A;  2EWB A;  4CS0 B;  1Y9W A;  5HH1 A;  2ZEN A;  3IIB A;  4MXU A;  1TXZ A;  1EE3 P;  4PK2 A;  1BAV A;  2IQ6 A;  2R8V A;  1F2O A;  3TT2 A;  5F09 A;  1AYE A;  5FSY A;  5G1Z A;  2G0B A;  4KOU A;  3T90 A;  2D4O A;  2ZW4 A;  4UIB A;  3HUV A;  2PQ8 A;  4MCS A;  2AFX A;  4CRZ B;  5JM6 A;  3EJG A;  4YWY A;  4ABL A;  4CGL A;  3D7F A;  4F0Y A;  4CYO A;  1S7K A;  1Q7L A;  3QB8 A;  2RNK A;  4KVX A;  4DNC A;  1XFO A;  1F57 A;  1R3N A;  4X5K A;  3TOB A;  2C6G A;  4Y49 C;  4F0X A;  4GVW A;  3TCV A;  3QNV A;  2ZEM A;  1HEE A;  1S7F A;  4NSQ A;  1QSM A;  4IQY A;  4YGO A;  1KZF A;  4NGQ A;  5EC4 A;  1VHE A;  3EXN A;  4JWP A;  4L8A A;  4Q7A A;  1CG2 A;  3PEI A;  2AFW A;  4K0C A;  2WUU A;  3ISX A;  5LYF A;  4GUA A;  4P4E A;  4UEF A;  4MMO A;  4AVC A;  1JWQ A;  5IB9 A;  4WJB A;  1B6B A;  3P2H A;  5K8M A;  1I1D A;  4JVV A;  2PJ9 A;  3CPA A;  2ZEG A;  1CP7 A;  2F7V A;  4LUA A;  4NFR A;  3E0K A;  4PV6 A;  1ZLH A;  2ABZ A;  4NGS A;  1IY7 A;  1YQE A;  4MFZ A;  5ELY A;  3TTH A;  2OB0 A;  3PGP A;  4R8F A;  1VHO A;  1QSR A;  4AG9 A;  2OZH A;  4C2Y A;  4NJR A;  2PIZ A;  4H89 A;  4NGP A;  1M4I A;  2CTC A;  3EY5 A;  1MJB A;  4R3L A;  3RO0 A;  4P4F A;  1MJ9 A;  5I0C A;  4MI4 A;  3SIG A;  2GU2 A;  4K3N A;  3H8F A;  2VL1 A;  3LD2 A;  3GYA A;  4ZI6 A;  2ANP A;  4P4J A;  3VWD A;  4DYO A;  3ETI A;  4XNH C;  2C6P A;  2EK8 A;  4J4Z A;  1QST A;  1XF8 A;  3F5B A;  5DWM A;  4ZGY B;  4ZYQ A;  4MFP A;  2ZXV A;  2FT0 A;  5KTC A;  2VZY A;  4MHP A;  4P44 A;  3B3C A;  3BHX A;  2PJ0 A;  2BOA A;  3BXM A;  4NF1 A;  2JDD A;  2Z3L A;  2GLF A;  2ZOG A;  3DR6 A;  4OID A;  3OWC A;  3WC6 A;  3D7D A;  2BFQ A;  3FED A;  4X8I A;  2GLJ A;  5CNP A;  2CIJ A;  3S9N A;  2VEZ A;  3IWE A;  2FXK A;  2L8R A;  3B3W A;  3B7I A;  3WR7 A;  1IB1 E;  2V8D A;  5G22 A;  2PJA A;  3KHZ A;  3PB6 X;  4MY0 A;  1Z5R A;  4UBR A;  3H4Q A;  5AG6 A;  5LYD A;  1DTD A;  4I49 A;  2YGW A;  3EKE A;  4OAD A;  3GPO A;  2JEW A;  3QAY A;  2Q51 A;  3DR8 A;  3CPX A;  4OLL A;  4B14 A;  1IGB A;  4MBU A;  3V45 A;  5D29 A;  2B3V A;  2PJ1 A;  3F8K A;  3IU1 A;  1ON0 A;  3BI0 A;  3IFE A;  4QVT A;  1L0C A;  4NJQ A;  4C2X A;  1N71 A;  2P6E A;  4ZY2 A;  5THW A;  4KSA A;  4PXD A;  3FVL A;  4JZ0 A;  3S6H A;  3ZJ0 A;  4CAF