3T8WA

A bestatin-based chemical biology strategy reveals distinct roles for malaria m1- and m17-family aminopeptidases
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/hydrolase inhibitor
total genus 178
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3t8wA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3t8wA02
2AFWA 4GUAA 2PJAA 3IC1A 3BHXA 5FSZA 2ABZA 5J1QA 5LRJA 4MRIA 3SI2A 4JYWA 2AFSA 4ZX8A 1ZLHA 1TKFA 4TU0A 2ZELA 4JVVA 1IGBA 3NA6A 4R76A 5HXDA 1ELMP 3V2BA 2V8DA 2XEGA 4IHMA 2PJ8A 2PIZA 3KGQA 3DLJA 4OC2A 3ETIA 2FXKA 1R3NA 3S9NA 1CX8A 4H2KA 4DYOA 5CB3A 2JBJA 3L2NA 4A94A 1VGYA 4MMOA 4ZYQA 1YLOA 2AFZA 3ISXA 4NGQA 4Q7AA 3KASA 1LAPA 3H8FA 3D4UA 3KQXA 4A39A 3WC5A 3H8GA 2BCOA 2PIYA 4PPZA 3CT9A 3GQOA 3CDXA 2PJ3A 1M4LA 1TF9A 3VH9A 4NGPA 2HB6A 3B3SA 4X8IA 1LAMA 3I1UA 2ANPA 3EWOA 5AILA 4B6ZA 3B3CA 3SJGA 1XBUA 2CIJA 4MCPA 1BLLE 1QMUA 1BAVA 1Y7EA 4MCRA 2BO9A 5JH9A 4NGRA 4ZY0A 4MHYA 4ZI6A 1KWMA 2F7VA 3FH4A 3FF3A 5JGFA 3NH4A 2IJZA 2AFOA 4PXCA 2J9AA 3PRTA 2AFUA 5CMSA 3D7GA 3VATA 3NFZA 3BI0A 4OMEA 2PVVA 1YW6A 3B2YA 2EK9A 2O4HA 3CPXA 3KHXA 4YWYA 3B3VA 4F8ZA 3SIIA 3VARA 1YD9A 5FSXA 5CPAA 4UIAA 2V8HA 2IMOA 4LQGA 2ZEOA 3TC8A 4RUHA 3KHZA 4NGNA 4P4EA 5D29A 3WABA 4ONWA 3EW5A 2VL1A 4P4DA 2XEJA 3S9MA 3GPGA 5FSVA 3NH5A 2ZOFA 1AMPA 1CG2A 2ZOGA 4A37A 4NFRA 4OIWA 3KL9A 6CPAA 2DX6A 1ZR5A 1DE4C 3ISZA 4A38A 3FMCA 3FVLA 1SPVA 2PJ6A 3GPOA 4NGMA 1H8LA 3RAMA 2X47A 3GB0A 2RFHA 3GQEA 3FEEA 2XEFA 3IIBA 4GVVA 2LGRA 1R43A 4MHNA 5JM6A 2POKA 1CPXA 5LYFA 2CTBA 3EWRA 2BFRA 1JQGA 3RZAA 3PB8X 4OP4A 2PVWA 4MCQA 4IQYA 2NSMA 1PCAA 4OC1A 4MCSA 3D7HA 3FECA 2PRQA 2QVPA 4KSIA 4WJBA 2ZEMA 3B3WA 1ZG8A 3WT4A 1UWYA 1HDQA 5LYDA 2CF4A 3MN8A 4R6TA 1OBRA 2NYQA 1CPSA 3FEDA 1VHOA 5IB9A 4MHPA 3GPQA 1VHEA 2ZEHA 2OR4A 3V45A 2PJ7A 4OIDA 1LOKA 2PJBA 1TKHA 4ZY1A 3PB7X 1Z2LA 3GLJA 5D8NA 4KYBA 3T8WA 4P6YA 4EFDA 2EK8A 4NGTA 3IWWA 4GM5A 3KQZA 2C6CA 2PJCA 5ELYA 3S9LA 1RTQA 2XD7A 3KR5A 4J4ZA 4OKOA 4P45A 3EJGA 4FAIA 2PJ5A 4MXUA 2BOAA 3PBEA 1ZG7A 4O23A 3JZTA 3EWQA 1LANA 1AYEA 1GYTA 4W9YA 4TNUA 4OC3A 1VHUA 4X2TA 3LMSA 4P4BA 2G9DA 4JGKA 3QNVA 4IK2A 1TXZA 2PE3A 2C1CA 3CPAA 1Y0YA 2BFQA 1ARLA 1XFOA 5FSUA 4EWTA 1TF8A 2HC9A 5HIHA 3IFEA 3N5FA 3SIJA 2ZENA 2WYRA 1XMBA 3TX8A 1LCPA 3D7FA 4PQAA 3PFEA 2GU2A 1EE3P 2JEWA 3H8EA 2ZEPA 3K9TA 4JZ0A 2Q4ZA 4MHZA 3FJUA 4DUKA 4JCAA 1YSJA 3PFOA 1ARMA 2Q43A 4UMLA 2ZEFA 2V8VA 3HLPA 2AFXA 2PJ4A 2EEEA 3SJFA 3V38A 2JBKA 4ABLA 1TXRA 4R7MA 2QJ8A 4CPAA 4P4JA 4ZX9A 3PEIA 2WZNA 4BD9A 3SI1A 