3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
4MHYA 1UWYA 4ONWA 1CPSA 4P4DA 3RBUA 4LQGA 2ZEOA 2GU2A 4MCQA 4F9UA 3SIIA 3H8FA 3I1UA 1CP7A 5HVGA 5JGFA 2C1CA 5IB9A 4MXUA 5DUSA 3FECA 4EFDA 1QQ9A 4A94A 3KGQA 2FVGA 3B3SA 3RZAA 4OC4A 1ARMA 1Z2LA 4PQAA 2PJ9A 3KZWA 5FSVA 3GPGA 1YW4A 4PXDA 2V8DA 3SI2A 3S9LA 1KWMA 5K8OA 1XBUA 1CBXA 4TU0A 2QJ8A 4AXVA 4OKOA 2AFWA 4EMEA 3ETIA 1PCAA 3B2YA 1F2PA 3PFEA 2PCUA 3PB6X 1LOKA 7CPAA 3FEEA 3EWPA 1VHOA 3WC6A 4YWYA 2C6GA 3FH4A 1ELMP 3SJEA 2XEIA 5JH9A 4R7MA 4X8IA 3V2BA 3Q71A 4JGKA 3T8WA 4ETJA 1YLOA 1VHEA 4GM5A 1Y0YA 4NGQA 1F57A 3SIGA 1FT7A 1XMBA 4A39A 2PJ6A 4OC5A 1EE3P 2ZOFA 3V38A 2Q51A 2F8HA 2Q4ZA 1TKJA 4PXCA 2FXKA 3LWUA 4P4BA 2DX6A 3SIJA 2G9DA 2F7VA 1RTQA 4UF4A 1TXRA 4UIBA 4JVVA 2PIYA 2ZEDA 4MHNA 4ABKA 1CP6A 3BI0A 2O53A 2ZENA 2PJCA 5ELYA 3D68A 5E3BA 2WYRA 2XEJA 2HB6A 4B6ZA 2CIJA 4ZY1A 1ZLHA 4A38A 3CPAA 2EWBA 3IEHA 3PFOA 1F2OA 5D29A 4P4IA 2JEWA 4ABLA 2NYQA 3EW5A 3L2NA 4WWVA 3EWRA 3SI1A 3S9NA 2EEEA 4UEEA 1NJRA 2PVWA 2AFUA 3TC8A 2PJ3A 3PB7X 5HOLA 3BHXA 2CTBA 4MCPA 4Q7AA 4DYOA 5LYDA 2LGRA 2RFHA 1CG2A 4O23A 1DTDA 3WT4A 4D86A 5LYFA 3KR4A 5CBMA 2AFZA 3HUVA 4FBEA 3KI9A 4OC0A 4P4JA 2GREA 3IFEA 3MN8A 3JZTA 2DEAA 1ARLA 2POKA 2V77A 3IO1A 3SJGA 1BPNA 3D66A 4PXEA 2QVPA 1IY7A 2XEGA 3IIDA 2CF4A 2ZEMA 3NFZA 3SJXA 1BLLE 1Y7EA 3MRUA 5J1QA 2IMOA 4WJBA 3KR5A 4OMEA 4Z65A 3GQEA 5CMSA 3IIFA 5LRKA 4MCSA 1LCPA 3B7IA 4GUAA 4NGPA 1CX8A 5HXDA 2PJ0A 1LFWA 3WABA 4UEFA 1R3NA 3D4UA 4W9YA 4NGTA 3TX8A 1AYEA 3ISXA 4ZY0A 1SPVA 1YW6A 2PVVA 4OIWA 4MRIA 6CPAA 1TY8A 5LYIA 5K8PA 1Q7LA 3IC1A 5HIHA 1IGBA 2C6CA 4NGNA 2VRIA 1ZR3A 1VGYA 3V45A 4K3NA 8CPAA 3CDXA 2JBJA 3GLJA 4ZY2A 2ABZA 2AFOA 3ISZA 5AILA 3DGVA 2NSMA 2BOAA 4A37A 2ACFA 1CPXA 4ZX8A 3N5FA 5K8MA 4ZI6A 4OIDA 4FUUA 4NFRA 2GLJA 2EK8A 2IJZA 2BCOA 2ZOGA 4PPZA 3IIBA 4FAIA 1DE4C 4PXBA 1YD9A 4GVVA 3BXMA 3KHZA 3HLPA 2HC9A 3B3VA 4F8ZA 5CB3A 5JM6A 2ZEGA 2ZEPA 1BAVA 3DLJA 4MHZA 2PJBA 4CPAA 1YSJA 2BFQA 4J5SA 4J5RA 2ANPA 4DUKA 3FVLA 5LRGA 2AFCA 4FWUA 2OR4A 2JBKA 4UIAA 1H8LA 5FSXA 2PJ2A 2O4HA 3K2KA 1LANA 4GVWA 2WZNA 3S9MA 3SI0A 2Q43A 3V7ZA 4R8FA 3RAMA 2V8HA 2ZEFA 3GQOA 3CT9A 3NH8A 3GUXA 1HDQA 3IJ3A 3BI1A 3VARA 3FX6A 3FEDA 5LYLA 3GPOA 2BFRA 4R6TA 4YU9A 5D8NA 4ESSA 1TF9A 3GB0A 4OC2A 2ZEHA 4OC1A 1ZLIA 4NGMA 4NGSA 4IK2A 3K9TA 2PJ4A 3H8GA 3D7GA 4TWEA 3D7FA 4UMLA 2I3CA 5F09A 1ZR5A 4P4EA 5FSZA 3GPQA 4OP4A 4KYBA 1LAMA 3LMSA 5THWA 3WC5A 1Y0RA 3PB4X 4P44A 4EWTA 3PRTA 2PJ8A 3NH4A 4OC3A 1OBRA 3EJGA 3IWWA 2ZELA 3EWQA 4NGRA 2BO9A 2V8GA 1TXZA 2PRQA 2PJ7A 1AMPA 3PB9X 3B3WA 4J4ZA 2AFSA 1M4LA 3Q6ZA 1YMEA 3WC7A 4K0CA 4IQYA 1BPMA 5DS0A 1QMUA 1Z5RA 1ZG7A 3PEIA 4MHPA 2L8RA 2GLFA 3QNVA 2FAVA 4UEZA 1XRYA 4JZ0A 4F9VA 2X47A 2FG1A 2J9AA 1NSAA 2C6PA 2PIZA 3H8EA 3FJUA 3D7HA 4P45A 2PJ5A 3VATA 1TKFA 1FNOA 3CPXA 1Z8LA 1LAPA 3SJFA 1JQGA 3KL9A 2PJAA 2RB7A 2XEFA 4JLLA 1ZG8A 2CTCA 3D67A 3EKEA 4KSIA 4ZX9A 5HVHA 4IAVA 3B35A 3SIHA 4RUHA 3KHXA 1HEEA 4JYWA 4P4FA 5CPAA 2AFMA 4DJLA 4JCAA 3KASA 3FMCA 3B3CA 4ZYQA 1XJOA 4P6YA 2EK9A 1ZG9A 5HVFA 1ELLP 4MCRA 3VFQA 4ETKA 2V8VA 4R76A 3PBEA 4BD9A 1VHUA 4IHMA 3EWOA 2VL1A 3D7DA 2ZEEA 4MMOA 2PE3A 1XFOA 1HDUA 4H2KA 5K8NA 2AFXA 4NJQA 1R43A 3NA6A 5FSYA 2XD7A 2IQ6A 3JRUA 5FSUA 2QYVA 3B3TA 3KQXA 3KQZA 3NH5A 5CB5A 3VH9A 5I4MA 3PB8X 2PJ1A 4NJRA 4J5QA 1VIXA 4TNUA 5LRJA 1GYTA 4G1PA 2OOTA 3FF3A 1PYTB 3EJFA 4X3RA 4X2TA 1HJZA 1TF8A 4P10A 3PBBA 1TKHA
chains in the Genus database with same CATH superfamily
4MHYA 1UWYA 4ONWA 1S7LA 1CPSA 4P4DA 2FIAA 3RBUA 4LQGA 2ZEOA 2GU2A 4MCQA 4F9UA 3SIIA 3H8FA 2GIVA 3I1UA 1CP7A 2Z11A 4RN7A 4C2ZA 2WPWA 4HNYB 5HVGA 5JGFA 2YNDA 5H86A 5AG4A 2C1CA 5IB9A 2WCTA 4MXUA 2EO8A 5DUSA 2EVNA 2VI7A 3FECA 4EFDA 1QQ9A 2CNSA 1VKCA 5FVJA 4A94A 5KTDA 4B13A 3KGQA 3G8WA 2FVGA 3B3SA 3RZAA 1XIXA 2DPTA 2QECA 3GIUA 4OC4A 2Q7BA 4KVXA 1ARMA 1NE9A 1Z2LA 2QMLA 4PQAA 2PJ9A 4RS2A 3KZWA 5FSVA 3GPGA 2RC4A 1YW4A 3S6GA 3S6HA 4CAWA 2OZGA 4PXDA 2V8DA 3SI2A 3S9LA 1KWMA 1QSTA 5K8OA 3TO7A 1XBUA 1CBXA 2OZUA 4FD4A 2HV2A 4TU0A 2QJ8A 4M85A 4AXVA 4QBJA 4OKOA 2AFWA 4EMEA 2Q44A 3ETIA 1PCAA 3B2YA 1F2PA 4AG7A 4E8OA 2ATRA 3PFEA 4L89A 5J8CA 4QUSA 5GCNA 1Z8TA 5E96A 3TFYA 2PCUA 3D8PA 1YVOA 5DWMA 4JJXA 5EMIA 3C26A 3PB6X 1LOKA 7CPAA 3DSBA 2ZW4A 3FEEA 3EWPA 1VHOA 3WC6A 4YWYA 2C6GA 3FNCA 5AGEA 3FH4A 4KOVA 1ELMP 3TT2A 3SJEA 2XEIA 