A;  2V77 A;  2CXA A;  4A39 A;  5CB5 A;  1S7N A;  3FH4 A;  3CZX A;  3IWW A;  4ZY1 A;  3RAM A;  4UWI A;  1S5K A;  1IU8 A;  4OC3 A;  3FB3 A;  1ELM P;  4C68 A;  3S6F A;  2Z11 A;  2J9A A;  2LGR A;  1I21 A;  3CXS A;  2JBK A;  2AJ6 A;  2KCW A;  2FG1 A;  4XPK A;  3EWQ A;  2VZZ A;  3DGV A;  2X47 A;  3P2F A;  3ZZI A;  1R43 A;  1P4N A;  2R1I A;  2RB7 A;  4KZT A;  4PK3 A;  3HLP A;  4U9Z A;  2EEE A;  4CYN A;  1XJO A;  1PU9 A;  5JQ4 A;  2Q7B A;  3NH5 A;  2JZD A;  1RXT A;  2FSR A;  5FSX A;  1YW4 A;  1Q2Y A;  4JXQ A;  3SIJ A;  2EK9 A;  4PQA A;  4CYP A;  4AB7 A;  2PR8 A;  3EWO A;  4NXY A;  2KQV A;  2OZU A;  4MFL A;  2C27 A;  2JZF A;  4JJX A;  3JTK A;  4P4B A;  2I00 A;  4A30 A;  4BBH A;  3GPG A;  1DE4 C;  2I3C A;  2J8M A;  1PCA A;  2AFC A;  4FD5 A;  5HVH A;  3IC1 A;  3H8G A;  4JXR A;  4M85 A;  5AG5 A;  3PZJ A;  2IMO A;  4ETJ A;  2XEF A;  4MFQ A;  2WPW A;  1BO4 A;  3NE8 A;  3IGR A;  4FUU A;  4J5Q A;  3D2P A;  1TY8 A;  2Z3O A;  3SJX A;  3B3S A;  2AFS A;  1ZG8 A;  1LCP A;  4XPD C;  3RNZ A;  3EWP A;  4QUS A;  5H84 A;  4OAE A;  4AVB A;  5G21 A;  4BMH A;  1ARM A;  1SQH A;  1OBR A;  4B5O A;  5CBM A;  4DJL A;  4L89 A;  3A9L A;  4A38 A;  1NMT A;  5A27 A;  4DUK A;  2PJC A;  3BLN A;  3CT9 A;  5HVG A;  1Z8X A;  2ZW7 A;  3LOD A;  1QSN A;  2BO9 A;  3SI2 A;  5CB3 A;  2G9D A;  4IF5 A;  3GLJ A;  4FWU A;  4B11 A;  2W2G A;  1VHS A;  2PJ4 A;  4UFV A;  1LAM A;  3V8I A;  4ORF A;  2FVG A;  2OOT A;  3KQX A;  2RFH A;  3K9T A;  4HKF A;  1HJZ A;  2D4P A;  3JUW A;  6CPA A;  5I4M A;  3VFQ A;  2OR4 A;  2EO8 A;  2JLM A;  1IIC A;  4U5Y A;  3KI9 A;  3FYN A;  4B12 A;  4KLV A;  2PJ8 A;  4JYW A;  4K30 A;  3B3V A;  3V38 A;  4A37 A;  3VWE A;  3WAB A;  4KSF A;  5IB0 A;  1R57 A;  2DX6 A;  1I12 A;  2PDO A;  4EVY A;  2REE A;  4Q38 A;  3SHP A;  4P45 A;  2Q43 A;  3S6K A;  1YVO A;  4UCP A;  4ESS A;  2HQY A;  3W91 A;  4B10 A;  4F9U A;  3IJ3 A;  4FD6 A;  4IAV A;  3FEC A;  3K2K A;  4F8Z A;  4HPS A;  2EUI A;  4MFJ A;  4YRH A;  1YGH A;  3W6X A;  3VAT A;  4QB9 A;  4C2Z A;  2B4D B;  2P6F A;  5AIL A;  1TF9 A;  2B4B A;  4PSX A;  3G8W A;  4W9Y A;  1VGY A;  2DF5 A;  2FS5 A;  4CRY B;  3KL9 A;  5FSU A;  1CJW A;  2OZG A;  1Z8T A;  1AUG A;  2QEC A;  2YND A;  3D7G A;  3TO7 A;  4NGT A;  