3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
1XRYA 2AFZA 2PJ1A 3HUVA 1M4LA 3NFZA 4WWVA 2BFQA 3B35A 3BXMA 4K3NA 3FF3A 3CPAA 3L2NA 2AFUA 4P4IA 1FT7A 2J9AA 5DS0A 4NGPA 2CF4A 3SI1A 2X47A 4UEFA 2CTCA 3CT9A 3KQXA 5I4MA 2JBJA 4R76A 5HVFA 1VHUA 4R7MA 5HVHA 1XMBA 4YU9A 4FAIA 1AMPA 2OOTA 1F2OA 2EK9A 4OC4A 1LAMA 3EWRA 1CBXA 1EE3P 3WC6A 1TKJA 4A37A 4GVVA 5D29A 3K9TA 3LWUA 2PJ8A 5F09A 1CPSA 2PE3A 4OC2A 2O4HA 3V7ZA 3S9LA 1DE4C 2DEAA 4A38A 2XEFA 2PJ2A 5JGFA 4UEZA 4ZY2A 2FVGA 5LYFA 2XD7A 1SPVA 1TKHA 4UMLA 3D68A 2FG1A 1YLOA 3KASA 4NGNA 5FSXA 4ZY1A 1R3NA 3B3CA 2ZEMA 2BO9A 1PYTB 5K8OA 2PJAA 1F57A 2CTBA 2CIJA 3DGVA 2NSMA 3EW5A 3EKEA 4UIAA 4YWYA 2HC9A 4GUAA 4GM5A 3B3SA 1QMUA 2BOAA 4ZY0A 2IJZA 5CB5A 3D7GA 1QQ9A 2PJ3A 3BHXA 2PRQA 3FH4A 3V2BA 1BPMA 3FVLA 4UIBA 4NGTA 3Q71A 1LOKA 4JGKA 1TY8A 1VGYA 4D86A 4LQGA 4ZX8A 2PJ6A 3PFEA 4OIWA 5K8PA 1LFWA 3NA6A 1TF8A 4X8IA 2QVPA 4MCPA 1F2PA 4MHNA 1FNOA 3VATA 1YW6A 3FJUA 2F8HA 3S9MA 4MXUA 1XBUA 1LCPA 4MHPA 4W9YA 3PRTA 2VL1A 3FEEA 3PB9X 4JLLA 3GLJA 5HVGA 4IHMA 3PBBA 4OC0A 4P4EA 4P6YA 3GPOA 3KQZA 5LRJA 4F9VA 5LYIA 4PXDA 1PCAA 3FMCA 1ARMA 2V8DA 3KGQA 4P4DA 3H8FA 5FSZA 2PIZA 3IJ3A 5K8NA 4DYOA 3MN8A 3B7IA 1LAPA 2XEIA 3WABA 2NYQA 2ZENA 1Y7EA 2PJ5A 4NJRA 2FAVA 3IIDA 4J4ZA 4A94A 3BI0A 4RUHA 2IQ6A 2PJBA 3EJGA 4ONWA 3CDXA 4H2KA 2AFXA 3IO1A 1YSJA 2ZOGA 2ZEOA 4NJQA 2V77A 4OC1A 3SJGA 4BD9A 3S9NA 5CBMA 3D67A 3D7DA 3B3TA 5THWA 4TU0A 3KR4A 5K8MA 1ZR3A 1Y0RA 3K2KA 3D4UA 2Q43A 2HB6A 2XEGA 2GLJA 3PB7X 4Z65A 2Q4ZA 4NGMA 4P4JA 3D7FA 4B6ZA 4MCQA 2AFSA 1CP6A 1Z8LA 2I3CA 4GVWA 1H8LA 3DLJA 4MCSA 3NH4A 2LGRA 3WC5A 2ACFA 3D66A 3VH9A 1CG2A 4J5SA 5AILA 1OBRA 4Q7AA 1NJRA 4JVVA 4ZX9A 4NGQA 2PIYA 4EFDA 4PXCA 3B3VA 4TWEA 5CPAA 2GREA 3LMSA 3NH8A 5DUSA 1VHOA 3FEDA 4P10A 4EMEA 3RZAA 3IC1A 1ELLP 3RAMA 2ZEDA 5IB9A 4DUKA 3VFQA 2BCOA 4OP4A 4MHYA 3IWWA 1CPXA 3RBUA 2V8HA 4OKOA 1Z2LA 4AXVA 1ZLHA 1KWMA 1XFOA 3TC8A 4X2TA 2ZEGA 1Q7LA 2JEWA 4OC3A 3MRUA 3KHXA 4FBEA 3V38A 5JH9A 5FSYA 3I1UA 3GPGA 4ABKA 2O53A 3GB0A 3ETIA 2PVVA 3VARA 2PVWA 1HDUA 3SI0A 2QYVA 4UEEA 3ISZA 1YW4A 2ZELA 4TNUA 1NSAA 2Q51A 2EWBA 4P4FA 2EK8A 3KR5A 1UWYA 3IIFA 3PB8X 4OIDA 1TKFA 3SIJA 2GLFA 3EJFA 4P4BA 5J1QA 4KSIA 2C6PA 4OC5A 4ETJA 3PB4X 4MMOA 4NGRA 4IQYA 1ZR5A 5HIHA 4UF4A 4IK2A 3T8WA 4MHZA 4OMEA 4ABLA 4PQAA 3KL9A 5D8NA 3IIBA 4CPAA 4FWUA 3Q6ZA 4O23A 2JBKA 3KZWA 2XEJA 1IGBA 4X3RA 3SJXA 1HDQA 5FSVA 3FECA 2PCUA 1AYEA 3SIHA 2GU2A 8CPAA 2BFRA 4MCRA 1YMEA 2PJ0A 4PXEA 2PJCA 1HEEA 5E3BA 4K0CA 1GYTA 2PJ4A 4JZ0A 2ZEHA 4PPZA 3B2YA 3FX6A 1ARLA 2EEEA 2RFHA 5FSUA 4ETKA 2L8RA 2AFCA 2C6GA 3KHZA 2AFOA 3GPQA 1R43A 4PXBA 2DX6A 1ZG7A 3B3WA 2ZEFA 3PFOA 4J5RA 5CB3A 1LANA 3NH5A 4KYBA 4R6TA 2OR4A 1JQGA 1ELMP 4NGSA 3ISXA 1CX8A 2G9DA 2ANPA 5LYDA 1ZG8A 3H8GA 3PEIA 1CP7A 4A39A 4J5QA 1BAVA 1VIXA 3GQEA 4IAVA 4ESSA 2AFWA 1YD9A 1TF9A 3SIIA 1XJOA 2VRIA 4NFRA 4WJBA 3GQOA 2C1CA 4DJLA 3H8EA 2QJ8A 5JM6A 7CPAA 4R8FA 3TX8A 2V8VA 3EWPA 3SIGA 5LRGA 1TXRA 2ZEEA 3SI2A 2V8GA 3N5FA 1VHEA 3EWOA 4ZI6A 1HJZA 4ZYQA 1ZG9A 2IMOA 3BI1A 3IEHA 5HXDA 5HOLA 2RB7A 3PBEA 2AFMA 1BPNA 4JCAA 5LYLA 2FXKA 3V45A 3QNVA 3KI9A 4G1PA 4FUUA 1IY7A 1Y0YA 3SJEA 1ZLIA 1BLLE 3D7HA 3SJFA 2ZEPA 4P45A 2POKA 2WYRA 5ELYA 3IFEA 2C6CA 3HLPA 2ZOFA 4JYWA 1TXZA 3PB6X 1Z5RA 3GUXA 2F7VA 4MRIA 5LRKA 3WC7A 2ABZA 1DTDA 3CPXA 6CPAA 2WZNA 4EWTA 4F8ZA 3WT4A 3JRUA 3JZTA 2PJ7A 3EWQA 4F9UA 5CMSA 1RTQA 2PJ9A 4P44A
chains in the Genus database with same CATH superfamily
4MFKA 4B10A 1XRYA 4KOSA 2AFZA 3FXTA 5KTCA 1KUVA 4L89A 2PJ1A 1Z9UA 3HUVA 1M4LA 2VQYA 4E2AA 2I00A 1XE4A 3NFZA 4WWVA 3I3GA 2H5MA 1IU8A 2BFQA 1YGHA 2I79A 3B35A 3BXMA 3R9GA 4C2YA 4K3NA 1J4JA 4ORFA 3FF3A 3CPAA 3L2NA 1VHSA 2AFUA 3DR8A 4KSAA 4J3GA 2EBJA 4P4IA 1QSTA 1QSOA 1FT7A 3BJ8A 2J9AA 5DWMA 2WCTA 3I9SA 5DS0A 2OZHA 4MJ8A 2CF4A 4NGPA 2Z3PA 4PSXA 3SI1A 2X47A 3FB3A 4UEFA 3CZXA 2CTCA 2FS5A 3CT9A 1YQEA 4KLWA 3KQXA 4Q36A 4QC6A 2Z3MA 4A2ZA 3R96A 5I4MA 2JBJA 4BINA 1NSLA 4R76A 5HVFA 5CNPA 1VHUA 4HNXB 4R7MA 2JDDA 5HVHA 1MK4A 2REEA 4UFWA 2PC1A 4MBUA 1XMBA 2YNCC 4YU9A 2QMLA 5EMIA 1YK3A 4FAIA 1AMPA 2OOTA 4XPKA 1F2OA 3DNSA 4KS9A 1M4IA 3RYOA 2EK9A 4OC4A 1LAMA 3EWRA 1OZPA 1RXTA 3DR6A 1CBXA 1EE3P 3WC6A 1TKJA 2WPWA 4MFLA 4A37A 4H6ZA 4GVVA 5D29A 3K9TA 3LWUA 1M4DA 2PJ8A 5F09A 1CPSA 2GE3A 4PK2A 2PE3A 5F46A 4OC2A 3UY5A 2O4HA 3V7ZA 