4F9UA 5CB5A 5DS0A 2ZEGA 3DGVA 3PB9X 1NSAA 1YW4A 5E3BA 5LYIA 2QYVA 4JLLA 1FNOA 4YU9A 2ZEDA 4D86A 1FT7A 1HEEA 1BPNA 4UEEA 2PJ0A 4AXVA 2IQ6A 3SJEA 8CPAA 2FAVA 4K3NA 1VIXA 3IO1A 3EWPA 4R8FA 4TWEA 2F8HA 3D66A 2FG1A 1Q7LA 3PB4X 4PXDA 3D68A 4FWUA 5HVHA 2GREA 3VFQA 3B7IA 3LWUA 2I3CA 3KI9A 4PXEA 1CP7A 4UEFA 2XEIA 2FVGA 4UIBA 2DEAA 4ETJA 4J5SA 1Z8LA 2O53A 3RBUA 2RB7A 5THWA 4UF4A 5I4MA 3B3TA 4Z65A 2ACFA 4NJQA 3Q71A 4ABKA 4P10A 3EKEA 3SIGA 1IY7A 1F2OA 3JRUA 2L8RA 3BI1A 4OC5A 2PJ9A 1PYTB 1TKJA 1ZR3A 1XJOA 5CBMA 2PJ2A 3D67A 3WC6A 5LRGA 1HDUA 5K8NA 3KZWA 1ELLP 4WWVA 3K2KA 4ESSA 2C6GA 3IIFA 5LRKA 1NJRA 2CTCA 2AFCA 4OC4A 4ZY2A 5DUSA 3SI0A 3KR4A 2EWBA 4ETKA 1YMEA 4G1PA 4NGSA 4P4IA 5HVFA 3WC7A 3BXMA 3FX6A 2OOTA 2VRIA 4OC0A 4X3RA 4FUUA 3EJFA 2GLFA 3IIDA 3SJXA 1XRYA 3V7ZA 3GUXA 4DJLA 4J5RA 1CBXA 1F2PA 3B35A 2PJ1A 4P44A 2V8GA 3D7DA 4PXBA 2AFMA 4FBEA 1TY8A 5K8PA 4K0CA 4F9VA 3IEHA 4IAVA 3IJ3A 4NJRA 3NH8A 1LFWA 2ZEEA 5LYLA 5K8MA 1Y0RA 1Z5RA 1ZG9A 2GLJA 1QQ9A 1CP6A 1BPMA 5FSYA 2Q51A 5F09A 1HJZA 4J5QA 3SIHA 3MRUA 5HVGA 2PCUA 5HOLA 2V77A 4EMEA 5K8OA 1DTDA 7CPAA 3PB6X 3HUVA 4GVWA 2C6PA 1F57A 1ZLIA 4P4FA 4UEZA 3PBBA 3Q6ZA
chains in the Genus database with same CATH superfamily
2WPWA 2AFWA 4GUAA 2PJAA 1ZO0A 2FIAA 2QIRA 3IC1A 2OZUA 3BHXA 5FSZA 4B5PB 1Q2CA 2ABZA 5J1QA 5LRJA 1S60A 4MRIA 2Z3MA 3SI2A 3G3SA 4JYWA 4QVTA 2AFSA 4ZX8A 2OB0A 1ZLHA 5AG5A 1TKFA 4TU0A 2ZELA 3H5ZA 4JVVA 1IGBA 3NA6A 5A27A 1M1DA 4A32A 4R76A 4R3KA 2PC1A 3CZXA 5HXDA 1ELMP 3LACA 3S6FA 1IICA 1R57A 3V2BA 1XEBA 2WUUA 4XPLA 2KQVA 2V8DA 4CAFA 1IYLA 2XEGA 2REFA 4UA3A 2B5GA 4IHMA 4HNYB 4RS2A 2PJ8A 2PIZA 4JWPA 1KUVA 3KGQA 4KOWA 4MFKA 2A4NA 3DLJA 4OC2A 3ETIA 4OAEA 4R57A 2FXKA 1R3NA 3P2HA 3S9NA 4JXRA 1CX8A 4H2KA 4DYOA 5CB3A 2JBJA 2VZYA 2AJ6A 2GANA 3L2NA 1A2ZA 4A94A 1VGYA 4MMOA 2Z3LA 4ZYQA 1YLOA 2AFZA 3ISXA 2FXFA 4NGQA 4Q7AA 3KASA 5DWNA 1LAPA 3H8FA 3D4UA 3KQXA 4A2ZA 4A39A 3WC5A 2G3AA 2K5TA 4JJXA 3H8GA 2BCOA 2PIYA 4FD5A 4PPZA 3CT9A 3GQOA 3CDXA 4Q36A 4YGOA 2CNMA 1M4LA 1TF9A 2PJ3A 3F0AA 1JWQA 4PSXA 1I12A 3VH9A 4NGPA 3QAYA 2HB6A 3B3SA 3EXNA 4KVXA 3T9YA 2PR8A 1LAMA 3I1UA 4X8IA 2ANPA 3EWOA 5AILA 2PRBA 4OLLA 4B6ZA 4F0YA 3B3CA 3SJGA 4L89A 4C2XA 4LUAA 1XBUA 2CIJA 3EC4A 2RC4A 4KLWA 1BLLE 3C26A 4MCPA 3S6GA 4C7HA 1B87A 4U9ZA 1QMUA 1MK4A 1BAVA 1Y7EA 4I49A 4MCRA 2BO9A 2FSRA 5JH9A 4NGRA 4ZY0A 4MHYA 4ZI6A 1KWMA 1YVKA 2F7VA 3FH4A 3FF3A 1I1DA 1IYKA 5JGFA 3NH4A 2IJZA 2AFOA 5HMNA 2J8MA 1QSNA 4PSWA 4KLVA 2FIWA 3ZJ0A 4CRYB 2Q04A 4PXCA 2J9AA 