4JGK A;  4TU0 A;  3TFY A;  4HNX B;  5HXD A;  1MK4 A;  3IWG A;  2B5G A;  4AXV A;  4ABK A;  2A4N A;  2GIV A;  4LX9 A;  4UCM A;  4MRI A;  5LRG A;  4A94 A;  3EO4 A;  3D8P A;  4J5S A;  3EW5 A;  1TKH A;  1CPX A;  1YK3 A;  3DNS A;  3SXN A;  3KQZ A;  1M1D A;  2WPX A;  2PJ2 A;  4MCQ A;  3D68 A;  4UIA A;  4UEZ A;  1Z2L A;  4OKO A;  1RTQ A;  5AG4 A;  1WWZ A;  1J4J A;  3UY5 A;  1FY7 A;  3IO1 A;  4CGM A;  2Z10 A;  2CY2 A;  4OC0 A;  4R9M A;  3IU2 A;  1Z8W A;  2VBQ A;  2C6C A;  2FXF A;  2YNE A;  1NSL A;  2ZPA A;  1YRE A;  4RS2 A;  2Z3M A;  3S9L A;  2C1C A;  3PB7 X;  1K4J A;  2HUZ A;  3ISZ A;  5CPA A;  1CX8 A;  4KOS A;  2Z3N A;  8CPA A;  2WYR A;  3PB9 X;  3Q6Z A;  4TNU A;  5J8C A;  5LRK A;  2FIW A;  2ZEP A;  1H8L A;  3TX8 A;  3D67 A;  3EWR A;  4NGM A;  1LOK A;  1P0H A;  4M6H A;  4MHN A;  2VQY A;  4CGP A;  5F46 A;  2AFO A;  1TKF A;  4AVA A;  1KUX A;  1PUA A;  2PVW A;  1HDQ A;  4GVV A;  2B5G B;  2VI7 A;  1CPS A;  3D66 A;  3GUX A;  4PSW A;  3N5F A;  1TIQ A;  2ACF A;  5CMS A;  2IL4 A;  2QIR A;  3CXP A;  4H6U A;  2Q4V A;  5G20 A;  5JPH A;  2Z3P A;  4ZBG A;  4R76 A;  1YX0 A;  2Q4Y A;  4KOW A;  1Z8L A;  7CPA A;  1YLE A;  2AFM A;  1YVK A;  2YNC A;  4Z65 A;  3KGQ A;  5F47 A;  4R6T A;  1NSA A;  1U6M A;  1CM0 A;  1ZG9 A;  1LAN A;  4OIW A;  3T9Y A;  4H2K A;  4RI1 A;  1ZR5 A;  5K8O A;  2CTB A;  3KZW A;  2JZE A;  4LQG A;  4PPZ A;  2ZW6 A;  3F0A A;  4R57 A;  4KOX A;  4A31 A;  4ETK A;  4MHY A;  4TWE A;  5JH9 A;  1NJR A;  2NYQ A;  4H6Z A;  2P6G A;  4GXH A;  1M4L A;  5BWA B;  1IYK A;  2GRE A;  5LYL A;  4ONW A;  4JLL A;  4AG7 A;  1HDU A;  3FRM A;  1JQG A;  1GYT A;  4UWJ A;  1S60 A;  3B2Y A;  4P4I A; 
#chains in the Genus database with same CATH homology
 4J5R A;  1YLO A;  3FMC A;  4OC5 A;  1ZG7 A;  2V8H A;  3NFZ A;  1LAP A;  1CBX A;  1Y7E A;  4YU9 A;  1XMB A;  3LWU A;  2V8V A;  5HIH A;  3V2B A;  4NGN A;  1Y0R A;  2FAV A;  1TF8 A;  2O53 A;  3S9M A;  3JZT A;  4P10 A;  4UML A;  3SJF A;  2QVP A;  1Y0Y A;  3B3T A;  3BI1 A;  1FT7 A;  2NSM A;  3PBB A;  1AMP A;  1BPM A;  4OC4 A;  4IHM A;  1FNO A;  2VRI A;  4D86 A;  3PFO A;  4MCP A;  3VAR A;  4G1P A;  5K8N A;  2PCU A;  2Q4Z A;  4OP4 A;  1TKJ A;  1SPV A;  3MN8 A;  4OME A;  3D4U A;  2PVV A;  4IK2 A;  4EME A;  