3LODA 5EC4A 3S9LA 3EY5A 2FIWA 4OAEA 1XEBA 2OZGA 1DE4C 2DEAA 4A38A 3P2FA 2XEFA 1S3ZA 1GHEA 3PZJA 2PJ2A 4YGOA 5BWAB 5JGFA 4B5OA 3T9YA 4A95A 4UEZA 4ZY2A 2FVGA 2YNDA 3W6XA 5LYFA 4MFZA 4CRZB 2XD7A 4U5YA 3W91A 1SPVA 4ZBGA 4ZGYB 1TKHA 2HUZA 4UMLA 2GIVA 3D68A 1WK4A 4NF1A 2FG1A 1YLOA 1XF8A 3KASA 4MHDA 1ON0A 4NGNA 5FSXA 4ZY1A 3T90A 1R3NA 3B3CA 2IL4A 2ZEMA 1XMTA 1PYTB 2BO9A 5K8OA 2PJAA 2Z11A 3QAHA 1F57A 4B5PA 5J8FA 2CTBA 2DPSA 1YVKA 2PDOA 4CAEA 2CIJA 4IUSA 4DNCA 3DGVA 2NSMA 1XOVA 3EW5A 4U9ZA 5AG7A 3EKEA 4UIAA 4YWYA 3S6GA 1MJBA 4EVYA 2DXQA 2R98A 4KOVA 2HC9A 4GS4A 4GUAA 2YNCA 4GM5A 3B3SA 4CYNA 1QMUA 2BOAA 4ZY0A 2IJZA 4M6HA 3SXOA 3V8IA 4UA3A 4HNWB 5CB5A 1M44A 1CJWA 3D7GA 4CYOA 1QQ9A 2PJ3A 3BHXA 2PRQA 3FH4A 4KOXA 3V2BA 1BPMA 3FVLA 4KUBA 1TIQA 3CXQA 4UIBA 2NMTA 3TO7A 4NGTA 3Q71A 4JXRA 1JWQA 4JWPA 2J8NA 1LOKA 4JGKA 1TY8A 2FL4A 3B8GA 1VGYA 4D86A 4IF5A 4LQGA 4U9YA 1ZO0A 4ZX8A 2PJ6A 3PFEA 4OIWA 5K8PA 2BSWA 2P0WA 2FXFA 2JZFA 1LFWA 5JPHA 3NA6A 2BL1A 4UFVA 1TF8A 1Q2CA 4X8IA 2VI7A 2Q7SA 5E96A 4KOTA 5JQ4A 2QVPA 1Z8XA 4MCPA 1F2PA 4MHNA 1FNOA 3VATA 1QSMA 1YW6A 2C27A 3FJUA 2P6EA 2F8HA 4H6UA 3S9MA 4MXUA 3EFAA 4Y49C 1IOFA 1LCPA 1XBUA 2PSWA 4MHPA 4W9YA 3RNZA 3PRTA 2VL1A 1R57A 3D2PA 4R3LA 3FEEA 2B4DB 3PB9X 4JLLA 3GLJA 2Y0MA 4M6IA 3FBUA 3PP9A 2ZW6A 2AJ6A 2CY2A 3DDDA 5HVGA 5IX3A 4IHMA 3PBBA 4X5KA 4CAVA 4OC0A 4P4EA 1IOIA 4P6YA 3GPOA 3KQZA 5LRJA 4UBRA 4F9VA 5LYIA 3SHPA 3D8PA 4PXDA 1PCAA 1S7NA 2Z3KA 3FMCA 1ARMA 4CYPA 2V8DA 3S6KA 4PV6A 3KGQA 4P4DA 3H8FA 5FSZA 1SQHA 2PIZA 1S7LA 4B11A 3IJ3A 3GYAA 3WR7A 5K8NA 4DYOA 2GFQA 1V0CA 3MN8A 3B7IA 1LAPA 2XEIA 3WABA 2NYQA 4M6GA 4XPDC 1Z8WA 2ZW5A 2ZENA 4UCPA 1Y7EA 2PJ5A 5AGEA 4II9A 4L8AA 4NJRA 5J8CA 1IYLA 2FAVA 3IIDA 2ZW7A 5F49A 2JDCA 3VWEA 4J4ZA 4A94A 4A32A 3BI0A 4I49A 4QBJA 4RUHA 2IQ6A 2PJBA 3EJGA 2P6GA 4ONWA 5KTDA 3CDXA 2EO8A 1Q2DA 4H2KA 5H84A 2AFXA 2Q0YA 4F0XA 1MJ9A 3IU1A 3IO1A 4FD4A 4JLYA 4B6ZA 4B14A 1YSJA 4GXHA 3NE8A 4R87A 2ZOGA 4FD6A 2ZEOA 3R9EA 2B3UA 4NJQA 3LACA 2V77A 4OC1A 3CXPA 4OLLA 3SJGA 4JJXA 4BD9A 2G0BA 3S9NA 5CBMA 3D67A 3D7DA 3B3TA 5THWA 4C7HA 4TU0A 4JD6A 4KUAA 4MI4A 4PK3A 4UWJA 1Y9WA 3KR4A 1QSRA 4KORA 1YREA 5K8MA 1ZR3A 1Y0RA 3K2KA 3D4UA 5ISVA 2Q43A 2HB6A 2XEGA 2GLJA 2J8MA 2WSAA 3PB7X 4Z65A 2Z3OA 2Q4ZA 4NGMA 4P4JA 3FYNA 1Z4EA 3D7FA 2Z0ZA 1S7FA 1XIXA 4Y49B 2ARHA 4A30A 2VZZA 4MCQA 4CGNA 2AFSA 4XNHC 1CP6A 1Z8LA 5KTAA 2I3CA 4GVWA 1H8LA 2D4PA 3DLJA 4MCSA 1A2ZA 2LGRA 3DSBA 3NH4A 3WC5A 2ACFA 2PR1A 2AE6A 3D66A 3IWEA 4R3KA 2JEVA 3VH9A 1CG2A 4J5SA 5AILA 1OBRA 1PUAA 1NJRA 4JVVA 4ZX9A 2RC4A 4NGQA 4Q7AA 4CS0B 2PIYA 4EFDA 1S5KA 3B3VA 4PXCA 4TWEA 3F5BA 5CPAA 1S7KA 1YR0A 4B5PB 2GREA 3LMSA 3NH8A 2PQ8A 2REFA 2GANA 5DUSA 1VHOA 1WWZA 2EUIA 3D2MA 3FEDA 3H4QA 4P10A 5G21A 4EMEA 3RZAA 4CYQA 3IC1A 1ELLP 1YLEA 4XPDB 4UWIA 2CNSA 2FE7A 3TFYA 2WPXA 3RAMA 2ZEDA 4AB7A 2JLMA 5IB9A 4KVOE 4DUKA 3VFQA 3NE7A 2BCOA 4OP4A 2Q44A 4MHYA 3RO0A 3IWWA 1CPXA 3RBUA 2P6FA 3GY9A 4QB9A 2V8HA 5G1ZA 2R7HA 2Z3NA 1Z2LA 4OKOA 2R1IA 1Y7RA 4AXVA 1ZLHA 1KWMA 1XFOA 3R1KA 3TC8A 3FRMA 3A9LA 4LX9A 4X2TA 2ZEGA 3PGPA 1Q7LA 4MFQA 4F6AA 2JEWA 1Z8TA 4OC3A 3MRUA 3KHXA 4HPSA 2PRBA 4KSFA 4FBEA 3V38A 3TTHA 5FSYA 5JH9A 2Q4YA 3I1UA 3GPGA 4ABKA 1VKCA 2O53A 3GB0A 3QAYA 3ETIA 2PVVA 4RN7A 5G20A 4CGPA 3VARA 2PVWA 1HDUA 4KOWA 3SI0A 2QYVA 2CXAA 4UEEA 2CNTA 3ISZA 4LUAA 4YFJA 1YW4A 2ZELA 2B4DA 4TNUA 3S6FA 3G3SA 1NSAA 4AVAA 4C2XA 2Q51A 4KOYA 1YX0A 4QUSA 2JZDA 2YGWA 4BBHA 2EWBA 4AVCA 4P4FA 2EK8A 3KR5A 1UWYA 3N7ZA 2ZXVA 3IIFA 3PB8X 4M85A 2DPTA 2G3AA 4OIDA 1TKFA 2OH1A 2PR8A 3SIJA 3IU2A 4XNHB 2OB0A 2GLFA 4KZTA 3EJFA 4P4BA 5J1QA 1FY7A 4KSIA 4AVBA 2BUEA 4NEXA 4E8OA 2C6PA 4OC5A 4ETJA 3PB4X 2G3TA 4MMOA 3OWCA 4NGRA 4QVTA 3JVNA 4IQYA 3EO4A 2ODFA 1ZR5A 2Z10A 5HIHA 3GKRA 1AUGA 1IICA 5GCNA 4UF4A 4IK2A 1I21A 3LD2A 3T8WA 2JZEA 5IB0A 4MHZA 3F0AA 4OMEA 4MY0A 4ABLA 4NXYA 4PQAA 3ZZIA 1RO5A 3KL9A 5D8NA 1Y9KA 3CXSA 3IIBA 3IWGA 4CPAA 1BO4A 4C68A 4F0YA 4FWUA 4R9MA 4RI1A 5IV0A 4CGOA 3Q6ZA 4O23A 3S6HA 2JBKA 2OU2A 3KZWA 1KZFA 2XEJA 1IGBA 3W6SA 4X3RA 1BOBA 3SJXA 1HDQA 5FSVA 3FECA 2PCUA 1AYEA 2FT0A 4CRYB 3EC4A 3TO6A 2KCWA 1B87A 1NE9A 4A33A 3SIHA 3D3SA 3E0KA 2CNMA 1KUXA 2GU2A 8CPAA 2BFRA 4MCRA 1YMEA 2PJ0A 3JUWA 4PXEA 1LRZA 5HMNA 5F48A 2PJCA 1HEEA 5E3BA 4K0CA 3R9FA 2K5TA 1MJAA 1GYTA 1I1DA 4KOUA 2PJ4A 4JZ0A 2ZEHA 2EVNA 