3PRTA 2AFUA 3R9FA 3CXSA 5CMSA 3D7GA 3VATA 3NFZA 4UCMA 3LD2A 2P6GA 5G22A 4B5OA 3BI0A 4OMEA 1QSMA 2PVVA 1YW6A 3B2YA 2EK9A 2O4HA 3CXPA 3CPXA 3KHXA 3NE8A 4YWYA 3SXOA 4CGNA 5IV0A 1VKCA 1IU8A 3B3VA 4F8ZA 1XMTA 4KSFA 3SIIA 3VARA 4K30A 2QMLA 4AVCA 1YD9A 5FSXA 1Z8WA 5I0CA 5CPAA 4NEXA 4UIAA 4U5YA 1J4JA 2V8HA 2IMOA 4LQGA 2ZEOA 3TC8A 3TOBA 4RUHA 3KHZA 4NGNA 1M44A 4P4EA 2PDOA 2B5GB 4PK2A 4ONWA 5D29A 3WABA 4NXYA 3EW5A 2VL1A 2Z3KA 4P4DA 2XEJA 4Q38A 2X7BA 1S5KA 3IU1A 3S9MA 3GPGA 5FSVA 2YNCC 4MI4A 2ODFA 4FD6A 2ARHA 2Z0ZA 2FCKA 2ZOFA 3NH5A 1AMPA 1CG2A 2ZOGA 3D2PA 4A37A 2Z3NA 2D4OA 2DPTA 4NFRA 2B4BA 4OIWA 3KL9A 6CPAA 2DX6A 1ZR5A 1DE4C 1QSOA 1WK4A 4HNWB 2GFQA 4CGPA 3I9SA 2ZW7A 5C82A 3ISZA 2Q7BA 4A38A 2Q0YA 3FMCA 2WCTA 3FVLA 1SPVA 2PJ6A 3GPOA 2OZGA 4NGMA 4HPSA 2W2GA 1H8LA 1QSRA 2ATRA 3RAMA 2X47A 3GB0A 4UCPA 2RFHA 3PP9A 2B58A 3GQEA 4OADA 1IOFA 5F49A 3FEEA 5AGEA 2XEFA 4UFVA 2H5MA 1Z9UA 3IIBA 4GVVA 1KUXA 5KTDA 1X12A 2LGRA 5HH1A 4QB9A 1R43A 2Z10A 4MHNA 3FNCA 1M4IA 5JM6A 1P4NA 2POKA 4L8AA 4GXHA 1NE9A 1CPXA 3BLNA 4C7IA 4B11A 5LYFA 4KORA 2CTBA 3EWRA 2BFRA 1JQGA 3RZAA 1MJ9A 4MBUA 3PB8X 4OP4A 3D3SA 4JD6A 4FD7A 1M4DA 2PVWA 4MCQA 2ZPAA 4UBRA 4F6AA 4IQYA 2NSMA 1PCAA 4OC1A 4MCSA 1Y7RA 2OU2A 3D7HA 3FECA 1IB1E 3MGDA 4QBJA 2PRQA 2QVPA 4KSIA 1YLEA 3PGPA 5CNPA 5F48A 1Z8TA 4WJBA 2BL1A 5H86A 2ZEMA 1K4JA 3R96A 3B3WA 4AVAA 4YFJA 2FS5A 4XPKA 1ZG8A 3WT4A 4BBHA 5AG4A 1UWYA 4XPDB 4KZTA 1QSTA 2CNTA 1HDQA 3IWGA 4QC6A 1L0CA 4M6GA 4PK3A 5LYDA 4BMHA 2R7HA 2YGWA 2CF4A 3TCVA 3MN8A 4R6TA 1OBRA 2NYQA 1CPSA 3FEDA 1VHOA 5IB9A 4MHPA 3GPQA 4E8OA 3F8KA 1VHEA 2ZEHA 3TTHA 4NSQA 2OR4A 3V45A 2PJ7A 4OIDA 1LOKA 2PJBA 1TKHA 3NE7A 4ZY1A 5GCNA 3W6SA 1Z4EA 3PB7X 3TT2A 2BUEA 1Z2LA 3GLJA 5D8NA 4KYBA 3T8WA 2B4DA 3QB8A 1GHEA 4JXQA 4P6YA 4EFDA 2EK8A 2GIVA 5EMIA 4CGMA 3BJ8A 2BSWA 4MFZA 4NGTA 3RO0A 3IWWA 1RXTA 4GM5A 3KQZA 2C6CA 2PJCA 3IU2A 5ELYA 2Z3OA 3S9LA 4IF5A 3GIUA 1RTQA 2XD7A 3S6HA 2EUIA 3ZZIA 4MFJA 3KR5A 4J4ZA 4OKOA 4P45A 3EJGA 2R98A 2PJ5A 4FAIA 4CRZB 1X10A 4UWIA 1S7LA 2BOAA 3PBEA 4MXUA 1ZG7A 4J3GA 3TOAA 2FE7A 3FBUA 3RYOA 4O23A 3JZTA 3EWQA 1LANA 2AE6A 2GE3A 2Q4VA 1AYEA 1UFHA 1GYTA 3DDDA 4KOYA 2ZW6A 4R3LA 4CAXA 3TE4A 4W9YA 2P6FA 2VEZA 4CYNA 4TNUA 1MJAA 4OC3A 1VHUA 4MY0A 4RN7A 1N71A 4X2TA 3KKWA 3LMSA 4P4BA 5EBVA 2G9DA 4JGKA 1LRZA 1I21A 4IUSA 1XE4A 3QNVA 4IK2A 1TXZA 5E96A 2PE3A 3W91A 4CYQA 2C1CA 3CXQA 3EFAA 2RNKA 3CPAA 1Y0YA 2Q44A 2PR1A 2BFQA 3S6KA 1ARLA 2YNCA 4KSAA 1XFOA 5FSUA 2HV2A 4EWTA 1TF8A 2JLMA 2HC9A 2Q4YA 4KUAA 