5JH9A 4HPSA 4R7MA 4X8IA 3V2BA 4HKFA 5HMNA 5F46A 3Q71A 4JGKA 3T8WA 4UCMA 3UY5A 3EFAA 1Z8XA 4ETJA 1YLOA 1VHEA 2B3VA 2I00A 2CY2A 2Z3KA 4GM5A 1Y0YA 1YQEA 4NGQA 4II9A 1F57A 3SIGA 1FT7A 1XMBA 1X12A 1YK3A 2PSWA 5IB0A 1N71A 4A39A 2J8MA 2PJ6A 4MY0A 1EE3P 4OC5A 2ZOFA 3V38A 2Q51A 3FRMA 2F8HA 2Q4ZA 2F5IA 1KUVA 1TKJA 4I49A 3F8KA 4PXCA 4CGPA 4PSWA 2FXKA 4R3KA 3LWUA 3R95A 2FS5A 4P4BA 3S6KA 4CGNA 1M44A 2DX6A 3SIJA 2G9DA 3H5ZA 2F7VA 1RTQA 4UF4A 1TXRA 4UIBA 4JVVA 4A2ZA 4PSXA 2KQVA 2PIYA 2ZEDA 4FD5A 4MHNA 4KOWA 4ABKA 1CP6A 1UFHA 3BI0A 3IGRA 2O53A 3P2FA 2ZENA 2PJCA 3LODA 5ELYA 5JQ4A 5AG7A 3D68A 5E3BA 4JXRA 2WYRA 1R57A 4B14A 1S7KA 2XEJA 4YRHA 2G3AA 2HB6A 4YGOA 4IUSA 3JUWA 1V0CA 4U5YA 4B6ZA 2CIJA 1QSRA 1P4NA 4ZY1A 1ZLHA 4A38A 2NMTA 3CPAA 4AVAA 2EWBA 2J8NA 3F0AA 2R98A 1F2OA 3IEHA 3PFOA 4P4IA 5D29A 2JEWA 5DWNA 4ABLA 3VWEA 2NYQA 5KTAA 1XE4A 3RYOA 3EW5A 4MHDA 3L2NA 4WWVA 3R9GA 4CRZB 3EWRA 1YLEA 3SI1A 3S9NA 2EEEA 4UEEA 2KCWA 1NJRA 2VQYA 2D4OA 2PVWA 4BINA 2VEZA 2AFUA 3TC8A 2PJ3A 3PB7X 5AG5A 3QB8A 1XMTA 5HOLA 3BHXA 2CTBA 4MCPA 2Z0ZA 3GYAA 4B5OA 4Q7AA 4DYOA 4U9ZA 5LYDA 2LGRA 2ODFA 1CG2A 2RFHA 4F0YA 4O23A 3W6SA 1DTDA 3WR7A 3WT4A 4D86A 5LYFA 2BL1A 3KR4A 1K4JA 5CBMA 4ONUA 2AFZA 2G3TA 4CYOA 1YGHA 3HUVA 3TE4A 5ISVA 4FBEA 1PU9A 3KI9A 4OC0A 2VZZA 3FIXA 4P4JA 2GREA 3IFEA 3CXQA 4QB9A 3MN8A 3JZTA 2DEAA 4F6AA 1ARLA 2POKA 2V77A 3IO1A 2ZW5A 3IWGA 3SJGA 4HNWB 5AG6A 1BPNA 1Q2YA 3D66A 4PXEA 1MJAA 4GS4A 4CS0B 2QVPA 1IY7A 4UFVA 2XEGA 3QAHA 3IIDA 2JLMA 2CF4A 2ZEMA 3GKRA 3NFZA 1BLLE 1Y7EA 2CNTA 3MRUA 2IMOA 3FBUA 4WJBA 3SJXA 5J1QA 3KR5A 4OMEA 4Z65A 2Z10A 2BEIA 3GQEA 2YNCA 4M6GA 3TOBA 5CMSA 3IIFA 4MI4A 2REFA 1LCPA 2X7BA 2Y0MA 4MCSA 4A30A 5LRKA 3B7IA 1WWZA 4GUAA 3JVNA 4Q38A 3QAYA 4NGPA 1CX8A 3SXOA 2PJ0A 1LFWA 3WABA 5HXDA 4UEFA 1R3NA 3V8IA 1Z8WA 2EBJA 2Q0YA 3D4UA 3EO4A 4MFKA 1P0HA 1S60A 2FSRA 4L8AA 2Z3MA 4W9YA 4NGTA 3TX8A 4B12A 4CRYB 4EVYA 1AYEA 1I1DA 4F0XA 4B5PA 4ZY0A 1SPVA 3ISXA 1YW6A 2PVVA 2W2GA 2JDCA 2JZFA 4KSAA 4MRIA 4OIWA 1Y7RA 4C7IA 4A95A 3G3SA 6CPAA 3SHPA 1QSMA 1TY8A 5LYIA 5K8PA 1Q7LA 1L0CA 1GHEA 4PK3A 3IC1A 5HIHA 1IU8A 1IGBA 2VXKA 2C6CA 5KTCA 3B8GA 4NGNA 2FIWA 2VRIA 1ZR3A 1VGYA 3V45A 4U9YA 4K3NA 8CPAA 3CDXA 2OZHA 4R57A 2Z3LA 2JBJA 3PGPA 4C2YA 4FD7A 3GLJA 4ZY2A 2ABZA 2AFOA 3ISZA 4H89A 3FXTA 4MFLA 5AILA 4XNHB 3DGVA 5BWAB 4M3SA 4MJ8A 2P6GA 2NSMA 4MFPA 2BOAA 3T9YA 5C82A 4FD6A 4A37A 2ACFA 1CPXA 1IIDA 3A9LA 2CNMA 3DR6A 1BOBA 4UCNA 4CAFA 4ZX8A 3N5FA 5IV0A 4KOYA 1IB1E 2PR8A 3H4QA 5K8MA 4ZI6A 4OIDA 4FUUA 4NFRA 2GLJA 3ZJ0A 5A28A 4A31A 2EK8A 3NE7A 4ZBGA 4ORFA 3R96A 2AE6A 2IJZA 5F48A 2BCOA 2OU2A 2ZOGA 1ZO0A 3I3GA 4PPZA 3IIBA 3R1KA 2DXQA 1DE4C 1S7NA 3D2MA 4PXBA 1ON0A 1YD9A 4CYPA 4FAIA 4GVVA 1OZPA 3BXMA 5IX3A 1Z4RA 2VBQA 1J4JA 3KHZA 4H6ZA 3HLPA 2HC9A 1KUXA 3B3VA 4F8ZA 5CB3A 5JM6A 2ZEGA 2ZEPA 1WK4A 2Q04A 4HNXB 1BAVA 3DLJA 4A32A 4MHZA 1SQHA 4NF1A 2PJBA 4KUBA 4CPAA 1YSJA 3GY9A 2BFQA 2EUIA 4J5SA 4J5RA 2FE7A 2ANPA 4B10A 3FVLA 4DUKA 5F47A 3VWDA 2RNKA 4GXHA 5LRGA 2Z3NA 4B5PB 2AFCA 1IOFA 1YX0A 2HUZA 2OR4A 2JBKA 4FWUA 2JZEA 1KZFA 1MK4A 3P2HA 4E0AA 4KZTA 4UIAA 1IOIA 4LX9A 1MJBA 1H8LA 5FSXA 1AUGA 4UFXA 2PJ2A 2O4HA 3K2KA 1LANA 4GVWA 2WZNA 3SXNA 3S9MA 3LD2A 4H6UA 1M4GA 3SI0A 4KLVA 1BO4A 1S7FA 2Q43A 4IF5A 2R8VA 4R8FA 2IL4A 3V7ZA 3RAMA 2DPSA 2V8HA 2ZEFA 3GQOA 3PP9A 3CT9A 1PUAA 3NH8A 3GUXA 4K30A 3BJ7A 4CAXA 1HDQA 3IJ3A 4QVTA 3BI1A 2Q7SA 4CGMA 3VARA 3FX6A 3W91A 3FEDA 2K5TA 5LYLA 3GPOA 2YNCC 2AJ6A 2BFRA 4R6TA 4NEXA 1NMTA 4B11A 4YU9A 2ZXVA 5D8NA 4ESSA 4XPDC 4A33A 4JXQA 1TF9A 3GB0A 2C27A 3FB3A 2Q4VA 3I9SA 4KVOE 4NSQA 3TO6A 4QC6A 4OC2A 2HQYA 4AVCA 5HH1A 3RO0A 1XOVA 4XNHC 2ZEHA 4OC1A 1IYKA 1ZLIA 4KOXA 4NGSA 1MJ9A 4IK2A 4NGMA 3K9TA 2PJ4A 4CAVA 3H8GA 3D7GA 4M6HA 4TWEA 3D7FA 4UMLA 2I3CA 3F5BA 4UA3A 4AVBA 4C2XA 5F09A 1ZR5A 1B6BA 2PDOA 1IICA 4P4EA 3TO9A 3BLNA 5FSZA 3GPQA 4OP4A 3D3SA 4KYBA 1M1DA 1LAMA 3LMSA 5THWA 2DF5A 3WC5A 4OADA 2OB0A 3OWCA 1Y0RA 3PB4X 1IYLA 2I79A 4OLLA 3IU2A 2VZYA 2H5MA 4UBRA 4P44A 4EWTA 3DDDA 1Q2CA 4MFQA 3PRTA 2FL4A 2PJ8A 5G22A 3KKWA 3NH4A 4OC3A 4KVME 1OBRA 1B87A 3EJGA 3IWWA 1XF8A 4E2AA 1Y9WA 2YGWA 2ZELA 3MGDA 4PK2A 2PC1A 3EWQA 3LACA 2ARHA 2WPXA 1VHSA 2Z3OA 4NGRA 5CNPA 1U6MA 3JTKA 3N7ZA 4BBHA 4ZGYB 2BO9A 1KUYA 2V8GA 1QSOA 2JDDA 1TXZA 4KS9A 2P6EA 2A4NA 1Z9UA 2ZPAA 2PRQA 3T90A 4CGLA 2G0BA 