3B2YA 4PPZA 1Z4RA 3FX6A 4K30A 1ARLA 2BEIA 2EEEA 1QSNA 5FSUA 2RFHA 3IGRA 4ETKA 2L8RA 5AG5A 2AFCA 2B4BA 4RS2A 2C6GA 1IIDA 4MFJA 4A31A 3KHZA 2AFOA 2Q04A 3GPQA 1R43A 4PXBA 3C26A 1M4GA 2DX6A 1ZG7A 3B3WA 5AG4A 5I0CA 2ZEFA 3PFOA 4J5RA 5CB3A 1LANA 1X12A 3NH5A 4KYBA 4C2ZA 2A4NA 2VXKA 4BMHA 4R6TA 1IB1E 2OR4A 1JQGA 1ELMP 2Z3LA 3QB8A 4NGSA 1P0HA 3ISXA 1CM0A 1CX8A 2G9DA 5A28A 2ANPA 5LYDA 1ZG8A 3H8GA 4XPLA 3K9UA 3PEIA 4Q38A 3BLNA 1CP7A 2YNEA 2D4OA 4A39A 4J5QA 2ATRA 2X7BA 1BAVA 1M1DA 3GQEA 1VIXA 4IAVA 4ESSA 3SXNA 2AFWA 3ZJ0A 1YD9A 1TF9A 3SIIA 1XJOA 2VRIA 3KKWA 4NFRA 3GQOA 2C1CA 2B58A 4WJBA 4DJLA 3H8EA 4KVXA 2QJ8A 3TT2A 2W2GA 5JM6A 1UFHA 2FCKA 1L0CA 2F5IA 5C88A 4LQ6A 4CGLA 1B6BA 4B13A 3EXNA 7CPAA 1I12A 4R8FA 3TX8A 2B3VA 2V8VA 5A27A 3EWPA 3SIGA 2RNKA 2VEZA 4PSWA 5G22A 5LRGA 1TXRA 4MY3A 5EBVA 1KUYA 2WUUA 2ZW4A 2J8RA 4NCZA 2ZEEA 3F8KA 4MFPA 3SI2A 2V8GA 3GIUA 2OZUA 2QECA 4FD7A 4ONUA 3TOBA 3N5FA 1VHEA 4UFXA 2B5GA 2QIRA 3TE4A 1P4NA 3EWOA 4ZI6A 2ZPAA 1HJZA 4ZYQA 1ZG9A 3P2HA 2IMOA 3BI1A 3IEHA 4KVME 4UCNA 4C7IA 5HXDA 2HQYA 5HOLA 2RB7A 2VBQA 3PBEA 2AFMA 4OADA 3JTKA 1BPNA 3G8WA 4AG7A 4JCAA 1N71A 3FNCA 5LYLA 4AG9A 2FXKA 3V45A 3QNVA 3KI9A 4G1PA 2B5GB 4YRHA 3BJ7A 1IY7A 1Y0YA 4FUUA 3SJEA 4E0AA 1ZLIA 1BLLE 1PU9A 1YVOA 2HV2A 2ZEPA 3D7HA 4P45A 2POKA 3SJFA 1K4JA 2WYRA 1S60A 5ELYA 1Q2YA 3IFEA 5DWNA 1U6MA 5FVJA 2C6CA 3HLPA 2ZOFA 4JYWA 4FD5A 1TXZA 2KQVA 1Z5RA 3H5ZA 3PB6X 4UCMA 5AG6A 5F47A 3MGDA 2Q7BA 4HKFA 3TCVA 2Q4VA 4CAXA 2DF5A 5HH1A 3GUXA 4JXQA 2F7VA 2R8VA 4MRIA 3R95A 3TOAA 3WC7A 5LRKA 2ABZA 1DTDA 4KLVA 4CAWA 3CPXA 1IYKA 3FIXA 3TO9A 1X10A 2WZNA 6CPAA 4M3SA 4EWTA 4R57A 3WT4A 2FSRA 4CAFA 4F8ZA 3VWDA 3JRUA 3JZTA 2FIAA 2O28A 5H86A 2PJ7A 5C82A 4H89A 3EWQA 2VZYA 4NSQA 4B12A 4CGMA 4F9UA 4HNYB 1NMTA 5CMSA 1RTQA 2PJ9A 4P44A
chains in the Genus database with same CATH topology
1XRYA 2AFZA 2PJ1A 3HUVA 1M4LA 3NFZA 4WWVA 2BFQA 3B35A 3BXMA 4K3NA 3FF3A 3CPAA 3L2NA 2AFUA 4P4IA 1FT7A 2J9AA 5DS0A 4NGPA 2CF4A 3SI1A 2X47A 4UEFA 2CTCA 3CT9A 3KQXA 5I4MA 2JBJA 4R76A 5HVFA 1VHUA 4R7MA 5HVHA 1XMBA 4YU9A 4FAIA 1AMPA 2OOTA 1F2OA 2EK9A 4OC4A 1LAMA 3EWRA 1CBXA 1EE3P 3WC6A 1TKJA 4A37A 4GVVA 5D29A 3K9TA 3LWUA 2PJ8A 5F09A 1CPSA 2PE3A 4OC2A 2O4HA 3V7ZA 3S9LA 1DE4C 2DEAA 4A38A 2XEFA 2PJ2A 5JGFA 4UEZA 4ZY2A 2FVGA 5LYFA 2XD7A 1SPVA 1TKHA 4UMLA 3D68A 2FG1A 1YLOA 3KASA 4NGNA 5FSXA 4ZY1A 1R3NA 3B3CA 2ZEMA 2BO9A 1PYTB 5K8OA 2PJAA 1F57A 2CTBA 2CIJA 3DGVA 2NSMA 3EW5A 3EKEA 4UIAA 4YWYA 2HC9A 4GUAA 4GM5A 3B3SA 1QMUA 2BOAA 4ZY0A 2IJZA 5CB5A 3D7GA 1QQ9A 2PJ3A 3BHXA 2PRQA 3FH4A 3V2BA 1BPMA 3FVLA 4UIBA 4NGTA 3Q71A 1LOKA 4JGKA 1TY8A 1VGYA 4D86A 4LQGA 4ZX8A 2PJ6A 3PFEA 4OIWA 5K8PA 1LFWA 3NA6A 1TF8A 4X8IA 2QVPA 4MCPA 1F2PA 4MHNA 1FNOA 3VATA 1YW6A 3FJUA 2F8HA 3S9MA 4MXUA 1XBUA 1LCPA 4MHPA 4W9YA 3PRTA 2VL1A 3FEEA 3PB9X 4JLLA 3GLJA 5HVGA 4IHMA 3PBBA 4OC0A 4P4EA 4P6YA 3GPOA 3KQZA 5LRJA 4F9VA 5LYIA 4PXDA 1PCAA 3FMCA 1ARMA 2V8DA 3KGQA 4P4DA 3H8FA 5FSZA 2PIZA 3IJ3A 5K8NA 4DYOA 3MN8A 3B7IA 1LAPA 2XEIA 3WABA 2NYQA 2ZENA 1Y7EA 2PJ5A 4NJRA 2FAVA 3IIDA 4J4ZA 4A94A 3BI0A 4RUHA 2IQ6A 2PJBA 3EJGA 4ONWA 3CDXA 4H2KA 2AFXA 3IO1A 1YSJA 2ZOGA 2ZEOA 4NJQA 2V77A 4OC1A 3SJGA 4BD9A 3S9NA 5CBMA 3D67A 3D7DA 3B3TA 5THWA 4TU0A 3KR4A 5K8MA 1ZR3A 1Y0RA 3K2KA 3D4UA 2Q43A 2HB6A 2XEGA 2GLJA 3PB7X 4Z65A 2Q4ZA 4NGMA 4P4JA 3D7FA 4B6ZA 4MCQA 2AFSA 1CP6A 1Z8LA 2I3CA 4GVWA 1H8LA 3DLJA 4MCSA 3NH4A 2LGRA 3WC5A 2ACFA 3D66A 3VH9A 1CG2A 4J5SA 5AILA 1OBRA 4Q7AA 1NJRA 4JVVA 4ZX9A 4NGQA 2PIYA 4EFDA 4PXCA 3B3VA 4TWEA 5CPAA 2GREA 3LMSA 3NH8A 5DUSA 1VHOA 3FEDA 4P10A 4EMEA 3RZAA 3IC1A 1ELLP 3RAMA 2ZEDA 5IB9A 4DUKA 3VFQA 2BCOA 4OP4A 4MHYA 3IWWA 1CPXA 3RBUA 2V8HA 4OKOA 1Z2LA 4AXVA 1ZLHA 1KWMA 1XFOA 3TC8A 4X2TA 2ZEGA 1Q7LA 2JEWA 4OC3A 3MRUA 3KHXA 4FBEA 3V38A 5JH9A 5FSYA 3I1UA 3GPGA 4ABKA 2O53A 3GB0A 3ETIA 2PVVA 3VARA 2PVWA 1HDUA 3SI0A 2QYVA 4UEEA 3ISZA 1YW4A 2ZELA 4TNUA 1NSAA 2Q51A 2EWBA 4P4FA 2EK8A 3KR5A 1UWYA 3IIFA 3PB8X 4OIDA 1TKFA 3SIJA 2GLFA 3EJFA 4P4BA 5J1QA 4KSIA 2C6PA 4OC5A 4ETJA 3PB4X 4MMOA 4NGRA 4IQYA 1ZR5A 5HIHA 4UF4A 4IK2A 3T8WA 4MHZA 4OMEA 4ABLA 4PQAA 3KL9A 5D8NA 3IIBA 4CPAA 4FWUA 3Q6ZA 4O23A 2JBKA 3KZWA 2XEJA 1IGBA 4X3RA 3SJXA 1HDQA 5FSVA 3FECA 2PCUA 1AYEA 3SIHA 2GU2A 8CPAA 2BFRA 4MCRA 1YMEA 2PJ0A 4PXEA 2PJCA 1HEEA 5E3BA 4K0CA 1GYTA 2PJ4A 4JZ0A 