2WSAA 4CYPA 5HIHA 3IFEA 4KOUA 4JLYA 4CAVA 3F5BA 3N5FA 3SIJA 4KVOE 4B10A 4MFPA 2KCWA 2ZENA 3A9LA 4KUBA 2WYRA 3N7ZA 3SXNA 1XMBA 4PV6A 3TX8A 1LCPA 5JPHA 1YGHA 2I79A 3BJ7A 2C27A 3D7FA 4LQ6A 4PQAA 3PFEA 2GU2A 1EE3P 2ZW5A 2JEWA 3RNZA 3H8EA 2ZEPA 1PU9A 3K9TA 3FRMA 4UFXA 3EO4A 4JZ0A 4CAWA 2Q4ZA 4MHZA 3D2MA 5KTAA 4B13A 4H6UA 3FJUA 4CS0B 1Z4RA 4JCAA 4DUKA 1YSJA 3PFOA 4DNCA 4F0XA 3R9GA 3R9EA 1ARMA 2Q43A 4UMLA 2B3VA 3QAHA 2B4DB 5C88A 2ZEFA 2V8VA 3HLPA 1P0HA 2AFXA 2CXAA 2PJ4A 4YRHA 4MJ8A 3TO6A 2PSWA 4B12A 2EEEA 1CJWA 3IGRA 3SJFA 3V38A 1S7KA 2JBKA 4ABLA 1NSLA 4H6ZA 1YVOA 1TXRA 1S7NA 1YQEA 4R7MA 5FVJA 4A30A 1XOVA 2QJ8A 3GYAA 4HKFA 4CPAA 4P4JA 4ZX9A 5J8CA 3PEIA 2WZNA 3GY9A 5J8FA 1KUYA 2QECA 3D8PA 4BD9A 5G20A 1WWZA 3EY5A 5G1ZA 3SI1A 3E0KA 4F9UA 4A33A 5CB5A 1B6BA 5DS0A 2ZEGA 3DGVA 1U6MA 3PB9X 2G3TA 3GKRA 4A95A 1NSAA 1YW4A 2BEIA 2YNEA 5ISVA 5E3BA 4II9A 5LYIA 2QYVA 4JLLA 3SHPA 1FNOA 4E2AA 4YU9A 4RI1A 2ZEDA 4D86A 4CAEA 5A28A 2D4PA 1FT7A 1HEEA 3DR6A 1BPNA 1BOBA 2PJ0A 4UEEA 5DWMA 4A31A 4AXVA 2IQ6A 3SJEA 2CNSA 8CPAA 1Y9KA 5F46A 3TFYA 2FAVA 4K3NA 1VIXA 3IO1A 3EWPA 2VXKA 4KOTA 2VZZA 4R8FA 3W6XA 4TWEA 3I3GA 2F8HA 1TIQA 3D66A 2FG1A 1Q7LA 3PB4X 4PXDA 4UWJA 2Q7SA 2JZDA 3D68A 3DR8A 1FY7A 4FWUA 4X5KA 2DF5A 4Y49C 5HVHA 1XIXA 2GREA 2PQ8A 3R95A 4R9MA 4CGLA 3VFQA 1CM0A 2OH1A 3B7IA 3B8GA 3LWUA 2J8RA 4C68A 5KTCA 2DPSA 4CYOA 2I3CA 3KI9A 5H84A 1OZPA 2ZXVA 4PXEA 1CP7A 4QUSA 2XEIA 3JTKA 3FYNA 4UEFA 2FVGA 4FD4A 4UIBA 4ZGYB 4ETJA 4J5SA 1Z8LA 2DEAA 1Z8XA 4XNHC 2O53A 3RBUA 2RB7A 2P0WA 5THWA 5BWAB 4UF4A 5I4MA 3JVNA 2JZFA 3B3TA 2Z3PA 4CGOA 4Z65A 2ACFA 1IIDA 4NJQA 3Q71A 4ABKA 2HUZA 3EKEA 4P10A 3SIGA 4BINA 2DXQA 1IY7A 1F2OA 2REEA 1NMTA 3G8WA 4HNXB 3JRUA 5AG7A 4MFLA 4AB7A 2L8RA 4KS9A 1YREA 2WPXA 4C2ZA 3TO9A 3BI1A 1MJBA 2F5IA 2PJ9A 3PZJA 4OC5A 4AG9A 1PYTB 3V8IA 5IB0A 4MFQA 4E0AA 5EC4A 1BO4A 1TKJA 1ZR3A 1XJOA 5CBMA 2PJ2A 3D67A 3WC6A 5LRGA 1HDUA 3K9UA 5K8NA 3KZWA 1AUGA 1ELLP 4WWVA 4AG7A 2YNDA 3K2KA 5F47A 4ESSA 2C6GA 3TO7A 3IIFA 5LRKA 1NJRA 2NMTA 2EVNA 2CTCA 2AFCA 3H4QA 4B14A 2Y0MA 5JQ4A 2R8VA 4ZY2A 2P6EA 4OC4A 5DUSA 3SI0A 3KR4A 3IWEA 2EWBA 4ETKA 1YMEA 3FIXA 4Y49B 5AG6A 4EVYA 1YX0A 4G1PA 4ONUA 4H89A 4NGSA 4P4IA 5HVFA 3WC7A 3BXMA 5G21A 3FX6A 3R1KA 4KOXA 2VRIA 4ZBGA 2OOTA 4OC0A 4M85A 4X3RA 4FUUA 3T90A 3EJFA 1KZFA 2GLFA 2I00A 1YR0A 3IIDA 3SJXA 1XRYA 4KVME 3V7ZA 4UCNA 3GUXA 4XNHB 4DJLA 2VBQA 2B3UA 4J5RA 1CBXA 1F2PA 2HQYA 3UY5A 4NCZA 2O28A 2VI7A 3B35A 2PJ1A 1V0CA 1M4GA 3P2FA 1Q2DA 4P44A 4KOSA 4KOVA 2V8GA 