2PJ7A 1FY7A 1AMPA 3PB9X 2PQ8A 3B3WA 4J4ZA 3RNZA 2AFSA 4CAEA 4DNCA 4MY3A 5C88A 1M4LA 3Q6ZA 1YMEA 2GANA 2P6FA 4Y49C 3TOAA 3WC7A 4K0CA 3R9EA 4IQYA 1BPMA 1JWQA 2FCKA 3CZXA 5DS0A 1QMUA 1Z5RA 4KUAA 2BSWA 4MBUA 1ZG7A 3PEIA 4KOTA 4MHPA 2L8RA 2GLFA 4NCZA 3QNVA 2FAVA 4UEZA 1XRYA 2ZW6A 4X5KA 1S3ZA 4JZ0A 2ZW7A 4R9MA 3BJ8A 4F9VA 5J8FA 2X47A 2FXFA 4MFJA 2FG1A 5G1ZA 2J9AA 1NSAA 4JWPA 2C6PA 2PIZA 3H8EA 2J8RA 2GFQA 3FJUA 3D2PA 2PRBA 3NE8A 3D7HA 1YVKA 4KSFA 5G21A 4P45A 2PJ5A 3EC4A 3VATA 1TKFA 4PV6A 3CXPA 1FNOA 3CPXA 2JZDA 2B58A 1Z8LA 2OH1A 2FT0A 1LAPA 3SJFA 1JQGA 3KL9A 1YREA 2PJAA 3R9FA 3DR8A 2RB7A 2XEFA 4JLLA 3PZJA 1S5KA 1ZG8A 2CTCA 2PR1A 4JD6A 3CXSA 3D67A 3EKEA 2B5GB 4KLWA 3W6XA 4KSIA 4ZX9A 3K9UA 4C68A 1I12A 5G20A 3EXNA 5HVHA 4IAVA 3B35A 3SIHA 1TIQA 2Q4YA 2R1IA 4UWJA 4RUHA 1XEBA 4JLYA 3KHXA 1HEEA 1CM0A 4JYWA 1A2ZA 4R87A 2O28A 4P4FA 2AFMA 5CPAA 4DJLA 4JCAA 3KASA 2REEA 3FMCA 3B3CA 4UFWA 4ZYQA 1RO5A 1XJOA 4P6YA 2EK9A 1ZG9A 1X10A 5HVFA 5JPHA 1ELLP 2WUUA 4YFJA 4MCRA 3VFQA 1NSLA 4KOUA 4ETKA 4Q36A 3IU1A 2V8VA 5EBVA 4R76A 3PBEA 2WSAA 4UCPA 5I0CA 1Q2DA 4BD9A 4CYQA 3IWEA 1VHUA 4IHMA 3EWOA 1Y9KA 2VL1A 3D7DA 4XPKA 2ZEEA 4MMOA 2PE3A 4Y49B 1XFOA 1YR0A 1HDUA 2P0WA 4H2KA 2R7HA 2B4DB 5A27A 2Z3PA 3TCVA 5K8NA 3EY5A 2AFXA 4NJQA 4CGOA 1R43A 4C7HA 4LUAA 2B5GA 1QSNA 1RXTA 3NA6A 2B4BA 4MFZA 4R3LA 5FSYA 2GE3A 2XD7A 2B4DA 1I21A 4CYNA 2IQ6A 2QIRA 3JRUA 5FSUA 4LQ6A 2QYVA 3TTHA 3B3TA 4UWIA 3KQXA 3KQZA 1M4DA 3NH5A 4XPDB 4KORA 5F49A 5CB5A 3FYNA 5H84A 3VH9A 5I4MA 2D4PA 4AB7A 3E0KA 4KOSA 3PB8X 2PJ1A 1M4IA 4NJRA 3S6FA 4J5QA 2YNEA 1LRZA 4NXYA 3ZZIA 1VIXA 4TNUA 2B3UA 4M6IA 5LRJA 4BMHA 1GYTA 4G1PA 2OOTA 3FF3A 4XPLA 2JEVA 1PYTB 4OAEA 1Z4EA 3EJFA 4X3RA 4J3GA 5EC4A 3DNSA 2BUEA 2CXAA 4X2TA 1HJZA 1TF8A 4RI1A 4AG9A 1CJWA 4P10A 3PBBA 1TKHA
chains in the Genus database with same CATH topology
4MHYA 1UWYA 4ONWA 1CPSA 4P4DA 3RBUA 4LQGA 2ZEOA 2GU2A 4MCQA 4F9UA 3SIIA 3H8FA 3I1UA 1CP7A 5HVGA 5JGFA 2C1CA 5IB9A 4MXUA 5DUSA 3FECA 4EFDA 1QQ9A 4A94A 3KGQA 2FVGA 3B3SA 3RZAA 4OC4A 1ARMA 1Z2LA 4PQAA 2PJ9A 3KZWA 5FSVA 3GPGA 1YW4A 4PXDA 2V8DA 3SI2A 3S9LA 1KWMA 5K8OA 1XBUA 1CBXA 4TU0A 2QJ8A 4AXVA 4OKOA 2AFWA 4EMEA 3ETIA 1PCAA 3B2YA 1F2PA 3PFEA 2PCUA 3PB6X 1LOKA 7CPAA 3FEEA 3EWPA 1VHOA 3WC6A 4YWYA 2C6GA 3FH4A 1ELMP 3SJEA 2XEIA 5JH9A 4R7MA 4X8IA 3V2BA 3Q71A 4JGKA 3T8WA 4ETJA 1YLOA 1VHEA 4GM5A 1Y0YA 4NGQA 1F57A 3SIGA 1FT7A 1XMBA 4A39A 2PJ6A 4OC5A 1EE3P 2ZOFA 3V38A 2Q51A 2F8HA 2Q4ZA 1TKJA 4PXCA 2FXKA 3LWUA 4P4BA 2DX6A 3SIJA 2G9DA 2F7VA 1RTQA 4UF4A 1TXRA 4UIBA 4JVVA 2PIYA 2ZEDA 4MHNA 4ABKA 1CP6A 3BI0A 2O53A 2ZENA 2PJCA 5ELYA 3D68A 5E3BA 2WYRA 2XEJA 2HB6A 4B6ZA 2CIJA 4ZY1A 1ZLHA 4A38A 3CPAA 2EWBA 3IEHA 3PFOA 1F2OA 5D29A 4P4IA 2JEWA 4ABLA 2NYQA 3EW5A 3L2NA 4WWVA 3EWRA 3SI1A 3S9NA 2EEEA 4UEEA 1NJRA 2PVWA 2AFUA 3TC8A 2PJ3A 3PB7X 5HOLA 3BHXA 2CTBA 4MCPA 4Q7AA 4DYOA 5LYDA 2LGRA 2RFHA 1CG2A 4O23A 1DTDA 3WT4A 4D86A 5LYFA 3KR4A 5CBMA 2AFZA 3HUVA 4FBEA 3KI9A 4OC0A 4P4JA 2GREA 3IFEA 3MN8A 3JZTA 2DEAA 1ARLA 2POKA 2V77A 3IO1A 3SJGA 1BPNA 3D66A 4PXEA 2QVPA 1IY7A 2XEGA 3IIDA 2CF4A 2ZEMA 3NFZA 3SJXA 1BLLE 1Y7EA 3MRUA 5J1QA 2IMOA 4WJBA 3KR5A 4OMEA 4Z65A 3GQEA 5CMSA 3IIFA 5LRKA 4MCSA 1LCPA 3B7IA 4GUAA 4NGPA 1CX8A 5HXDA 2PJ0A 1LFWA 3WABA 4UEFA 1R3NA 3D4UA 4W9YA 4NGTA 3TX8A 1AYEA 3ISXA 4ZY0A 1SPVA 1YW6A 2PVVA 4OIWA 4MRIA 6CPAA 1TY8A 5LYIA 5K8PA 1Q7LA 3IC1A 5HIHA 1IGBA 2C6CA 4NGNA 2VRIA 1ZR3A 1VGYA 3V45A 4K3NA 8CPAA 3CDXA 2JBJA 3GLJA 4ZY2A 2ABZA 2AFOA 3ISZA 5AILA 3DGVA 2NSMA 2BOAA 4A37A 2ACFA 1CPXA 4ZX8A 3N5FA 5K8MA 4ZI6A 4OIDA 4FUUA 4NFRA 2GLJA 2EK8A 2IJZA 2BCOA 2ZOGA 4PPZA 3IIBA 4FAIA 1DE4C 4PXBA 1YD9A 4GVVA 3BXMA 3KHZA 3HLPA 2HC9A 3B3VA 4F8ZA 5CB3A 5JM6A 2ZEGA 2ZEPA 1BAVA 3DLJA 4MHZA 2PJBA 4CPAA 1YSJA 2BFQA 4J5SA 4J5RA 2ANPA 4DUKA 3FVLA 5LRGA 2AFCA 4FWUA 2OR4A 2JBKA 4UIAA 1H8LA 5FSXA 2PJ2A 2O4HA 3K2KA 1LANA 4GVWA 2WZNA 3S9MA 3SI0A 2Q43A 3V7ZA 4R8FA 3RAMA 2V8HA 2ZEFA 3GQOA 3CT9A 3NH8A 3GUXA 1HDQA 3IJ3A 3BI1A 3VARA 3FX6A 3FEDA 5LYLA 3GPOA 2BFRA 4R6TA 4YU9A 5D8NA 4ESSA 1TF9A 3GB0A 4OC2A 2ZEHA 4OC1A 1ZLIA 4NGMA 4NGSA 4IK2A 3K9TA 2PJ4A 3H8GA 3D7GA 4TWEA 3D7FA 4UMLA 2I3CA 5F09A 1ZR5A 4P4EA 5FSZA 3GPQA 4OP4A 4KYBA 1LAMA 3LMSA 5THWA 3WC5A 1Y0RA 3PB4X 4P44A 4EWTA 3PRTA 2PJ8A 3NH4A 4OC3A 1OBRA 3EJGA 3IWWA 2ZELA 3EWQA 4NGRA 2BO9A 