2ZEHA 4PPZA 3B2YA 3FX6A 1ARLA 2EEEA 2RFHA 5FSUA 4ETKA 2L8RA 2AFCA 2C6GA 3KHZA 2AFOA 3GPQA 1R43A 4PXBA 2DX6A 1ZG7A 3B3WA 2ZEFA 3PFOA 4J5RA 5CB3A 1LANA 3NH5A 4KYBA 4R6TA 2OR4A 1JQGA 1ELMP 4NGSA 3ISXA 1CX8A 2G9DA 2ANPA 5LYDA 1ZG8A 3H8GA 3PEIA 1CP7A 4A39A 4J5QA 1BAVA 1VIXA 3GQEA 4IAVA 4ESSA 2AFWA 1YD9A 1TF9A 3SIIA 1XJOA 2VRIA 4NFRA 4WJBA 3GQOA 2C1CA 4DJLA 3H8EA 2QJ8A 5JM6A 7CPAA 4R8FA 3TX8A 2V8VA 3EWPA 3SIGA 5LRGA 1TXRA 2ZEEA 3SI2A 2V8GA 3N5FA 1VHEA 3EWOA 4ZI6A 1HJZA 4ZYQA 1ZG9A 2IMOA 3BI1A 3IEHA 5HXDA 5HOLA 2RB7A 3PBEA 2AFMA 1BPNA 4JCAA 5LYLA 2FXKA 3V45A 3QNVA 3KI9A 4G1PA 4FUUA 1IY7A 1Y0YA 3SJEA 1ZLIA 1BLLE 3D7HA 3SJFA 2ZEPA 4P45A 2POKA 2WYRA 5ELYA 3IFEA 2C6CA 3HLPA 2ZOFA 4JYWA 1TXZA 3PB6X 1Z5RA 3GUXA 2F7VA 4MRIA 5LRKA 3WC7A 2ABZA 1DTDA 3CPXA 6CPAA 2WZNA 4EWTA 4F8ZA 3WT4A 3JRUA 3JZTA 2PJ7A 3EWQA 4F9UA 5CMSA 1RTQA 2PJ9A 4P44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XRY A;  2AFZ A;  2PJ1 A;  3HUV A;  1M4L A;  3NFZ A;  4WWV A;  2BFQ A;  3B35 A;  3BXM A;  4K3N A;  3FF3 A;  3CPA A;  3L2N A;  2AFU A;  4P4I A;  1FT7 A;  2J9A A;  5DS0 A;  4NGP A;  2CF4 A;  3SI1 A;  2X47 A;  4UEF A;  2CTC A;  3CT9 A;  3KQX A;  5I4M A;  2JBJ A;  4R76 A;  5HVF A;  1VHU A;  4R7M A;  5HVH A;  1XMB A;  4YU9 A;  4FAI A;  1AMP A;  2OOT A;  1F2O A;  2EK9 A;  4OC4 A;  1LAM A;  3EWR A;  1CBX A;  1EE3 P;  3WC6 A;  1TKJ A;  4A37 A;  4GVV A;  5D29 A;  3K9T A;  3LWU A;  2PJ8 A;  5F09 A;  1CPS A;  2PE3 A;  4OC2 A;  2O4H A;  3V7Z A;  3S9L A;  1DE4 C;  2DEA A;  4A38 A;  2XEF A;  2PJ2 A;  5JGF A;  4UEZ A;  4ZY2 A;  2FVG A;  5LYF A;  2XD7 A;  1SPV A;  1TKH A;  4UML A;  3D68 A;  2FG1 A;  1YLO A;  3KAS A;  4NGN A;  5FSX A;  4ZY1 A;  1R3N A;  3B3C A;  2ZEM A;  2BO9 A;  1PYT B;  5K8O A;  2PJA A;  1F57 A;  2CTB A;  2CIJ A;  3DGV A;  2NSM A;  3EW5 A;  3EKE A;  4UIA A;  4YWY A;  2HC9 A;  4GUA A;  4GM5 A;  3B3S A;  1QMU A;  2BOA A;  4ZY0 A;  2IJZ A;  5CB5 A;  3D7G A;  1QQ9 A;  2PJ3 A;  3BHX A;  2PRQ A;  3FH4 A;  3V2B A;  1BPM A;  3FVL A;  4UIB A;  4NGT A;  3Q71 A;  1LOK A;  4JGK A;  1TY8 A;  1VGY A;  4D86 A;  4LQG A;  4ZX8 A;  2PJ6 A;  3PFE A;  4OIW A;  5K8P A;  1LFW A;  3NA6 A;  1TF8 A;  4X8I A;  2QVP A;  4MCP A;  1F2P A;  4MHN A;  1FNO A;  3VAT A;  1YW6 A;  3FJU A;  2F8H A;  3S9M A;  4MXU A;  1XBU A;  1LCP A;  4MHP A;  4W9Y A;  3PRT A;  2VL1 A;  3FEE A;  3PB9 X;  4JLL A;  3GLJ A;  5HVG A;  4IHM A;  3PBB A;  4OC0 A;  4P4E A;  4P6Y A;  3GPO A;  3KQZ A;  5LRJ A;  4F9V A;  5LYI A;  4PXD A;  1PCA A;  3FMC A;  1ARM A;  2V8D A;  3KGQ A;  4P4D A;  3H8F A;  5FSZ A;  2PIZ A;  3IJ3 A;  5K8N A;  4DYO A;  3MN8 A;  3B7I A;  1LAP A;  2XEI A;  3WAB A;  2NYQ A;  2ZEN A;  1Y7E A;  2PJ5 A;  4NJR A;  2FAV A;  3IID A;  4J4Z A;  4A94 A;  3BI0 A;  4RUH A;  2IQ6 A;  2PJB A;  3EJG A;  4ONW A;  3CDX A;  4H2K A;  2AFX A;  3IO1 A;  1YSJ A;  2ZOG A;  2ZEO A;  4NJQ A;  2V77 A;  4OC1 A;  3SJG A;  4BD9 A;  3S9N A;  5CBM A;  3D67 A;  3D7D A;  3B3T A;  5THW A;  4TU0 A;  3KR4 A;  5K8M A;  1ZR3 A;  1Y0R A;  3K2K A;  3D4U A;  2Q43 A;  2HB6 A;  2XEG A;  2GLJ A;  3PB7 X;  4Z65 A;  2Q4Z A;  4NGM A;  4P4J A;  3D7F A;  4B6Z A;  4MCQ A;  2AFS A;  1CP6 A;  1Z8L A;  2I3C A;  4GVW A;  1H8L A;  3DLJ A;  4MCS A;  3NH4 A;  2LGR A;  3WC5 A;  2ACF A;  3D66 A;  3VH9 A;  1CG2 A;  4J5S A;  5AIL A;  1OBR A;  4Q7A A;  1NJR A;  4JVV A;  4ZX9 A;  4NGQ A;  2PIY A;  4EFD A;  4PXC A;  3B3V A;  4TWE A;  5CPA A;  2GRE A;  3LMS A;  3NH8 A;  5DUS A;  1VHO A;  3FED A;  4P10 A;  4EME A;  3RZA A;  3IC1 A;  1ELL P;  3RAM A;  2ZED A;  5IB9 A;  4DUK A;  3VFQ A;  2BCO A;  4OP4 A;  4MHY A;  3IWW A;  1CPX A;  3RBU A;  2V8H A;  4OKO A;  1Z2L A;  4AXV A;  1ZLH A;  1KWM A;  1XFO A;  3TC8 A;  4X2T A;  2ZEG A;  1Q7L A;  2JEW A;  4OC3 A;  3MRU A;  3KHX A;  4FBE A;  3V38 A;  5JH9 A;  5FSY A;  3I1U A;  3GPG A;  4ABK A;  2O53 A;  3GB0 A;  3ETI A;  2PVV A;  3VAR A;  2PVW A;  1HDU A;  3SI0 A;  2QYV A;  4UEE A;  3ISZ A;  1YW4 A;  2ZEL A;  4TNU A;  1NSA A;  2Q51 A;  2EWB A;  4P4F A;  2EK8 A;  3KR5 A;  1UWY A;  3IIF A;  3PB8 X;  4OID A;  1TKF A;  3SIJ A;  2GLF A;  3EJF A;  4P4B A;  5J1Q A;  4KSI A;  2C6P A;  4OC5 A;  4ETJ A;  3PB4 X;  4MMO A;  4NGR A;  4IQY A;  1ZR5 A;  5HIH A;  4UF4 A;  4IK2 A;  3T8W A;  4MHZ A;  4OME A;  4ABL A;  4PQA A;  3KL9 A;  