3D7DA 4PXBA 2AFMA 4FBEA 4ORFA 1TY8A 5K8PA 3DNSA 4K0CA 5IX3A 4F9VA 1ON0A 3IEHA 3WR7A 4IAVA 2JEVA 2JDCA 4XPDC 2R1IA 3IJ3A 4NJRA 2OZHA 2JZEA 1LFWA 3NH8A 1YK3A 4AVBA 4B5PA 2ZEEA 5LYLA 5K8MA 4M6HA 1Y0RA 1Z5RA 1XF8A 1ZG9A 2J8NA 3DSBA 4U9YA 3VWDA 4NF1A 1PUAA 2GLJA 4R87A 1QQ9A 3VWEA 4GS4A 4M6IA 1CP6A 2EO8A 1BPMA 5FSYA 1SQHA 2Q51A 3FXTA 4LX9A 5F09A 1HJZA 4J5QA 3SIHA 1S3ZA 3MRUA 5HVGA 2PCUA 5HOLA 1VHSA 2V77A 4EMEA 5K8OA 2IL4A 1DTDA 3FB3A 3JUWA 4MY3A 1IOIA 7CPAA 2EBJA 3OWCA 2JDDA 4C2YA 3PB6X 1Y9WA 2CY2A 2FL4A 3HUVA 1S7FA 4GVWA 4MHDA 2G0BA 2Z11A 2ZW4A 2C6PA 1F57A 1ZLIA 2VQYA 4UFWA 4P4FA 2FT0A 4UEZA 3LODA 1RO5A 3PBBA 3Q6ZA 4M3SA 1Q2YA
chains in the Genus database with same CATH topology
2AFWA 4GUAA 2PJAA 3IC1A 3BHXA 5FSZA 2ABZA 5J1QA 5LRJA 4MRIA 3SI2A 4JYWA 2AFSA 4ZX8A 1ZLHA 1TKFA 4TU0A 2ZELA 4JVVA 1IGBA 3NA6A 4R76A 5HXDA 1ELMP 3V2BA 2V8DA 2XEGA 4IHMA 2PJ8A 2PIZA 3KGQA 3DLJA 4OC2A 3ETIA 2FXKA 1R3NA 3S9NA 1CX8A 4H2KA 4DYOA 5CB3A 2JBJA 3L2NA 4A94A 1VGYA 4MMOA 4ZYQA 1YLOA 2AFZA 3ISXA 4NGQA 4Q7AA 3KASA 1LAPA 3H8FA 3D4UA 3KQXA 4A39A 3WC5A 3H8GA 2BCOA 2PIYA 4PPZA 3CT9A 3GQOA 3CDXA 2PJ3A 1M4LA 1TF9A 3VH9A 4NGPA 2HB6A 3B3SA 4X8IA 1LAMA 3I1UA 2ANPA 3EWOA 5AILA 4B6ZA 3B3CA 3SJGA 1XBUA 2CIJA 4MCPA 1BLLE 1QMUA 1BAVA 1Y7EA 4MCRA 2BO9A 5JH9A 4NGRA 4ZY0A 4MHYA 4ZI6A 1KWMA 2F7VA 3FH4A 3FF3A 5JGFA 3NH4A 2IJZA 2AFOA 4PXCA 2J9AA 3PRTA 2AFUA 5CMSA 3D7GA 3VATA 3NFZA 3BI0A 4OMEA 2PVVA 1YW6A 3B2YA 2EK9A 2O4HA 3CPXA 3KHXA 4YWYA 3B3VA 4F8ZA 3SIIA 3VARA 1YD9A 5FSXA 5CPAA 4UIAA 2V8HA 2IMOA 4LQGA 2ZEOA 3TC8A 4RUHA 3KHZA 4NGNA 4P4EA 5D29A 3WABA 4ONWA 3EW5A 2VL1A 4P4DA 2XEJA 3S9MA 3GPGA 5FSVA 3NH5A 2ZOFA 1AMPA 1CG2A 2ZOGA 4A37A 4NFRA 4OIWA 3KL9A 6CPAA 2DX6A 1ZR5A 1DE4C 3ISZA 4A38A 3FMCA 3FVLA 1SPVA 2PJ6A 3GPOA 4NGMA 1H8LA 3RAMA 2X47A 3GB0A 2RFHA 3GQEA 3FEEA 2XEFA 3IIBA 4GVVA 2LGRA 1R43A 4MHNA 5JM6A 2POKA 1CPXA 5LYFA 2CTBA 3EWRA 2BFRA 1JQGA 3RZAA 3PB8X 4OP4A 2PVWA 4MCQA 4IQYA 2NSMA 1PCAA 4OC1A 4MCSA 3D7HA 3FECA 2PRQA 2QVPA 4KSIA 4WJBA 2ZEMA 3B3WA 1ZG8A 3WT4A 1UWYA 1HDQA 5LYDA 2CF4A 3MN8A 4R6TA 1OBRA 2NYQA 1CPSA 3FEDA 1VHOA 5IB9A 4MHPA 3GPQA 1VHEA 2ZEHA 2OR4A 3V45A 2PJ7A 4OIDA 1LOKA 2PJBA 1TKHA 4ZY1A 3PB7X 1Z2LA 3GLJA 5D8NA 4KYBA 3T8WA 4P6YA 4EFDA 2EK8A 4NGTA 3IWWA 4GM5A 3KQZA 2C6CA 2PJCA 5ELYA 3S9LA 1RTQA 2XD7A 3KR5A 4J4ZA 4OKOA 4P45A 3EJGA 4FAIA 2PJ5A 4MXUA 2BOAA 3PBEA 1ZG7A 4O23A 3JZTA 3EWQA 1LANA 1AYEA 1GYTA 4W9YA 4TNUA 4OC3A 1VHUA 4X2TA 3LMSA 4P4BA 2G9DA 4JGKA 3QNVA 4IK2A 1TXZA 2PE3A 