5D8N A;  4R7M A;  3NA6 A;  3GPQ A;  5FSZ A;  3SIH A;  3WC7 A;  4RUH A;  3D7H A;  4BD9 A;  3NH4 A;  3IEH A;  3KR5 A;  2POK A;  4EFD A;  5K8P A;  2BFR A;  2ZEO A;  2QYV A;  3Q71 A;  3KAS A;  1QMU A;  4OC2 A;  4X2T A;  4GM5 A;  3NH8 A;  1YME A;  2HB6 A;  3H8E A;  2BCO A;  3VH9 A;  2ZEF A;  3RBU A;  3DLJ A;  3L2N A;  1XBU A;  3TC8 A;  2CF4 A;  3B35 A;  4P4D A;  2PIY A;  3JRU A;  1BPN A;  4B6Z A;  4FAI A;  4KSI A;  4ZX8 A;  4UF4 A;  3GB0 A;  5J1Q A;  2ZOF A;  1UWY A;  2XEG A;  4NGR A;  3WC5 A;  2DEA A;  2ZEE A;  3PFE A;  4ZY0 A;  1YD9 A;  5E3B A;  4X3R A;  2QJ8 A;  5LYI A;  4CPA A;  2PJ6 A;  3SJG A;  3T8W A;  4ZX9 A;  3I1U A;  2PJ7 A;  3SI1 A;  1F2P A;  4UEE A;  1ZR3 A;  3GQO A;  5JGF A;  1BLL E;  3V7Z A;  4FBE A;  2PJ3 A;  5FSV A;  3CDX A;  3PB8 X;  2XEJ A;  5DUS A;  4F9V A;  5LRJ A;  2XD7 A;  3SII A;  4WWV A;  3GQE A;  1QQ9 A;  2IJZ A;  2WZN A;  2ZEL A;  4JCA A;  4PXB A;  3MRU A;  2AFZ A;  3PBE A;  2F8H A;  3FJU A;  2ZED A;  2XEI A;  1ELL P;  3KR4 A;  2PRQ A;  4EWT A;  4PXC A;  4MHZ A;  2HC9 A;  3PB4 X;  3FF3 A;  3IID A;  2PE3 A;  5HOL A;  1VIX A;  4PXE A;  5DS0 A;  1PYT B;  2AFU A;  4MCR A;  1YSJ A;  2PJB A;  2O4H A;  2PJ5 A;  1YW6 A;  1ZLI A;  2JBJ A;  3KHX A;  3RZA A;  3WT4 A;  4O23 A;  1CP6 A;  3FEE A;  4P6Y A;  5HVF A;  3EJF A;  2V8G A;  2ZEH A;  3FX6 A;  3LMS A;  3IIF A;  4KYB A;  1XRY A;  1VHU A;  3PRT A;  1ARL A;  4OC1 A;  1KWM A;  1LFW A;  1TXR A;  3SI0 A;  3SJE A;  2EWB A;  2ZEN A;  3IIB A;  4MXU A;  1TXZ A;  1EE3 P;  1BAV A;  2IQ6 A;  5F09 A;  1F2O A;  1AYE A;  5FSY A;  4UIB A;  3HUV A;  4MCS A;  2AFX A;  5JM6 A;  3EJG A;  4YWY A;  4ABL A;  3D7F A;  1Q7L A;  1XFO A;  1F57 A;  1R3N A;  2C6G A;  4GVW A;  3QNV A;  2ZEM A;  1HEE A;  4IQY A;  4NGQ A;  1VHE A;  4Q7A A;  1CG2 A;  3PEI A;  2AFW A;  4K0C A;  3ISX A;  5LYF A;  4GUA A;  4P4E A;  4UEF A;  4MMO A;  5IB9 A;  4WJB A;  5K8M A;  3CPA A;  4JVV A;  2PJ9 A;  2ZEG A;  1CP7 A;  2F7V A;  4NFR A;  1ZLH A;  2ABZ A;  4NGS A;  1IY7 A;  5ELY A;  4R8F A;  1VHO A;  4NJR A;  2PIZ A;  4NGP A;  2CTC A;  4P4F A;  3SIG A;  2GU2 A;  4K3N A;  3H8F A;  2VL1 A;  4ZI6 A;  2ANP A;  4P4J A;  4DYO A;  3ETI A;  2C6P A;  2EK8 A;  4J4Z A;  4ZYQ A;  4MHP A;  4P44 A;  3B3C A;  3BHX