5D8N A;  3IIB A;  4CPA A;  4FWU A;  3Q6Z A;  4O23 A;  2JBK A;  3KZW A;  2XEJ A;  1IGB A;  4X3R A;  3SJX A;  1HDQ A;  5FSV A;  3FEC A;  2PCU A;  1AYE A;  3SIH A;  2GU2 A;  8CPA A;  2BFR A;  4MCR A;  1YME A;  2PJ0 A;  4PXE A;  2PJC A;  1HEE A;  5E3B A;  4K0C A;  1GYT A;  2PJ4 A;  4JZ0 A;  2ZEH A;  4PPZ A;  3B2Y A;  3FX6 A;  1ARL A;  2EEE A;  2RFH A;  5FSU A;  4ETK A;  2L8R A;  2AFC A;  2C6G A;  3KHZ A;  2AFO A;  3GPQ A;  1R43 A;  4PXB A;  2DX6 A;  1ZG7 A;  3B3W A;  2ZEF A;  3PFO A;  4J5R A;  5CB3 A;  1LAN A;  3NH5 A;  4KYB A;  4R6T A;  2OR4 A;  1JQG A;  1ELM P;  4NGS A;  3ISX A;  1CX8 A;  2G9D A;  2ANP A;  5LYD A;  1ZG8 A;  3H8G A;  3PEI A;  1CP7 A;  4A39 A;  4J5Q A;  1BAV A;  1VIX A;  3GQE A;  4IAV A;  4ESS A;  2AFW A;  1YD9 A;  1TF9 A;  3SII A;  1XJO A;  2VRI A;  4NFR A;  4WJB A;  3GQO A;  2C1C A;  4DJL A;  3H8E A;  2QJ8 A;  5JM6 A;  7CPA A;  4R8F A;  3TX8 A;  2V8V A;  3EWP A;  3SIG A;  5LRG A;  1TXR A;  2ZEE A;  3SI2 A;  2V8G A;  3N5F A;  1VHE A;  3EWO A;  4ZI6 A;  1HJZ A;  4ZYQ A;  1ZG9 A;  2IMO A;  3BI1 A;  3IEH A;  5HXD A;  5HOL A;  2RB7 A;  3PBE A;  2AFM A;  1BPN A;  4JCA A;  5LYL A;  2FXK A;  3V45 A;  3QNV A;  3KI9 A;  4G1P A;  4FUU A;  1IY7 A;  1Y0Y A;  3SJE A;  1ZLI A;  1BLL E;  3D7H A;  3SJF A;  2ZEP A;  4P45 A;  2POK A;  2WYR A;  5ELY A;  3IFE A;  2C6C A;  3HLP A;  2ZOF A;  4JYW A;  1TXZ A;  3PB6 X;  1Z5R A;  3GUX A;  2F7V A;  4MRI A;  5LRK A;  3WC7 A;  2ABZ A;  1DTD A;  3CPX A;  6CPA A;  2WZN A;  4EWT A;  4F8Z A;  3WT4 A;  3JRU A;  3JZT A;  2PJ7 A;  3EWQ A;  4F9U A;  5CMS A;  1RTQ A;  2PJ9 A;  4P44 A; 
#chains in the Genus database with same CATH topology
 4MFK A;  4B10 A;  1XRY A;  4KOS A;  2AFZ A;  3FXT A;  5KTC A;  1KUV A;  4L89 A;  2PJ1 A;  1Z9U A;  3HUV A;  1M4L A;  2VQY A;  4E2A A;  2I00 A;  1XE4 A;  3NFZ A;  4WWV A;  3I3G A;  2H5M A;  1IU8 A;  2BFQ A;  1YGH A;  2I79 A;  3B35 A;  3BXM A;  3R9G A;  4C2Y A;  4K3N A;  1J4J A;  4ORF A;  3FF3 A;  3CPA A;  3L2N A;  1VHS A;  2AFU A;  3DR8 A;  4KSA A;  4J3G A;  2EBJ A;  4P4I A;  1QST A;  1QSO A;  1FT7 A;  3BJ8 A;  2J9A A;  5DWM A;  2WCT A;  3I9S A;  5DS0 A;  2OZH A;  4MJ8 A;  2CF4 A;  4NGP A;  2Z3P A;  4PSX A;  3SI1 A;  2X47 A;  3FB3 A;  4UEF A;  3CZX A;  2CTC A;  2FS5 A;  3CT9 A;  1YQE A;  4KLW A;  3KQX A;  4Q36 A;  4QC6 A;  2Z3M A;  4A2Z A;  3R96 A;  5I4M A;  2JBJ A;  4BIN A;  1NSL A;  4R76 A;  5HVF A;  5CNP A;  1VHU A;  4HNX B;  4R7M A;  2JDD A;  5HVH A;  1MK4 A;  2REE A;  4UFW A;  2PC1 A;  4MBU A;  1XMB A;  2YNC C;  4YU9 A;  2QML A;  5EMI A;  1YK3 A;  4FAI A;  1AMP A;  2OOT A;  4XPK A;  1F2O A;  3DNS A;  4KS9 A;  1M4I A;  3RYO A;  2EK9 A;  4OC4 A;  1LAM A;  3EWR A;  1OZP A;  1RXT A;  3DR6 A;  1CBX A;  1EE3 P;  3WC6 A;  1TKJ A;  2WPW A;  4MFL A;  4A37 A;  4H6Z A;  4GVV A;  5D29 A;  3K9T A;  3LWU A;  1M4D A;  2PJ8 A;  5F09 A;  1CPS A;  2GE3 A;  4PK2 A;  2PE3 A;  5F46 A;  4OC2 A;  3UY5 A;  2O4H A;  3V7Z A;  3LOD A;  5EC4 A;  3S9L A;  3EY5 A;  2FIW A;  4OAE A;  1XEB A;  2OZG A;  1DE4 C;  2DEA A;  4A38 A;  3P2F A;  2XEF A;  1S3Z A;  1GHE A;  3PZJ A;  2PJ2 A;  4YGO A;  5BWA B;  5JGF A;  4B5O A;  3T9Y A;  4A95 A;  4UEZ A;  4ZY2 A;  2FVG A;  2YND A;  3W6X A;  5LYF A;  4MFZ A;  4CRZ B;  2XD7 A;  4U5Y A;  3W91 A;  1SPV A;  4ZBG A;  4ZGY B;  1TKH A;  2HUZ A;  4UML A;  2GIV A;  3D68 A;  1WK4 A;  4NF1 A;  2FG1 A;  1YLO A;  1XF8 A;  3KAS A;  4MHD A;  1ON0 A;  4NGN A;  5FSX A;  4ZY1 A;  3T90 A;  1R3N A;  3B3C A;  2IL4 A;  2ZEM A;  1XMT A;  1PYT B;  2BO9 A;  5K8O A;  2PJA A;  2Z11 A;  3QAH A;  1F57 A;  4B5P A;  5J8F A;  2CTB A;  2DPS A;  1YVK A;  2PDO A;  4CAE A;  2CIJ A;  4IUS A;  4DNC A;  3DGV A;  2NSM A;  1XOV A;  3EW5 A;  4U9Z A;  5AG7 A;  3EKE A;  4UIA A;  4YWY A;  3S6G A;  1MJB A;  4EVY A;  2DXQ A;  2R98 A;  4KOV A;  2HC9 A;  4GS4 A;  4GUA A;  2YNC A;  4GM5 A;  3B3S A;  4CYN A;  1QMU A;  2BOA A;  4ZY0 A;  2IJZ A;  4M6H A;  3SXO A;  3V8I A;  4UA3 A;  4HNW B;  5CB5 A;  1M44 A;  1CJW A;  3D7G A;  4CYO A;  1QQ9 A;  2PJ3 A;  3BHX A;  2PRQ A;  3FH4 A;  4KOX A;  3V2B A;  1BPM A;  3FVL A;  4KUB A;  1TIQ A;  3CXQ A;  4UIB A;  2NMT A;  3TO7 A;  4NGT A;  3Q71 A;  4JXR A;  1JWQ A;  4JWP A;  2J8N A;  1LOK A;  4JGK A;  1TY8 A;  2FL4 A;  3B8G A;  1VGY A;  4D86 A;  4IF5 A;  4LQG A;  