2C1CA 3CPAA 1Y0YA 2BFQA 1ARLA 1XFOA 5FSUA 4EWTA 1TF8A 2HC9A 5HIHA 3IFEA 3N5FA 3SIJA 2ZENA 2WYRA 1XMBA 3TX8A 1LCPA 3D7FA 4PQAA 3PFEA 2GU2A 1EE3P 2JEWA 3H8EA 2ZEPA 3K9TA 4JZ0A 2Q4ZA 4MHZA 3FJUA 4DUKA 4JCAA 1YSJA 3PFOA 1ARMA 2Q43A 4UMLA 2ZEFA 2V8VA 3HLPA 2AFXA 2PJ4A 2EEEA 3SJFA 3V38A 2JBKA 4ABLA 1TXRA 4R7MA 2QJ8A 4CPAA 4P4JA 4ZX9A 3PEIA 2WZNA 4BD9A 3SI1A 4F9UA 5CB5A 5DS0A 2ZEGA 3DGVA 3PB9X 1NSAA 1YW4A 5E3BA 5LYIA 2QYVA 4JLLA 1FNOA 4YU9A 2ZEDA 4D86A 1FT7A 1HEEA 1BPNA 4UEEA 2PJ0A 4AXVA 2IQ6A 3SJEA 8CPAA 2FAVA 4K3NA 1VIXA 3IO1A 3EWPA 4R8FA 4TWEA 2F8HA 3D66A 2FG1A 1Q7LA 3PB4X 4PXDA 3D68A 4FWUA 5HVHA 2GREA 3VFQA 3B7IA 3LWUA 2I3CA 3KI9A 4PXEA 1CP7A 4UEFA 2XEIA 2FVGA 4UIBA 2DEAA 4ETJA 4J5SA 1Z8LA 2O53A 3RBUA 2RB7A 5THWA 4UF4A 5I4MA 3B3TA 4Z65A 2ACFA 4NJQA 3Q71A 4ABKA 4P10A 3EKEA 3SIGA 1IY7A 1F2OA 3JRUA 2L8RA 3BI1A 4OC5A 2PJ9A 1PYTB 1TKJA 1ZR3A 1XJOA 5CBMA 2PJ2A 3D67A 3WC6A 5LRGA 1HDUA 5K8NA 3KZWA 1ELLP 4WWVA 3K2KA 4ESSA 2C6GA 3IIFA 5LRKA 1NJRA 2CTCA 2AFCA 4OC4A 4ZY2A 5DUSA 3SI0A 3KR4A 2EWBA 4ETKA 1YMEA 4G1PA 4NGSA 4P4IA 5HVFA 3WC7A 3BXMA 3FX6A 2OOTA 2VRIA 4OC0A 4X3RA 4FUUA 3EJFA 2GLFA 3IIDA 3SJXA 1XRYA 3V7ZA 3GUXA 4DJLA 4J5RA 1CBXA 1F2PA 3B35A 2PJ1A 4P44A 2V8GA 3D7DA 4PXBA 2AFMA 4FBEA 1TY8A 5K8PA 4K0CA 4F9VA 3IEHA 4IAVA 3IJ3A 4NJRA 3NH8A 1LFWA 2ZEEA 5LYLA 5K8MA 1Y0RA 1Z5RA 1ZG9A 2GLJA 1QQ9A 1CP6A 1BPMA 5FSYA 2Q51A 5F09A 1HJZA 4J5QA 3SIHA 3MRUA 5HVGA 2PCUA 5HOLA 2V77A 4EMEA 5K8OA 1DTDA 7CPAA 3PB6X 3HUVA 4GVWA 2C6PA 1F57A 1ZLIA 4P4FA 4UEZA 3PBBA 3Q6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFW A;  4GUA A;  2PJA A;  3IC1 A;  3BHX A;  5FSZ A;  2ABZ A;  5J1Q A;  5LRJ A;  4MRI A;  3SI2 A;  4JYW A;  2AFS A;  4ZX8 A;  1ZLH A;  1TKF A;  4TU0 A;  2ZEL A;  4JVV A;  1IGB A;  3NA6 A;  4R76 A;  5HXD A;  1ELM P;  3V2B A;  2V8D A;  2XEG A;  4IHM A;  2PJ8 A;  2PIZ A;  3KGQ A;  3DLJ A;  4OC2 A;  3ETI A;  2FXK A;  1R3N A;  3S9N A;  1CX8 A;  4H2K A;  4DYO A;  5CB3 A;  2JBJ A;  3L2N A;  4A94 A;  1VGY A;  4MMO A;  4ZYQ A;  1YLO A;  2AFZ A;  3ISX A;  4NGQ A;  4Q7A A;  3KAS A;  1LAP A;  3H8F A;  3D4U A;  3KQX A;  4A39 A;  3WC5 A;  3H8G A;  2BCO A;  2PIY A;  4PPZ A;  3CT9 A;  3GQO A;  3CDX A;  2PJ3 A;  1M4L A;  1TF9 A;  3VH9 A;  4NGP A;  2HB6 A;  3B3S A;  4X8I A;  1LAM A;  3I1U A;  2ANP A;  3EWO A;  5AIL A;  4B6Z A;  3B3C A;  3SJG A;  1XBU A;  2CIJ A;  4MCP A;  1BLL E;  1QMU A;  1BAV A;  1Y7E A;  4MCR A;  2BO9 A;  5JH9 A;  4NGR A;  4ZY0 A;  4MHY A;  4ZI6 A;  1KWM A;  