2V8GA 1TXZA 2PRQA 2PJ7A 1AMPA 3PB9X 3B3WA 4J4ZA 2AFSA 1M4LA 3Q6ZA 1YMEA 3WC7A 4K0CA 4IQYA 1BPMA 5DS0A 1QMUA 1Z5RA 1ZG7A 3PEIA 4MHPA 2L8RA 2GLFA 3QNVA 2FAVA 4UEZA 1XRYA 4JZ0A 4F9VA 2X47A 2FG1A 2J9AA 1NSAA 2C6PA 2PIZA 3H8EA 3FJUA 3D7HA 4P45A 2PJ5A 3VATA 1TKFA 1FNOA 3CPXA 1Z8LA 1LAPA 3SJFA 1JQGA 3KL9A 2PJAA 2RB7A 2XEFA 4JLLA 1ZG8A 2CTCA 3D67A 3EKEA 4KSIA 4ZX9A 5HVHA 4IAVA 3B35A 3SIHA 4RUHA 3KHXA 1HEEA 4JYWA 4P4FA 5CPAA 2AFMA 4DJLA 4JCAA 3KASA 3FMCA 3B3CA 4ZYQA 1XJOA 4P6YA 2EK9A 1ZG9A 5HVFA 1ELLP 4MCRA 3VFQA 4ETKA 2V8VA 4R76A 3PBEA 4BD9A 1VHUA 4IHMA 3EWOA 2VL1A 3D7DA 2ZEEA 4MMOA 2PE3A 1XFOA 1HDUA 4H2KA 5K8NA 2AFXA 4NJQA 1R43A 3NA6A 5FSYA 2XD7A 2IQ6A 3JRUA 5FSUA 2QYVA 3B3TA 3KQXA 3KQZA 3NH5A 5CB5A 3VH9A 5I4MA 3PB8X 2PJ1A 4NJRA 4J5QA 1VIXA 4TNUA 5LRJA 1GYTA 4G1PA 2OOTA 3FF3A 1PYTB 3EJFA 4X3RA 4X2TA 1HJZA 1TF8A 4P10A 3PBBA 1TKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHY A;  1UWY A;  4ONW A;  1CPS A;  4P4D A;  3RBU A;  4LQG A;  2ZEO A;  2GU2 A;  4MCQ A;  4F9U A;  3SII A;  3H8F A;  3I1U A;  1CP7 A;  5HVG A;  5JGF A;  2C1C A;  5IB9 A;  4MXU A;  5DUS A;  3FEC A;  4EFD A;  1QQ9 A;  4A94 A;  3KGQ A;  2FVG A;  3B3S A;  3RZA A;  4OC4 A;  1ARM A;  1Z2L A;  4PQA A;  2PJ9 A;  3KZW A;  5FSV A;  3GPG A;  1YW4 A;  4PXD A;  2V8D A;  3SI2 A;  3S9L A;  1KWM A;  5K8O A;  1XBU A;  1CBX A;  4TU0 A;  2QJ8 A;  4AXV A;  4OKO A;  2AFW A;  4EME A;  3ETI A;  1PCA A;  3B2Y A;  1F2P A;  3PFE A;  2PCU A;  3PB6 X;  1LOK A;  7CPA A;  3FEE A;  3EWP A;  1VHO A;  3WC6 A;  4YWY A;  2C6G A;  3FH4 A;  1ELM P;  3SJE A;  2XEI A;  5JH9 A;  4R7M A;  4X8I A;  3V2B A;  3Q71 A;  4JGK A;  3T8W A;  4ETJ A;  1YLO A;  1VHE A;  4GM5 A;  1Y0Y A;  4NGQ A;  1F57 A;  3SIG A;  1FT7 A;  1XMB A;  4A39 A;  2PJ6 A;  4OC5 A;  1EE3 P;  2ZOF A;  3V38 A;  2Q51 A;  2F8H A;  2Q4Z A;  1TKJ A;  4PXC A;  2FXK A;  3LWU A;  4P4B A;  2DX6 A;  3SIJ A;  2G9D A;  2F7V A;  1RTQ A;  4UF4 A;  1TXR A;  4UIB A;  4JVV A;  2PIY A;  2ZED A;  4MHN A;  4ABK A;  1CP6 A;  3BI0 A;  2O53 A;  2ZEN A;  2PJC A;  5ELY A;  3D68 A;  5E3B A;  2WYR A;  2XEJ A;  2HB6 A;  4B6Z A;  2CIJ A;  4ZY1 A;  1ZLH A;  4A38 A;  3CPA A;  2EWB A;  3IEH A;  3PFO A;  1F2O A;  5D29 A;  4P4I A;  2JEW A;  4ABL A;  2NYQ A;  3EW5 A;  3L2N A;  4WWV A;  3EWR A;  3SI1 A;  3S9N A;  2EEE A;  4UEE A;  1NJR A;  2PVW A;  2AFU A;  3TC8 A;  2PJ3 A;  3PB7 X;  5HOL A;  3BHX A;  2CTB A;  4MCP A;  4Q7A A;  4DYO A;  5LYD A;  2LGR A;  2RFH A;  1CG2 A;  4O23 A;  1DTD A;  3WT4 A;  4D86 A;  5LYF A;  3KR4 A;  5CBM A;  2AFZ A;  3HUV A;  4FBE A;  3KI9 A;  4OC0 A;  4P4J A;  2GRE A;  3IFE A;  3MN8 A;  3JZT A;  2DEA A;  1ARL A;  2POK A;  2V77 A;  3IO1 A;  3SJG A;  1BPN A;  3D66 A;  4PXE A;  2QVP A;  1IY7 A;  2XEG A;  3IID A;  2CF4 A;  2ZEM A;  3NFZ A;  3SJX A;  1BLL E;  1Y7E A;  3MRU A;  5J1Q A;  2IMO A;  4WJB A;  3KR5 A;  4OME A;  4Z65 A;  3GQE A;  5CMS A;  3IIF A;  5LRK A;  4MCS A;  1LCP A;  3B7I A;  4GUA A;  4NGP A;  1CX8 A;  5HXD A;  2PJ0 A;  1LFW A;  3WAB A;  4UEF A;  1R3N A;  3D4U A;  4W9Y A;  4NGT A;  3TX8 A;  1AYE A;  3ISX A;  4ZY0 A;  1SPV A;  1YW6 A;  2PVV A;  4OIW A;  4MRI A;  6CPA A;  1TY8 A;  5LYI A;  5K8P A;  1Q7L A;  3IC1 A;  5HIH A;  1IGB A;  2C6C A;  4NGN A;  2VRI A;  1ZR3 A;  1VGY A;  3V45 A;  4K3N A;  8CPA A;  3CDX A;  2JBJ A;  3GLJ A;  4ZY2 A;  2ABZ A;  2AFO A;  3ISZ A;  5AIL A;  3DGV A;  2NSM A;  2BOA A;  4A37 A;  2ACF A;  1CPX A;  4ZX8 A;  3N5F A;  5K8M A;  4ZI6 A;  4OID A;  4FUU A;  4NFR A;  2GLJ A;  2EK8 A;  2IJZ A;  2BCO A;  2ZOG A;  4PPZ A;  3IIB A;  4FAI A;  1DE4 C;  4PXB A;  1YD9 A;  4GVV A;  3BXM A;  3KHZ A;  3HLP A;  2HC9 A;  3B3V A;  4F8Z A;  5CB3 A;  5JM6 A;  2ZEG A;  2ZEP A;  1BAV A;  3DLJ A;  4MHZ A;  2PJB A;  4CPA A;  1YSJ A;  2BFQ A;  4J5S A;  4J5R A;  2ANP A;  4DUK A;  3FVL A;  5LRG A;  2AFC A;  4FWU A;  2OR4 A;  2JBK A;  4UIA A;  1H8L A;  5FSX A;  2PJ2 A;  2O4H A;  3K2K A;  1LAN A;  4GVW A;  2WZN A;  3S9M A;  3SI0 A;  2Q43 A;  3V7Z A;  4R8F A;  3RAM A;  2V8H A;  2ZEF A;  3GQO A;  3CT9 A;  3NH8 A;  3GUX A;  1HDQ A;  3IJ3 A;  3BI1 A;  3VAR A;  3FX6 A;  3FED A;  5LYL A;  3GPO A;  2BFR A;  4R6T A;  4YU9 A;  5D8N A;  4ESS A;  1TF9 A;  3GB0 A;  4OC2 A;  2ZEH A;  4OC1 A;  1ZLI A;  4NGM A;  4NGS A;  4IK2 A;  3K9T A;  2PJ4 A;  