4U9Y A;  1ZO0 A;  4ZX8 A;  2PJ6 A;  3PFE A;  4OIW A;  5K8P A;  2BSW A;  2P0W A;  2FXF A;  2JZF A;  1LFW A;  5JPH A;  3NA6 A;  2BL1 A;  4UFV A;  1TF8 A;  1Q2C A;  4X8I A;  2VI7 A;  2Q7S A;  5E96 A;  4KOT A;  5JQ4 A;  2QVP A;  1Z8X A;  4MCP A;  1F2P A;  4MHN A;  1FNO A;  3VAT A;  1QSM A;  1YW6 A;  2C27 A;  3FJU A;  2P6E A;  2F8H A;  4H6U A;  3S9M A;  4MXU A;  3EFA A;  4Y49 C;  1IOF A;  1LCP A;  1XBU A;  2PSW A;  4MHP A;  4W9Y A;  3RNZ A;  3PRT A;  2VL1 A;  1R57 A;  3D2P A;  4R3L A;  3FEE A;  2B4D B;  3PB9 X;  4JLL A;  3GLJ A;  2Y0M A;  4M6I A;  3FBU A;  3PP9 A;  2ZW6 A;  2AJ6 A;  2CY2 A;  3DDD A;  5HVG A;  5IX3 A;  4IHM A;  3PBB A;  4X5K A;  4CAV A;  4OC0 A;  4P4E A;  1IOI A;  4P6Y A;  3GPO A;  3KQZ A;  5LRJ A;  4UBR A;  4F9V A;  5LYI A;  3SHP A;  3D8P A;  4PXD A;  1PCA A;  1S7N A;  2Z3K A;  3FMC A;  1ARM A;  4CYP A;  2V8D A;  3S6K A;  4PV6 A;  3KGQ A;  4P4D A;  3H8F A;  5FSZ A;  1SQH A;  2PIZ A;  1S7L A;  4B11 A;  3IJ3 A;  3GYA A;  3WR7 A;  5K8N A;  4DYO A;  2GFQ A;  1V0C A;  3MN8 A;  3B7I A;  1LAP A;  2XEI A;  3WAB A;  2NYQ A;  4M6G A;  4XPD C;  1Z8W A;  2ZW5 A;  2ZEN A;  4UCP A;  1Y7E A;  2PJ5 A;  5AGE A;  4II9 A;  4L8A A;  4NJR A;  5J8C A;  1IYL A;  2FAV A;  3IID A;  2ZW7 A;  5F49 A;  2JDC A;  3VWE A;  4J4Z A;  4A94 A;  4A32 A;  3BI0 A;  4I49 A;  4QBJ A;  4RUH A;  2IQ6 A;  2PJB A;  3EJG A;  2P6G A;  4ONW A;  5KTD A;  3CDX A;  2EO8 A;  1Q2D A;  4H2K A;  5H84 A;  2AFX A;  2Q0Y A;  4F0X A;  1MJ9 A;  3IU1 A;  3IO1 A;  4FD4 A;  4JLY A;  4B6Z A;  4B14 A;  1YSJ A;  4GXH A;  3NE8 A;  4R87 A;  2ZOG A;  4FD6 A;  2ZEO A;  3R9E A;  2B3U A;  4NJQ A;  3LAC A;  2V77 A;  4OC1 A;  3CXP A;  4OLL A;  3SJG A;  4JJX A;  4BD9 A;  2G0B A;  3S9N A;  5CBM A;  3D67 A;  3D7D A;  3B3T A;  5THW A;  4C7H A;  4TU0 A;  4JD6 A;  4KUA A;  4MI4 A;  4PK3 A;  4UWJ A;  1Y9W A;  3KR4 A;  1QSR A;  4KOR A;  1YRE A;  5K8M A;  1ZR3 A;  1Y0R A;  3K2K A;  3D4U A;  5ISV A;  2Q43 A;  2HB6 A;  2XEG A;  2GLJ A;  2J8M A;  2WSA A;  3PB7 X;  4Z65 A;  2Z3O A;  2Q4Z A;  4NGM A;  4P4J A;  3FYN A;  1Z4E A;  3D7F A;  2Z0Z A;  1S7F A;  1XIX A;  4Y49 B;  2ARH A;  4A30 A;  2VZZ A;  4MCQ A;  4CGN A;  2AFS A;  4XNH C;  1CP6 A;  1Z8L A;  5KTA A;  2I3C A;  4GVW A;  1H8L A;  2D4P A;  3DLJ A;  4MCS A;  1A2Z A;  2LGR A;  3DSB A;  3NH4 A;  3WC5 A;  2ACF A;  2PR1 A;  2AE6 A;  3D66 A;  3IWE A;  4R3K A;  2JEV A;  3VH9 A;  1CG2 A;  4J5S A;  5AIL A;  1OBR A;  1PUA A;  1NJR A;  4JVV A;  4ZX9 A;  2RC4 A;  4NGQ A;  4Q7A A;  4CS0 B;  2PIY A;  4EFD A;  1S5K A;  3B3V A;  4PXC A;  4TWE A;  3F5B A;  5CPA A;  1S7K A;  1YR0 A;  4B5P B;  2GRE A;  3LMS A;  3NH8 A;  2PQ8 A;  2REF A;  2GAN A;  5DUS A;  1VHO A;  1WWZ A;  2EUI A;  3D2M A;  3FED A;  3H4Q A;  4P10 A;  5G21 A;  4EME A;  3RZA A;  4CYQ A;  3IC1 A;  1ELL P;  1YLE A;  4XPD B;  4UWI A;  2CNS A;  2FE7 A;  3TFY A;  2WPX A;  3RAM A;  2ZED A;  4AB7 A;  2JLM A;  5IB9 A;  4KVO E;  4DUK A;  3VFQ A;  3NE7 A;  2BCO A;  4OP4 A;  2Q44 A;  4MHY A;  3RO0 A;  3IWW A;  1CPX A;  3RBU A;  2P6F A;  3GY9 A;  4QB9 A;  2V8H A;  5G1Z A;  2R7H A;  2Z3N A;  1Z2L A;  4OKO A;  2R1I A;  1Y7R A;  4AXV A;  1ZLH A;  1KWM A;  1XFO A;  3R1K A;  3TC8 A;  3FRM A;  3A9L A;  4LX9 A;  4X2T A;  2ZEG A;  3PGP A;  1Q7L A;  4MFQ A;  4F6A A;  2JEW A;  1Z8T A;  4OC3 A;  3MRU A;  3KHX A;  4HPS A;  2PRB A;  4KSF A;  4FBE A;  3V38 A;  3TTH A;  5FSY A;  5JH9 A;  2Q4Y A;  3I1U A;  3GPG A;  4ABK A;  1VKC A;  2O53 A;  3GB0 A;  3QAY A;  3ETI A;  2PVV A;  4RN7 A;  5G20 A;  4CGP A;  3VAR A;  2PVW A;  1HDU A;  4KOW A;  3SI0 A;  2QYV A;  2CXA A;  4UEE A;  2CNT A;  3ISZ A;  4LUA A;  4YFJ A;  1YW4 A;  2ZEL A;  2B4D A;  4TNU A;  3S6F A;  3G3S A;  1NSA A;  4AVA A;  4C2X A;  2Q51 A;  4KOY A;  1YX0 A;  4QUS A;  2JZD A;  2YGW A;  4BBH A;  2EWB A;  4AVC A;  4P4F A;  2EK8 A;  3KR5 A;  1UWY A;  3N7Z A;  2ZXV A;  3IIF A;  3PB8 X;  4M85 A;  2DPT A;  2G3A A;  4OID A;  1TKF A;  2OH1 A;  2PR8 A;  3SIJ A;  3IU2 A;  4XNH B;  2OB0 A;  2GLF A;  4KZT A;  3EJF A;  4P4B A;  5J1Q A;  1FY7 A;  4KSI A;  4AVB A;  2BUE A;  4NEX A;  4E8O A;  2C6P A;  4OC5 A;  4ETJ A;  3PB4 X;  2G3T A;  4MMO A;  3OWC A;  4NGR A;  4QVT A;  3JVN A;  4IQY A;  3EO4 A;  2ODF A;  1ZR5 A;  2Z10 A;  5HIH A;  3GKR A;  1AUG A;  1IIC A;  5GCN A;  4UF4 A;  4IK2 