2F7V A;  3FH4 A;  3FF3 A;  5JGF A;  3NH4 A;  2IJZ A;  2AFO A;  4PXC A;  2J9A A;  3PRT A;  2AFU A;  5CMS A;  3D7G A;  3VAT A;  3NFZ A;  3BI0 A;  4OME A;  2PVV A;  1YW6 A;  3B2Y A;  2EK9 A;  2O4H A;  3CPX A;  3KHX A;  4YWY A;  3B3V A;  4F8Z A;  3SII A;  3VAR A;  1YD9 A;  5FSX A;  5CPA A;  4UIA A;  2V8H A;  2IMO A;  4LQG A;  2ZEO A;  3TC8 A;  4RUH A;  3KHZ A;  4NGN A;  4P4E A;  5D29 A;  3WAB A;  4ONW A;  3EW5 A;  2VL1 A;  4P4D A;  2XEJ A;  3S9M A;  3GPG A;  5FSV A;  3NH5 A;  2ZOF A;  1AMP A;  1CG2 A;  2ZOG A;  4A37 A;  4NFR A;  4OIW A;  3KL9 A;  6CPA A;  2DX6 A;  1ZR5 A;  1DE4 C;  3ISZ A;  4A38 A;  3FMC A;  3FVL A;  1SPV A;  2PJ6 A;  3GPO A;  4NGM A;  1H8L A;  3RAM A;  2X47 A;  3GB0 A;  2RFH A;  3GQE A;  3FEE A;  2XEF A;  3IIB A;  4GVV A;  2LGR A;  1R43 A;  4MHN A;  5JM6 A;  2POK A;  1CPX A;  5LYF A;  2CTB A;  3EWR A;  2BFR A;  1JQG A;  3RZA A;  3PB8 X;  4OP4 A;  2PVW A;  4MCQ A;  4IQY A;  2NSM A;  1PCA A;  4OC1 A;  4MCS A;  3D7H A;  3FEC A;  2PRQ A;  2QVP A;  4KSI A;  4WJB A;  2ZEM A;  3B3W A;  1ZG8 A;  3WT4 A;  1UWY A;  1HDQ A;  5LYD A;  2CF4 A;  3MN8 A;  4R6T A;  1OBR A;  2NYQ A;  1CPS A;  3FED A;  1VHO A;  5IB9 A;  4MHP A;  3GPQ A;  1VHE A;  2ZEH A;  2OR4 A;  3V45 A;  2PJ7 A;  4OID A;  1LOK A;  2PJB A;  1TKH A;  4ZY1 A;  3PB7 X;  1Z2L A;  3GLJ A;  5D8N A;  4KYB A;  3T8W A;  4P6Y A;  4EFD A;  2EK8 A;  4NGT A;  3IWW A;  4GM5 A;  3KQZ A;  2C6C A;  2PJC A;  5ELY A;  3S9L A;  1RTQ A;  2XD7 A;  3KR5 A;  4J4Z A;  4OKO A;  4P45 A;  3EJG A;  4FAI A;  2PJ5 A;  4MXU A;  2BOA A;  3PBE A;  1ZG7 A;  4O23 A;  3JZT A;  3EWQ A;  1LAN A;  1AYE A;  1GYT A;  4W9Y A;  4TNU A;  4OC3 A;  1VHU A;  4X2T A;  3LMS A;  4P4B A;  2G9D A;  4JGK A;  3QNV A;  4IK2 A;  1TXZ A;  2PE3 A;  2C1C A;  3CPA A;  1Y0Y A;  2BFQ A;  1ARL A;  1XFO A;  5FSU A;  4EWT A;  1TF8 A;  2HC9 A;  5HIH A;  3IFE A;  3N5F A;  3SIJ A;  2ZEN A;  2WYR A;  1XMB A;  3TX8 A;  1LCP A;  3D7F A;  4PQA A;  3PFE A;  2GU2 A;  1EE3 P;  2JEW A;  3H8E A;  2ZEP A;  3K9T A;  4JZ0 A;  2Q4Z A;  4MHZ A;  3FJU A;  4DUK A;  4JCA A;  1YSJ A;  3PFO A;  1ARM A;  2Q43 A;  4UML A;  2ZEF A;  2V8V A;  3HLP A;  2AFX A;  2PJ4 A;  2EEE A;  3SJF A;  3V38 A;  2JBK A;  4ABL A;  1TXR A;  4R7M A;  2QJ8 A;  4CPA A;  4P4J A;  4ZX9 A;  3PEI A;  2WZN A;  4BD9 A;  3SI1 A;  4F9U A;  5CB5 A;  5DS0 A;  2ZEG A;  3DGV A;  3PB9 X;  1NSA A;  1YW4 A;  5E3B A;  5LYI A;  2QYV A;  4JLL A;  1FNO A;  4YU9 A;  2ZED A;  4D86 A;  1FT7 A;  1HEE A;  1BPN A;  