3H8G A;  3D7G A;  4TWE A;  3D7F A;  4UML A;  2I3C A;  5F09 A;  1ZR5 A;  4P4E A;  5FSZ A;  3GPQ A;  4OP4 A;  4KYB A;  1LAM A;  3LMS A;  5THW A;  3WC5 A;  1Y0R A;  3PB4 X;  4P44 A;  4EWT A;  3PRT A;  2PJ8 A;  3NH4 A;  4OC3 A;  1OBR A;  3EJG A;  3IWW A;  2ZEL A;  3EWQ A;  4NGR A;  2BO9 A;  2V8G A;  1TXZ A;  2PRQ A;  2PJ7 A;  1AMP A;  3PB9 X;  3B3W A;  4J4Z A;  2AFS A;  1M4L A;  3Q6Z A;  1YME A;  3WC7 A;  4K0C A;  4IQY A;  1BPM A;  5DS0 A;  1QMU A;  1Z5R A;  1ZG7 A;  3PEI A;  4MHP A;  2L8R A;  2GLF A;  3QNV A;  2FAV A;  4UEZ A;  1XRY A;  4JZ0 A;  4F9V A;  2X47 A;  2FG1 A;  2J9A A;  1NSA A;  2C6P A;  2PIZ A;  3H8E A;  3FJU A;  3D7H A;  4P45 A;  2PJ5 A;  3VAT A;  1TKF A;  1FNO A;  3CPX A;  1Z8L A;  1LAP A;  3SJF A;  1JQG A;  3KL9 A;  2PJA A;  2RB7 A;  2XEF A;  4JLL A;  1ZG8 A;  2CTC A;  3D67 A;  3EKE A;  4KSI A;  4ZX9 A;  5HVH A;  4IAV A;  3B35 A;  3SIH A;  4RUH A;  3KHX A;  1HEE A;  4JYW A;  4P4F A;  5CPA A;  2AFM A;  4DJL A;  4JCA A;  3KAS A;  3FMC A;  3B3C A;  4ZYQ A;  1XJO A;  4P6Y A;  2EK9 A;  1ZG9 A;  5HVF A;  1ELL P;  4MCR A;  3VFQ A;  4ETK A;  2V8V A;  4R76 A;  3PBE A;  4BD9 A;  1VHU A;  4IHM A;  3EWO A;  2VL1 A;  3D7D A;  2ZEE A;  4MMO A;  2PE3 A;  1XFO A;  1HDU A;  4H2K A;  5K8N A;  2AFX A;  4NJQ A;  1R43 A;  3NA6 A;  5FSY A;  2XD7 A;  2IQ6 A;  3JRU A;  5FSU A;  2QYV A;  3B3T A;  3KQX A;  3KQZ A;  3NH5 A;  5CB5 A;  3VH9 A;  5I4M A;  3PB8 X;  2PJ1 A;  4NJR A;  4J5Q A;  1VIX A;  4TNU A;  5LRJ A;  1GYT A;  4G1P A;  2OOT A;  3FF3 A;  1PYT B;  3EJF A;  4X3R A;  4X2T A;  1HJZ A;  1TF8 A;  4P10 A;  3PBB A;  1TKH A; 
#chains in the Genus database with same CATH topology
 4MHY A;  1UWY A;  4ONW A;  1S7L A;  1CPS A;  4P4D A;  2FIA A;  3RBU A;  4LQG A;  2ZEO A;  2GU2 A;  4MCQ A;  4F9U A;  3SII A;  3H8F A;  2GIV A;  3I1U A;  1CP7 A;  2Z11 A;  4RN7 A;  4C2Z A;  2WPW A;  4HNY B;  5HVG A;  5JGF A;  2YND A;  5H86 A;  5AG4 A;  2C1C A;  5IB9 A;  2WCT A;  4MXU A;  2EO8 A;  5DUS A;  2EVN A;  2VI7 A;  3FEC A;  4EFD A;  1QQ9 A;  2CNS A;  1VKC A;  5FVJ A;  4A94 A;  5KTD A;  4B13 A;  3KGQ A;  3G8W A;  2FVG A;  3B3S A;  3RZA A;  1XIX A;  2DPT A;  2QEC A;  3GIU A;  4OC4 A;  2Q7B A;  4KVX A;  1ARM A;  1NE9 A;  1Z2L A;  2QML A;  4PQA A;  2PJ9 A;  4RS2 A;  3KZW A;  5FSV A;  3GPG A;  2RC4 A;  1YW4 A;  3S6G A;  3S6H A;  4CAW A;  2OZG A;  4PXD A;  2V8D A;  3SI2 A;  3S9L A;  1KWM A;  1QST A;  5K8O A;  3TO7 A;  1XBU A;  1CBX A;  2OZU A;  4FD4 A;  2HV2 A;  4TU0 A;  2QJ8 A;  4M85 A;  4AXV A;  4QBJ A;  4OKO A;  2AFW A;  4EME A;  2Q44 A;  3ETI A;  1PCA A;  3B2Y A;  1F2P A;  4AG7 A;  4E8O A;  2ATR A;  3PFE A;  4L89 A;  5J8C A;  4QUS A;  5GCN A;  1Z8T A;  5E96 A;  3TFY A;  2PCU A;  3D8P A;  1YVO A;  5DWM A;  4JJX A;  5EMI A;  3C26 A;  3PB6 X;  1LOK A;  7CPA A;  3DSB A;  2ZW4 A;  3FEE A;  3EWP A;  1VHO A;  3WC6 A;  4YWY A;  2C6G A;  3FNC A;  5AGE A;  3FH4 A;  4KOV A;  1ELM P;  3TT2 A;  3SJE A;  2XEI A;  5JH9 A;  4HPS A;  4R7M A;  4X8I A;  3V2B A;  4HKF A;  5HMN A;  5F46 A;  3Q71 A;  4JGK A;  3T8W A;  4UCM A;  3UY5 A;  3EFA A;  1Z8X A;  4ETJ A;  1YLO A;  1VHE A;  2B3V A;  2I00 A;  2CY2 A;  2Z3K A;  4GM5 A;  1Y0Y A;  1YQE A;  4NGQ A;  4II9 A;  1F57 A;  3SIG A;  1FT7 A;  1XMB A;  1X12 A;  1YK3 A;  2PSW A;  5IB0 A;  1N71 A;  4A39 A;  2J8M A;  2PJ6 A;  4MY0 A;  1EE3 P;  4OC5 A;  2ZOF A;  3V38 A;  2Q51 A;  3FRM A;  2F8H A;  2Q4Z A;  2F5I A;  1KUV A;  1TKJ A;  4I49 A;  3F8K A;  4PXC A;  4CGP A;  4PSW A;  2FXK A;  4R3K A;  3LWU A;  3R95 A;  2FS5 A;  4P4B A;  3S6K A;  4CGN A;  1M44 A;  2DX6 A;  3SIJ A;  2G9D A;  3H5Z A;  2F7V A;  1RTQ A;  4UF4 A;  1TXR A;  4UIB A;  4JVV A;  4A2Z A;  4PSX A;  2KQV A;  2PIY A;  2ZED A;  4FD5 A;  4MHN A;  4KOW A;  4ABK A;  1CP6 A;  1UFH A;  3BI0 A;  3IGR A;  2O53 A;  3P2F A;  2ZEN A;  2PJC A;  3LOD A;  5ELY A;  5JQ4 A;  5AG7 A;  3D68 A;  5E3B A;  4JXR A;  2WYR A;  1R57 A;  4B14 A;  1S7K A;  2XEJ A;  4YRH A;  2G3A A;  2HB6 A;  4YGO A;  4IUS A;  3JUW A;  1V0C A;  4U5Y A;  4B6Z A;  2CIJ A;  1QSR A;  1P4N A;  4ZY1 A;  1ZLH A;  4A38 A;  2NMT A;  3CPA A;  4AVA A;  2EWB A;  2J8N A;  3F0A A;  2R98 A;  1F2O A;  3IEH A;  3PFO A;  4P4I A;  5D29 A;  2JEW A;  5DWN A;  4ABL A;  3VWE A;  2NYQ A;  5KTA A;  1XE4 A;  3RYO A;  3EW5 A;  4MHD A;  3L2N A;  