A;  1I21 A;  3LD2 A;  3T8W A;  2JZE A;  5IB0 A;  4MHZ A;  3F0A A;  4OME A;  4MY0 A;  4ABL A;  4NXY A;  4PQA A;  3ZZI A;  1RO5 A;  3KL9 A;  5D8N A;  1Y9K A;  3CXS A;  3IIB A;  3IWG A;  4CPA A;  1BO4 A;  4C68 A;  4F0Y A;  4FWU A;  4R9M A;  4RI1 A;  5IV0 A;  4CGO A;  3Q6Z A;  4O23 A;  3S6H A;  2JBK A;  2OU2 A;  3KZW A;  1KZF A;  2XEJ A;  1IGB A;  3W6S A;  4X3R A;  1BOB A;  3SJX A;  1HDQ A;  5FSV A;  3FEC A;  2PCU A;  1AYE A;  2FT0 A;  4CRY B;  3EC4 A;  3TO6 A;  2KCW A;  1B87 A;  1NE9 A;  4A33 A;  3SIH A;  3D3S A;  3E0K A;  2CNM A;  1KUX A;  2GU2 A;  8CPA A;  2BFR A;  4MCR A;  1YME A;  2PJ0 A;  3JUW A;  4PXE A;  1LRZ A;  5HMN A;  5F48 A;  2PJC A;  1HEE A;  5E3B A;  4K0C A;  3R9F A;  2K5T A;  1MJA A;  1GYT A;  1I1D A;  4KOU A;  2PJ4 A;  4JZ0 A;  2ZEH A;  2EVN A;  3B2Y A;  4PPZ A;  1Z4R A;  3FX6 A;  4K30 A;  1ARL A;  2BEI A;  2EEE A;  1QSN A;  5FSU A;  2RFH A;  3IGR A;  4ETK A;  2L8R A;  5AG5 A;  2AFC A;  2B4B A;  4RS2 A;  2C6G A;  1IID A;  4MFJ A;  4A31 A;  3KHZ A;  2AFO A;  2Q04 A;  3GPQ A;  1R43 A;  4PXB A;  3C26 A;  1M4G A;  2DX6 A;  1ZG7 A;  3B3W A;  5AG4 A;  5I0C A;  2ZEF A;  3PFO A;  4J5R A;  5CB3 A;  1LAN A;  1X12 A;  3NH5 A;  4KYB A;  4C2Z A;  2A4N A;  2VXK A;  4BMH A;  4R6T A;  1IB1 E;  2OR4 A;  1JQG A;  1ELM P;  2Z3L A;  3QB8 A;  4NGS A;  1P0H A;  3ISX A;  1CM0 A;  1CX8 A;  2G9D A;  5A28 A;  2ANP A;  5LYD A;  1ZG8 A;  3H8G A;  4XPL A;  3K9U A;  3PEI A;  4Q38 A;  3BLN A;  1CP7 A;  2YNE A;  2D4O A;  4A39 A;  4J5Q A;  2ATR A;  2X7B A;  1BAV A;  1M1D A;  3GQE A;  1VIX A;  4IAV A;  4ESS A;  3SXN A;  2AFW A;  3ZJ0 A;  1YD9 A;  1TF9 A;  3SII A;  1XJO A;  2VRI A;  3KKW A;  4NFR A;  3GQO A;  2C1C A;  2B58 A;  4WJB A;  4DJL A;  3H8E A;  4KVX A;  2QJ8 A;  3TT2 A;  2W2G A;  5JM6 A;  1UFH A;  2FCK A;  1L0C A;  2F5I A;  5C88 A;  4LQ6 A;  4CGL A;  1B6B A;  4B13 A;  3EXN A;  7CPA A;  1I12 A;  4R8F A;  3TX8 A;  2B3V A;  2V8V A;  5A27 A;  3EWP A;  3SIG A;  2RNK A;  2VEZ A;  4PSW A;  5G22 A;  5LRG A;  1TXR A;  4MY3 A;  5EBV A;  1KUY A;  2WUU A;  2ZW4 A;  2J8R A;  4NCZ A;  2ZEE A;  3F8K A;  4MFP A;  3SI2 A;  2V8G A;  3GIU A;  2OZU A;  2QEC A;  4FD7 A;  4ONU A;  3TOB A;  3N5F A;  1VHE A;  4UFX A;  2B5G A;  2QIR A;  3TE4 A;  1P4N A;  3EWO A;  4ZI6 A;  2ZPA A;  1HJZ A;  4ZYQ A;  1ZG9 A;  3P2H A;  2IMO A;  3BI1 A;  3IEH A;  4KVM E;  4UCN A;  4C7I A;  5HXD A;  2HQY A;  5HOL A;  2RB7 A;  2VBQ A;  3PBE A;  2AFM A;  4OAD A;  3JTK A;  1BPN A;  3G8W A;  4AG7 A;  4JCA A;  1N71 A;  3FNC A;  5LYL A;  4AG9 A;  2FXK A;  3V45 A;  3QNV A;  3KI9 A;  4G1P A;  2B5G B;  4YRH A;  3BJ7 A;  1IY7 A;  1Y0Y A;  4FUU A;  3SJE A;  4E0A A;  1ZLI A;  1BLL E;  1PU9 A;  1YVO A;  2HV2 A;  2ZEP A;  3D7H A;  4P45 A;  2POK A;  3SJF A;  1K4J A;  2WYR A;  1S60 A;  5ELY A;  1Q2Y A;  3IFE A;  5DWN A;  1U6M A;  5FVJ A;  2C6C A;  3HLP A;  2ZOF A;  4JYW A;  4FD5 A;  1TXZ A;  2KQV A;  1Z5R A;  3H5Z A;  3PB6 X;  4UCM A;  5AG6 A;  5F47 A;  3MGD A;  2Q7B A;  4HKF A;  3TCV A;  2Q4V A;  4CAX A;  2DF5 A;  5HH1 A;  3GUX A;  4JXQ A;  2F7V A;  2R8V A;  4MRI A;  3R95 A;  3TOA A;  3WC7 A;  5LRK A;  2ABZ A;  1DTD A;  4KLV A;  4CAW A;  3CPX A;  1IYK A;  3FIX A;  3TO9 A;  1X10 A;  2WZN A;  6CPA A;  4M3S A;  4EWT A;  4R57 A;  3WT4 A;  2FSR A;  4CAF A;  4F8Z A;  3VWD A;  3JRU A;  3JZT A;  2FIA A;  2O28 A;  5H86 A;  2PJ7 A;  5C82 A;  4H89 A;  3EWQ A;  2VZY A;  4NSQ A;  4B12 A;  4CGM A;  4F9U A;  4HNY B;  1NMT A;  5CMS A;  1RTQ A;  2PJ9 A;  4P44 A; 
#chains in the Genus database with same CATH homology
 1XRY A;  2AFZ A;  2PJ1 A;  3HUV A;  1M4L A;  3NFZ A;  4WWV A;  2BFQ A;  3B35 A;  3BXM A;  4K3N A;  3FF3 A;  3CPA A;  3L2N A;  2AFU A;  4P4I A;  1FT7 A;  2J9A A;  5DS0 A;  4NGP A;  2CF4 A;  3SI1 A;  2X47 A;  4UEF A;  2CTC A;  3CT9 A;  3KQX A;  5I4M A;  2JBJ A;  4R76 A;  5HVF A;  1VHU A;  4R7M A;  5HVH A;  1XMB A;  4YU9 A;  4FAI A;  1AMP A;  2OOT A;  1F2O A;  2EK9 A;  4OC4 A;  1LAM A;  3EWR A;  1CBX A;  1EE3 P;  3WC6 A;  1TKJ A;  4A37 A;  4GVV A;  5D29 A;  3K9T A;  3LWU A;  2PJ8 A;  5F09 A;  1CPS A;  2PE3 A;  4OC2 A;  2O4H A;  3V7Z A;  3S9L A;  1DE4 C;  2DEA A;  4A38 A;  2XEF A;  2PJ2 A;  5JGF A;  4UEZ A;  4ZY2 A;  2FVG A;  5LYF A;  2XD7 A;  1SPV A;  1TKH A;  4UML A;  3D68 A;  2FG1 A;  1YLO A;  3KAS