A;  2PJ0 A;  2BOA A;  3BXM A;  3WC6 A;  2ZOG A;  2GLF A;  4OID A;  3D7D A;  2BFQ A;  3FED A;  4X8I A;  2GLJ A;  2CIJ A;  3S9N A;  2FXK A;  2L8R A;  3B3W A;  3B7I A;  2V8D A;  2PJA A;  3KHZ A;  3PB6 X;  1Z5R A;  5LYD A;  1DTD A;  3EKE A;  3GPO A;  2JEW A;  2Q51 A;  3CPX A;  1IGB A;  3V45 A;  5D29 A;  2PJ1 A;  3BI0 A;  3IFE A;  4NJQ A;  4ZY2 A;  5THW A;  4PXD A;  3FVL A;  4JZ0 A;  2V77 A;  4A39 A;  5CB5 A;  3FH4 A;  3IWW A;  4ZY1 A;  3RAM A;  4OC3 A;  1ELM P;  2J9A A;  2LGR A;  2JBK A;  2FG1 A;  3EWQ A;  3DGV A;  2X47 A;  1R43 A;  2RB7 A;  3HLP A;  2EEE A;  1XJO A;  3NH5 A;  5FSX A;  1YW4 A;  4PQA A;  3SIJ A;  2EK9 A;  3EWO A;  4P4B A;  3GPG A;  1DE4 C;  2I3C A;  5HVH A;  1PCA A;  2AFC A;  3IC1 A;  3H8G A;  2IMO A;  4ETJ A;  2XEF A;  4FUU A;  4J5Q A;  1TY8 A;  3SJX A;  3B3S A;  2AFS A;  1ZG8 A;  1LCP A;  3EWP A;  1ARM A;  1OBR A;  5CBM A;  4DJL A;  4A38 A;  4DUK A;  2PJC A;  3CT9 A;  5HVG A;  2BO9 A;  3SI2 A;  5CB3 A;  2G9D A;  3GLJ A;  4FWU A;  2PJ4 A;  1LAM A;  2FVG A;  2OOT A;  3KQX A;  2RFH A;  3K9T A;  6CPA A;  1HJZ A;  5I4M A;  3VFQ A;  2OR4 A;  3KI9 A;  4JYW A;  2PJ8 A;  3B3V A;  3V38 A;  4A37 A;  3WAB A;  2DX6 A;  4P45 A;  2Q43 A;  4ESS A;  4F9U A;  3IJ3 A;  4IAV A;  3FEC A;  3K2K A;  4F8Z A;  3VAT A;  4W9Y A;  5AIL A;  1TF9 A;  1VGY A;  3KL9 A;  5FSU A;  3D7G A;  4NGT A;  4JGK A;  4TU0 A;  5HXD A;  4AXV A;  4ABK A;  4MRI A;  5LRG A;  4A94 A;  4J5S A;  3EW5 A;  1TKH A;  1CPX A;  3KQZ A;  4MCQ A;  4UIA A;  2PJ2 A;  3D68 A;  4UEZ A;  1Z2L A;  4OKO A;  1RTQ A;  3IO1 A;  4OC0 A;  2C6C A;  3S9L A;  2C1C A;  3PB7 X;  3ISZ A;  5CPA A;  1CX8 A;  8CPA A;  2WYR A;  3PB9 X;  3Q6Z A;  4TNU A;  5LRK A;  2ZEP A;  1H8L A;  3TX8 A;  3D67 A;  3EWR A;  4NGM A;  1LOK A;  4MHN A;  2AFO A;  1TKF A;  2PVW A;  1HDQ A;  4GVV A;  1CPS A;  3D66 A;  3GUX A;  3N5F A;  2ACF A;  5CMS A;  4R76 A;  1Z8L A;  7CPA A;  2AFM A;  4Z65 A;  3KGQ A;  4R6T A;  1NSA A;  1ZG9 A;  1LAN A;  4OIW A;  4H2K A;  5K8O A;  1ZR5 A;  2CTB A;  3KZW A;  4LQG A;  4PPZ A;  4ETK A;  4MHY A;  4TWE A;  5JH9 A;  1NJR A;  2NYQ A;  1M4L A;  2GRE A;  5LYL A;  4ONW A;  4JLL A;  1HDU A;  1JQG A;  1GYT A;  3B2Y A;  4P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...