4WWV A;  3R9G A;  4CRZ B;  3EWR A;  1YLE A;  3SI1 A;  3S9N A;  2EEE A;  4UEE A;  2KCW A;  1NJR A;  2VQY A;  2D4O A;  2PVW A;  4BIN A;  2VEZ A;  2AFU A;  3TC8 A;  2PJ3 A;  3PB7 X;  5AG5 A;  3QB8 A;  1XMT A;  5HOL A;  3BHX A;  2CTB A;  4MCP A;  2Z0Z A;  3GYA A;  4B5O A;  4Q7A A;  4DYO A;  4U9Z A;  5LYD A;  2LGR A;  2ODF A;  1CG2 A;  2RFH A;  4F0Y A;  4O23 A;  3W6S A;  1DTD A;  3WR7 A;  3WT4 A;  4D86 A;  5LYF A;  2BL1 A;  3KR4 A;  1K4J A;  5CBM A;  4ONU A;  2AFZ A;  2G3T A;  4CYO A;  1YGH A;  3HUV A;  3TE4 A;  5ISV A;  4FBE A;  1PU9 A;  3KI9 A;  4OC0 A;  2VZZ A;  3FIX A;  4P4J A;  2GRE A;  3IFE A;  3CXQ A;  4QB9 A;  3MN8 A;  3JZT A;  2DEA A;  4F6A A;  1ARL A;  2POK A;  2V77 A;  3IO1 A;  2ZW5 A;  3IWG A;  3SJG A;  4HNW B;  5AG6 A;  1BPN A;  1Q2Y A;  3D66 A;  4PXE A;  1MJA A;  4GS4 A;  4CS0 B;  2QVP A;  1IY7 A;  4UFV A;  2XEG A;  3QAH A;  3IID A;  2JLM A;  2CF4 A;  2ZEM A;  3GKR A;  3NFZ A;  1BLL E;  1Y7E A;  2CNT A;  3MRU A;  2IMO A;  3FBU A;  4WJB A;  3SJX A;  5J1Q A;  3KR5 A;  4OME A;  4Z65 A;  2Z10 A;  2BEI A;  3GQE A;  2YNC A;  4M6G A;  3TOB A;  5CMS A;  3IIF A;  4MI4 A;  2REF A;  1LCP A;  2X7B A;  2Y0M A;  4MCS A;  4A30 A;  5LRK A;  3B7I A;  1WWZ A;  4GUA A;  3JVN A;  4Q38 A;  3QAY A;  4NGP A;  1CX8 A;  3SXO A;  2PJ0 A;  1LFW A;  3WAB A;  5HXD A;  4UEF A;  1R3N A;  3V8I A;  1Z8W A;  2EBJ A;  2Q0Y A;  3D4U A;  3EO4 A;  4MFK A;  1P0H A;  1S60 A;  2FSR A;  4L8A A;  2Z3M A;  4W9Y A;  4NGT A;  3TX8 A;  4B12 A;  4CRY B;  4EVY A;  1AYE A;  1I1D A;  4F0X A;  4B5P A;  4ZY0 A;  1SPV A;  3ISX A;  1YW6 A;  2PVV A;  2W2G A;  2JDC A;  2JZF A;  4KSA A;  4MRI A;  4OIW A;  1Y7R A;  4C7I A;  4A95 A;  3G3S A;  6CPA A;  3SHP A;  1QSM A;  1TY8 A;  5LYI A;  5K8P A;  1Q7L A;  1L0C A;  1GHE A;  4PK3 A;  3IC1 A;  5HIH A;  1IU8 A;  1IGB A;  2VXK A;  2C6C A;  5KTC A;  3B8G A;  4NGN A;  2FIW A;  2VRI A;  1ZR3 A;  1VGY A;  3V45 A;  4U9Y A;  4K3N A;  8CPA A;  3CDX A;  2OZH A;  4R57 A;  2Z3L A;  2JBJ A;  3PGP A;  4C2Y A;  4FD7 A;  3GLJ A;  4ZY2 A;  2ABZ A;  2AFO A;  3ISZ A;  4H89 A;  3FXT A;  4MFL A;  5AIL A;  4XNH B;  3DGV A;  5BWA B;  4M3S A;  4MJ8 A;  2P6G A;  2NSM A;  4MFP A;  2BOA A;  3T9Y A;  5C82 A;  4FD6 A;  4A37 A;  2ACF A;  1CPX A;  1IID A;  3A9L A;  2CNM A;  3DR6 A;  1BOB A;  4UCN A;  4CAF A;  4ZX8 A;  3N5F A;  5IV0 A;  4KOY A;  1IB1 E;  2PR8 A;  3H4Q A;  5K8M A;  4ZI6 A;  4OID A;  4FUU A;  4NFR A;  2GLJ A;  3ZJ0 A;  5A28 A;  4A31 A;  2EK8 A;  3NE7 A;  4ZBG A;  4ORF A;  3R96 A;  2AE6 A;  2IJZ A;  5F48 A;  2BCO A;  2OU2 A;  2ZOG A;  1ZO0 A;  3I3G A;  4PPZ A;  3IIB A;  3R1K A;  2DXQ A;  1DE4 C;  1S7N A;  3D2M A;  4PXB A;  1ON0 A;  1YD9 A;  4CYP A;  4FAI A;  4GVV A;  1OZP A;  3BXM A;  5IX3 A;  1Z4R A;  2VBQ A;  1J4J A;  3KHZ A;  4H6Z A;  3HLP A;  2HC9 A;  1KUX A;  3B3V A;  4F8Z A;  5CB3 A;  5JM6 A;  2ZEG A;  2ZEP A;  1WK4 A;  2Q04 A;  4HNX B;  1BAV A;  3DLJ A;  4A32 A;  4MHZ A;  1SQH A;  4NF1 A;  2PJB A;  4KUB A;  4CPA A;  1YSJ A;  3GY9 A;  2BFQ A;  2EUI A;  4J5S A;  4J5R A;  2FE7 A;  2ANP A;  4B10 A;  3FVL A;  4DUK A;  5F47 A;  3VWD A;  2RNK A;  4GXH A;  5LRG A;  2Z3N A;  4B5P B;  2AFC A;  1IOF A;  1YX0 A;  2HUZ A;  2OR4 A;  2JBK A;  4FWU A;  2JZE A;  1KZF A;  1MK4 A;  3P2H A;  4E0A A;  4KZT A;  4UIA A;  1IOI A;  4LX9 A;  1MJB A;  1H8L A;  5FSX A;  1AUG A;  4UFX A;  2PJ2 A;  2O4H A;  3K2K A;  1LAN A;  4GVW A;  2WZN A;  3SXN A;  3S9M A;  3LD2 A;  4H6U A;  1M4G A;  3SI0 A;  4KLV A;  1BO4 A;  1S7F A;  2Q43 A;  4IF5 A;  2R8V A;  4R8F A;  2IL4 A;  3V7Z A;  3RAM A;  2DPS A;  2V8H A;  2ZEF A;  3GQO A;  3PP9 A;  3CT9 A;  1PUA A;  3NH8 A;  3GUX A;  4K30 A;  3BJ7 A;  4CAX A;  1HDQ A;  3IJ3 A;  4QVT A;  3BI1 A;  2Q7S A;  4CGM A;  3VAR A;  3FX6 A;  3W91 A;  3FED A;  2K5T A;  5LYL A;  3GPO A;  2YNC C;  2AJ6 A;  2BFR A;  4R6T A;  4NEX A;  1NMT A;  4B11 A;  4YU9 A;  2ZXV A;  5D8N A;  4ESS A;  4XPD C;  4A33 A;  4JXQ A;  1TF9 A;  3GB0 A;  2C27 A;  3FB3 A;  2Q4V A;  3I9S A;  4KVO E;  4NSQ A;  3TO6 A;  4QC6 A;  4OC2 A;  2HQY A;  4AVC A;  5HH1 A;  3RO0 A;  1XOV A;  4XNH C;  2ZEH A;  4OC1 A;  1IYK A;  1ZLI A;  4KOX A;  4NGS A;  1MJ9 A;  4IK2 A;  4NGM A;  3K9T A;  2PJ4 A;  4CAV A;  3H8G A;  3D7G A;  4M6H A;  4TWE A;  3D7F A;  4UML A;  2I3C A;  3F5B A;  4UA3 A;  4AVB