A;  4NGN A;  5FSX A;  4ZY1 A;  1R3N A;  3B3C A;  2ZEM A;  2BO9 A;  1PYT B;  5K8O A;  2PJA A;  1F57 A;  2CTB A;  2CIJ A;  3DGV A;  2NSM A;  3EW5 A;  3EKE A;  4UIA A;  4YWY A;  2HC9 A;  4GUA A;  4GM5 A;  3B3S A;  1QMU A;  2BOA A;  4ZY0 A;  2IJZ A;  5CB5 A;  3D7G A;  1QQ9 A;  2PJ3 A;  3BHX A;  2PRQ A;  3FH4 A;  3V2B A;  1BPM A;  3FVL A;  4UIB A;  4NGT A;  3Q71 A;  1LOK A;  4JGK A;  1TY8 A;  1VGY A;  4D86 A;  4LQG A;  4ZX8 A;  2PJ6 A;  3PFE A;  4OIW A;  5K8P A;  1LFW A;  3NA6 A;  1TF8 A;  4X8I A;  2QVP A;  4MCP A;  1F2P A;  4MHN A;  1FNO A;  3VAT A;  1YW6 A;  3FJU A;  2F8H A;  3S9M A;  4MXU A;  1XBU A;  1LCP A;  4MHP A;  4W9Y A;  3PRT A;  2VL1 A;  3FEE A;  3PB9 X;  4JLL A;  3GLJ A;  5HVG A;  4IHM A;  3PBB A;  4OC0 A;  4P4E A;  4P6Y A;  3GPO A;  3KQZ A;  5LRJ A;  4F9V A;  5LYI A;  4PXD A;  1PCA A;  3FMC A;  1ARM A;  2V8D A;  3KGQ A;  4P4D A;  3H8F A;  5FSZ A;  2PIZ A;  3IJ3 A;  5K8N A;  4DYO A;  3MN8 A;  3B7I A;  1LAP A;  2XEI A;  3WAB A;  2NYQ A;  2ZEN A;  1Y7E A;  2PJ5 A;  4NJR A;  2FAV A;  3IID A;  4J4Z A;  4A94 A;  3BI0 A;  4RUH A;  2IQ6 A;  2PJB A;  3EJG A;  4ONW A;  3CDX A;  4H2K A;  2AFX A;  3IO1 A;  1YSJ A;  2ZOG A;  2ZEO A;  4NJQ A;  2V77 A;  4OC1 A;  3SJG A;  4BD9 A;  3S9N A;  5CBM A;  3D67 A;  3D7D A;  3B3T A;  5THW A;  4TU0 A;  3KR4 A;  5K8M A;  1ZR3 A;  1Y0R A;  3K2K A;  3D4U A;  2Q43 A;  2HB6 A;  2XEG A;  2GLJ A;  3PB7 X;  4Z65 A;  2Q4Z A;  4NGM A;  4P4J A;  3D7F A;  4B6Z A;  4MCQ A;  2AFS A;  1CP6 A;  1Z8L A;  2I3C A;  4GVW A;  1H8L A;  3DLJ A;  4MCS A;  3NH4 A;  2LGR A;  3WC5 A;  2ACF A;  3D66 A;  3VH9 A;  1CG2 A;  4J5S A;  5AIL A;  1OBR A;  4Q7A A;  1NJR A;  4JVV A;  4ZX9 A;  4NGQ A;  2PIY A;  4EFD A;  4PXC A;  3B3V A;  4TWE A;  5CPA A;  2GRE A;  3LMS A;  3NH8 A;  5DUS A;  1VHO A;  3FED A;  4P10 A;  4EME A;  3RZA A;  3IC1 A;  1ELL P;  3RAM A;  2ZED A;  5IB9 A;  4DUK A;  3VFQ A;  2BCO A;  4OP4 A;  4MHY A;  3IWW A;  1CPX A;  3RBU A;  2V8H A;  4OKO A;  1Z2L A;  4AXV A;  1ZLH A;  1KWM A;  1XFO A;  3TC8 A;  4X2T A;  2ZEG A;  1Q7L A;  2JEW A;  4OC3 A;  3MRU A;  3KHX A;  4FBE A;  3V38 A;  5JH9 A;  5FSY A;  3I1U A;  3GPG A;  4ABK A;  2O53 A;  3GB0 A;  3ETI A;  2PVV A;  3VAR A;  2PVW A;  1HDU A;  3SI0 A;  2QYV A;  4UEE A;  3ISZ A;  1YW4 A;  2ZEL A;  4TNU A;  1NSA A;  2Q51 A;  2EWB A;  4P4F A;  2EK8 A;  3KR5 A;  1UWY A;  3IIF A;  3PB8 X;  4OID A;  1TKF A;  3SIJ A;  2GLF A;  3EJF A;  4P4B A;  5J1Q A;  4KSI A;  2C6P A;  4OC5 A;  4ETJ A;  3PB4 X;  4MMO A;  4NGR A;  4IQY A;  1ZR5 A;  5HIH A;  4UF4 A;  4IK2 A;  3T8W A;  4MHZ A;  4OME A;  4ABL A;  4PQA A;  3KL9 A;  5D8N A;  3IIB A;  4CPA A;  4FWU A;  3Q6Z A;  4O23 A;  2JBK A;  3KZW A;  2XEJ A;  1IGB A;  4X3R A;  3SJX A;  1HDQ A;  5FSV A;  3FEC A;  2PCU A;  1AYE A;  3SIH A;  2GU2 A;  8CPA A;  2BFR A;  4MCR A;  1YME A;  2PJ0 A;  4PXE A;  2PJC A;  1HEE A;  5E3B A;  4K0C A;  1GYT A;  2PJ4 A;  4JZ0 A;  2ZEH A;  4PPZ A;  3B2Y A;  3FX6 A;  1ARL A;  2EEE A;  2RFH A;  5FSU A;  4ETK A;  2L8R A;  2AFC A;  2C6G A;  3KHZ A;  2AFO A;  3GPQ A;  1R43 A;  4PXB A;  2DX6 A;  1ZG7 A;  3B3W A;  2ZEF A;  3PFO A;  4J5R A;  5CB3 A;  1LAN A;  3NH5 A;  4KYB A;  4R6T A;  2OR4 A;  1JQG A;  1ELM P;  4NGS A;  3ISX A;  1CX8 A;  2G9D A;  2ANP A;  5LYD A;  1ZG8 A;  3H8G A;  3PEI A;  1CP7 A;  4A39 A;  4J5Q A;  1BAV A;  1VIX A;  3GQE A;  4IAV A;  4ESS A;  2AFW A;  1YD9 A;  1TF9 A;  3SII A;  1XJO A;  2VRI A;  4NFR A;  4WJB A;  3GQO A;  2C1C A;  4DJL A;  3H8E A;  2QJ8 A;  5JM6 A;  7CPA A;  4R8F A;  3TX8 A;  2V8V A;  3EWP A;  3SIG A;  5LRG A;  1TXR A;  2ZEE A;  3SI2 A;  2V8G A;  3N5F A;  1VHE A;  3EWO A;  4ZI6 A;  1HJZ A;  4ZYQ A;  1ZG9 A;  2IMO A;  3BI1 A;  3IEH A;  5HXD A;  5HOL A;  2RB7 A;  3PBE A;  2AFM A;  1BPN A;  4JCA A;  5LYL A;  2FXK A;  3V45 A;  3QNV A;  3KI9 A;  4G1P A;  4FUU A;  1IY7 A;  1Y0Y A;  3SJE A;  1ZLI A;  1BLL E;  3D7H A;  3SJF A;  2ZEP A;  4P45 A;  2POK A;  2WYR A;  5ELY A;  3IFE A;  2C6C A;  3HLP A;  2ZOF A;  4JYW A;  1TXZ A;  3PB6 X;  1Z5R A;  3GUX A;  2F7V A;  4MRI A;  5LRK A;  3WC7 A;  2ABZ A;  1DTD A;  3CPX A;  6CPA A;  2WZN A;  4EWT A;  4F8Z A;  3WT4 A;  3JRU A;  3JZT A;  2PJ7 A;  3EWQ A;  4F9U A;  5CMS A;  1RTQ A;  2PJ9 A;  4P44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...