A;  4C2X A;  5F09 A;  1ZR5 A;  1B6B A;  2PDO A;  1IIC A;  4P4E A;  3TO9 A;  3BLN A;  5FSZ A;  3GPQ A;  4OP4 A;  3D3S A;  4KYB A;  1M1D A;  1LAM A;  3LMS A;  5THW A;  2DF5 A;  3WC5 A;  4OAD A;  2OB0 A;  3OWC A;  1Y0R A;  3PB4 X;  1IYL A;  2I79 A;  4OLL A;  3IU2 A;  2VZY A;  2H5M A;  4UBR A;  4P44 A;  4EWT A;  3DDD A;  1Q2C A;  4MFQ A;  3PRT A;  2FL4 A;  2PJ8 A;  5G22 A;  3KKW A;  3NH4 A;  4OC3 A;  4KVM E;  1OBR A;  1B87 A;  3EJG A;  3IWW A;  1XF8 A;  4E2A A;  1Y9W A;  2YGW A;  2ZEL A;  3MGD A;  4PK2 A;  2PC1 A;  3EWQ A;  3LAC A;  2ARH A;  2WPX A;  1VHS A;  2Z3O A;  4NGR A;  5CNP A;  1U6M A;  3JTK A;  3N7Z A;  4BBH A;  4ZGY B;  2BO9 A;  1KUY A;  2V8G A;  1QSO A;  2JDD A;  1TXZ A;  4KS9 A;  2P6E A;  2A4N A;  1Z9U A;  2ZPA A;  2PRQ A;  3T90 A;  4CGL A;  2G0B A;  2PJ7 A;  1FY7 A;  1AMP A;  3PB9 X;  2PQ8 A;  3B3W A;  4J4Z A;  3RNZ A;  2AFS A;  4CAE A;  4DNC A;  4MY3 A;  5C88 A;  1M4L A;  3Q6Z A;  1YME A;  2GAN A;  2P6F A;  4Y49 C;  3TOA A;  3WC7 A;  4K0C A;  3R9E A;  4IQY A;  1BPM A;  1JWQ A;  2FCK A;  3CZX A;  5DS0 A;  1QMU A;  1Z5R A;  4KUA A;  2BSW A;  4MBU A;  1ZG7 A;  3PEI A;  4KOT A;  4MHP A;  2L8R A;  2GLF A;  4NCZ A;  3QNV A;  2FAV A;  4UEZ A;  1XRY A;  2ZW6 A;  4X5K A;  1S3Z A;  4JZ0 A;  2ZW7 A;  4R9M A;  3BJ8 A;  4F9V A;  5J8F A;  2X47 A;  2FXF A;  4MFJ A;  2FG1 A;  5G1Z A;  2J9A A;  1NSA A;  4JWP A;  2C6P A;  2PIZ A;  3H8E A;  2J8R A;  2GFQ A;  3FJU A;  3D2P A;  2PRB A;  3NE8 A;  3D7H A;  1YVK A;  4KSF A;  5G21 A;  4P45 A;  2PJ5 A;  3EC4 A;  3VAT A;  1TKF A;  4PV6 A;  3CXP A;  1FNO A;  3CPX A;  2JZD A;  2B58 A;  1Z8L A;  2OH1 A;  2FT0 A;  1LAP A;  3SJF A;  1JQG A;  3KL9 A;  1YRE A;  2PJA A;  3R9F A;  3DR8 A;  2RB7 A;  2XEF A;  4JLL A;  3PZJ A;  1S5K A;  1ZG8 A;  2CTC A;  2PR1 A;  4JD6 A;  3CXS A;  3D67 A;  3EKE A;  2B5G B;  4KLW A;  3W6X A;  4KSI A;  4ZX9 A;  3K9U A;  4C68 A;  1I12 A;  5G20 A;  3EXN A;  5HVH A;  4IAV A;  3B35 A;  3SIH A;  1TIQ A;  2Q4Y A;  2R1I A;  4UWJ A;  4RUH A;  1XEB A;  4JLY A;  3KHX A;  1HEE A;  1CM0 A;  4JYW A;  1A2Z A;  4R87 A;  2O28 A;  4P4F A;  2AFM A;  5CPA A;  4DJL A;  4JCA A;  3KAS A;  2REE A;  3FMC A;  3B3C A;  4UFW A;  4ZYQ A;  1RO5 A;  1XJO A;  4P6Y A;  2EK9 A;  1ZG9 A;  1X10 A;  5HVF A;  5JPH A;  1ELL P;  2WUU A;  4YFJ A;  4MCR A;  3VFQ A;  1NSL A;  4KOU A;  4ETK A;  4Q36 A;  3IU1 A;  2V8V A;  5EBV A;  4R76 A;  3PBE A;  2WSA A;  4UCP A;  5I0C A;  1Q2D A;  4BD9 A;  4CYQ A;  3IWE A;  1VHU A;  4IHM A;  3EWO A;  1Y9K A;  2VL1 A;  3D7D A;  4XPK A;  2ZEE A;  4MMO A;  2PE3 A;  4Y49 B;  1XFO A;  1YR0 A;  1HDU A;  2P0W A;  4H2K A;  2R7H A;  2B4D B;  5A27 A;  2Z3P A;  3TCV A;  5K8N A;  3EY5 A;  2AFX A;  4NJQ A;  4CGO A;  1R43 A;  4C7H A;  4LUA A;  2B5G A;  1QSN A;  1RXT A;  3NA6 A;  2B4B A;  4MFZ A;  4R3L A;  5FSY A;  2GE3 A;  2XD7 A;  2B4D A;  1I21 A;  4CYN A;  2IQ6 A;  2QIR A;  3JRU A;  5FSU A;  4LQ6 A;  2QYV A;  3TTH A;  3B3T A;  4UWI A;  3KQX A;  3KQZ A;  1M4D A;  3NH5 A;  4XPD B;  4KOR A;  5F49 A;  5CB5 A;  3FYN A;  5H84 A;  3VH9 A;  5I4M A;  2D4P A;  4AB7 A;  3E0K A;  4KOS A;  3PB8 X;  2PJ1 A;  1M4I A;  4NJR A;  3S6F A;  4J5Q A;  2YNE A;  1LRZ A;  4NXY A;  3ZZI A;  1VIX A;  4TNU A;  2B3U A;  4M6I A;  5LRJ A;  4BMH A;  1GYT A;  4G1P A;  2OOT A;  3FF3 A;  4XPL A;  2JEV A;  1PYT B;  4OAE A;  1Z4E A;  3EJF A;  4X3R A;  4J3G A;  5EC4 A;  3DNS A;  2BUE A;  2CXA A;  4X2T A;  1HJZ A;  1TF8 A;  4RI1 A;  4AG9 A;  1CJW A;  4P10 A;  3PBB A;  1TKH A; 
#chains in the Genus database with same CATH homology
 4MHY A;  1UWY A;  4ONW A;  1CPS A;  4P4D A;  3RBU A;  4LQG A;  2ZEO A;  2GU2 A;  4MCQ A;  4F9U A;  3SII A;  3H8F A;  3I1U A;  1CP7 A;  5HVG A;  5JGF A;  2C1C A;  5IB9 A;  4MXU A;  5DUS A;  3FEC A;  4EFD A;  1QQ9 A;  4A94 A;  3KGQ A;  2FVG A;  3B3S A;  3RZA A;  4OC4 A;  1ARM A;  1Z2L A;  4PQA A;  2PJ9 A;  3KZW A;  5FSV A;  3GPG A;  1YW4 A;  4PXD A;  2V8D A;  3SI2 A;  3S9L A;  1KWM A;  5K8O A;  1XBU A;  1CBX A;  4TU0 A;  2QJ8 A;  4AXV A;  4OKO A;  2AFW A;  4EME A;  3ETI A;  1PCA A;  3B2Y A;  1F2P A;  3PFE A;  2PCU A;  3PB6 X;  1LOK A;  7CPA A;  3FEE A;  3EWP A;  1VHO A;  3WC6 A;  4YWY A;  2C6G A;  3FH4 A;  1ELM P;  3SJE A;  2XEI A;  5JH9 A;  4R7M A;  4X8I A;  3V2B A;  3Q71 A;  4JGK A;  3T8W A;  4ETJ A;  1YLO A;  1VHE A;  4GM5 A;  1Y0Y A;  4NGQ A;  1F57 A;  3SIG A;  1FT7 A;  1XMB A;  4A39 A;  2PJ6 A;  4OC5 A;  1EE3 P;  2ZOF A;  3V38 A;  2Q51 A;  2F8H A;  2Q4Z A;  1TKJ A;  4PXC A;  2FXK A;  3LWU A;  4P4B A;  2DX6 A;  3SIJ A;  2G9D A;  2F7V A;  1RTQ A;  4UF4 A;  1TXR A;  4UIB A;  4JVV A;  2PIY A;  2ZED A;  4MHN A;  4ABK A;  1CP6 A;  3BI0 A;  2O53 A;  2ZEN A;  2PJC A;  5ELY A;  3D68 A;  5E3B A;  2WYR A;  2XEJ A;  2HB6 A;  4B6Z A;  2CIJ A;  4ZY1 A;  1ZLH A;  4A38 A;  3CPA A;  2EWB A;  3IEH A;  3PFO A;  1F2O A;  5D29 A;  4P4I A;  2JEW A;  4ABL A;  2NYQ A;  3EW5 A;  3L2N A;  4WWV A;  3EWR A;  3SI1 A;  3S9N A;  2EEE A;  4UEE A;  1NJR A;  2PVW A;  2AFU A;  3TC8 A;  2PJ3 A;  3PB7 X;  5HOL A;  3BHX A;  2CTB A;  4MCP A;  4Q7A A;  4DYO A;  5LYD A;  2LGR A;  2RFH A;  1CG2 A;  4O23 A;  1DTD A;  3WT4 A;  4D86 A;  5LYF A;  3KR4 A;  5CBM A;  2AFZ A;  3HUV A;  4FBE A;  3KI9 A;  4OC0 A;  4P4J A;  2GRE A;  3IFE A;  3MN8 A;  3JZT A;  2DEA A;  1ARL A;  2POK A;  2V77 A;  3IO1 A;  3SJG A;  1BPN A;  3D66 A;  4PXE A;  2QVP A;  1IY7 A;  2XEG A;  3IID A;  2CF4 A;  2ZEM A;  3NFZ A;  3SJX A;  1BLL E;  1Y7E A;  3MRU A;  5J1Q A;  2IMO A;  4WJB A;  3KR5 A;  4OME A;  4Z65 A;  3GQE A;  5CMS A;  3IIF A;  5LRK A;  4MCS A;  1LCP A;  3B7I A;  4GUA A;  4NGP A;  1CX8 A;  5HXD A;  2PJ0 A;  1LFW A;  3WAB A;  4UEF A;  1R3N A;  3D4U A;  4W9Y A;  4NGT A;  3TX8 A;  1AYE A;  3ISX A;  4ZY0 A;  1SPV A;  1YW6 A;  2PVV A;  4OIW A;  4MRI A;  6CPA A;  1TY8 A;  5LYI A;  5K8P A;  1Q7L A;  3IC1 A;  5HIH A;  1IGB A;  2C6C A;  4NGN A;  2VRI A;  1ZR3 A;  1VGY A;  3V45 A;  4K3N A;  8CPA A;  3CDX A;  2JBJ A;  3GLJ A;  4ZY2 A;  2ABZ A;  2AFO A;  3ISZ A;  5AIL A;  3DGV A;  2NSM A;  2BOA A;  4A37 A;  2ACF A;  1CPX A;  4ZX8 A;  3N5F A;  5K8M A;  4ZI6 A;  4OID A;  4FUU A;  4NFR A;  2GLJ A;  2EK8 A;  2IJZ A;  2BCO A;  2ZOG A;  4PPZ A;  3IIB A;  4FAI A;  1DE4 C;  4PXB A;  1YD9 A;  4GVV A;  3BXM A;  3KHZ A;  3HLP A;  2HC9 A;  3B3V A;  4F8Z A;  5CB3 A;  5JM6 A;  2ZEG A;  2ZEP A;  1BAV A;  3DLJ A;  4MHZ A;  2PJB A;  4CPA A;  1YSJ A;  2BFQ A;  4J5S A;  4J5R A;  2ANP A;  4DUK A;  3FVL A;  5LRG A;  2AFC A;  4FWU A;  2OR4 A;  2JBK A;  4UIA A;  1H8L A;  5FSX A;  2PJ2 A;  2O4H A;  3K2K A;  1LAN A;  4GVW A;  2WZN A;  3S9M A;  3SI0 A;  2Q43 A;  3V7Z A;  4R8F A;  3RAM A;  2V8H A;  2ZEF A;  3GQO A;  3CT9 A;  3NH8 A;  3GUX A;  1HDQ A;  3IJ3 A;  3BI1 A;  3VAR A;  3FX6 A;  3FED A;  5LYL A;  3GPO A;  2BFR A;  4R6T A;  4YU9 A;  5D8N A;  4ESS A;  1TF9 A;  3GB0 A;  4OC2 A;  2ZEH A;  4OC1 A;  1ZLI A;  4NGM A;  4NGS A;  4IK2 A;  3K9T A;  2PJ4 A;  3H8G A;  3D7G A;  4TWE A;  3D7F A;  4UML A;  2I3C A;  5F09 A;  1ZR5 A;  4P4E A;  5FSZ A;  3GPQ A;  4OP4 A;  4KYB A;  1LAM A;  3LMS A;  5THW A;  3WC5 A;  1Y0R A;  3PB4 X;  4P44 A;  4EWT A;  3PRT A;  2PJ8 A;  3NH4 A;  4OC3 A;  1OBR A;  3EJG A;  3IWW A;  2ZEL A;  3EWQ A;  4NGR A;  2BO9 A;  2V8G A;  1TXZ A;  2PRQ A;  2PJ7 A;  1AMP A;  3PB9 X;  3B3W A;  4J4Z A;  2AFS A;  1M4L A;  3Q6Z A;  1YME A;  3WC7 A;  4K0C A;  4IQY A;  1BPM A;  5DS0 A;  1QMU A;  1Z5R A;  1ZG7 A;  3PEI A;  4MHP A;  2L8R A;  2GLF A;  3QNV A;  2FAV A;  4UEZ A;  1XRY A;  4JZ0 A;  4F9V A;  2X47 A;  2FG1 A;  2J9A A;  1NSA A;  2C6P A;  2PIZ A;  3H8E A;  3FJU A;  3D7H A;  4P45 A;  2PJ5 A;  3VAT A;  1TKF A;  1FNO A;  3CPX A;  1Z8L A;  1LAP A;  3SJF A;  1JQG A;  3KL9 A;  2PJA A;  2RB7 A;  2XEF A;  4JLL A;  1ZG8 A;  2CTC A;  3D67 A;  3EKE A;  4KSI A;  4ZX9 A;  5HVH A;  4IAV A;  3B35 A;  3SIH A;  4RUH A;  3KHX A;  1HEE A;  4JYW A;  4P4F A;  5CPA A;  2AFM A;  4DJL A;  4JCA A;  3KAS A;  3FMC A;  3B3C A;  4ZYQ A;  1XJO A;  4P6Y A;  2EK9 A;  1ZG9 A;  5HVF A;  1ELL P;  4MCR A;  3VFQ A;  4ETK A;  2V8V A;  4R76 A;  3PBE A;  4BD9 A;  1VHU A;  4IHM A;  3EWO A;  2VL1 A;  3D7D A;  2ZEE A;  4MMO A;  2PE3 A;  1XFO A;  1HDU A;  4H2K A;  5K8N A;  2AFX A;  4NJQ A;  1R43 A;  3NA6 A;  5FSY A;  2XD7 A;  2IQ6 A;  3JRU A;  5FSU A;  2QYV A;  3B3T A;  3KQX A;  3KQZ A;  3NH5 A;  5CB5 A;  3VH9 A;  5I4M A;  3PB8 X;  2PJ1 A;  4NJR A;  4J5Q A;  1VIX A;  4TNU A;  5LRJ A;  1GYT A;  4G1P A;  2OOT A;  3FF3 A;  1PYT B;  3EJF A;  4X3R A;  4X2T A;  1HJZ A;  1TF8 A;  4P10 A;  3PBB A;  1TKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...