4UEE A;  2PJ0 A;  4AXV A;  2IQ6 A;  3SJE A;  8CPA A;  2FAV A;  4K3N A;  1VIX A;  3IO1 A;  3EWP A;  4R8F A;  4TWE A;  2F8H A;  3D66 A;  2FG1 A;  1Q7L A;  3PB4 X;  4PXD A;  3D68 A;  4FWU A;  5HVH A;  2GRE A;  3VFQ A;  3B7I A;  3LWU A;  2I3C A;  3KI9 A;  4PXE A;  1CP7 A;  4UEF A;  2XEI A;  2FVG A;  4UIB A;  2DEA A;  4ETJ A;  4J5S A;  1Z8L A;  2O53 A;  3RBU A;  2RB7 A;  5THW A;  4UF4 A;  5I4M A;  3B3T A;  4Z65 A;  2ACF A;  4NJQ A;  3Q71 A;  4ABK A;  4P10 A;  3EKE A;  3SIG A;  1IY7 A;  1F2O A;  3JRU A;  2L8R A;  3BI1 A;  4OC5 A;  2PJ9 A;  1PYT B;  1TKJ A;  1ZR3 A;  1XJO A;  5CBM A;  2PJ2 A;  3D67 A;  3WC6 A;  5LRG A;  1HDU A;  5K8N A;  3KZW A;  1ELL P;  4WWV A;  3K2K A;  4ESS A;  2C6G A;  3IIF A;  5LRK A;  1NJR A;  2CTC A;  2AFC A;  4OC4 A;  4ZY2 A;  5DUS A;  3SI0 A;  3KR4 A;  2EWB A;  4ETK A;  1YME A;  4G1P A;  4NGS A;  4P4I A;  5HVF A;  3WC7 A;  3BXM A;  3FX6 A;  2OOT A;  2VRI A;  4OC0 A;  4X3R A;  4FUU A;  3EJF A;  2GLF A;  3IID A;  3SJX A;  1XRY A;  3V7Z A;  3GUX A;  4DJL A;  4J5R A;  1CBX A;  1F2P A;  3B35 A;  2PJ1 A;  4P44 A;  2V8G A;  3D7D A;  4PXB A;  2AFM A;  4FBE A;  1TY8 A;  5K8P A;  4K0C A;  4F9V A;  3IEH A;  4IAV A;  3IJ3 A;  4NJR A;  3NH8 A;  1LFW A;  2ZEE A;  5LYL A;  5K8M A;  1Y0R A;  1Z5R A;  1ZG9 A;  2GLJ A;  1QQ9 A;  1CP6 A;  1BPM A;  5FSY A;  2Q51 A;  5F09 A;  1HJZ A;  4J5Q A;  3SIH A;  3MRU A;  5HVG A;  2PCU A;  5HOL A;  2V77 A;  4EME A;  5K8O A;  1DTD A;  7CPA A;  3PB6 X;  3HUV A;  4GVW A;  2C6P A;  1F57 A;  1ZLI A;  4P4F A;  4UEZ A;  3PBB A;  3Q6Z A; 
#chains in the Genus database with same CATH topology
 2WPW A;  2AFW A;  4GUA A;  2PJA A;  1ZO0 A;  2FIA A;  2QIR A;  3IC1 A;  2OZU A;  3BHX A;  5FSZ A;  4B5P B;  1Q2C A;  2ABZ A;  5J1Q A;  5LRJ A;  1S60 A;  4MRI A;  2Z3M A;  3SI2 A;  3G3S A;  4JYW A;  4QVT A;  2AFS A;  4ZX8 A;  2OB0 A;  1ZLH A;  5AG5 A;  1TKF A;  4TU0 A;  2ZEL A;  3H5Z A;  4JVV A;  1IGB A;  3NA6 A;  5A27 A;  1M1D A;  4A32 A;  4R76 A;  4R3K A;  2PC1 A;  3CZX A;  5HXD A;  1ELM P;  3LAC A;  3S6F A;  1IIC A;  1R57 A;  3V2B A;  1XEB A;  2WUU A;  4XPL A;  2KQV A;  2V8D A;  4CAF A;  1IYL A;  2XEG A;  2REF A;  4UA3 A;  2B5G A;  4IHM A;  4HNY B;  4RS2 A;  2PJ8 A;  2PIZ A;  4JWP A;  1KUV A;  3KGQ A;  4KOW A;  4MFK A;  2A4N A;  3DLJ A;  4OC2 A;  3ETI A;  4OAE A;  4R57 A;  2FXK A;  1R3N A;  3P2H A;  3S9N A;  4JXR A;  1CX8 A;  4H2K A;  4DYO A;  5CB3 A;  2JBJ A;  2VZY A;  2AJ6 A;  2GAN A;  3L2N A;  1A2Z A;  4A94 A;  1VGY A;  4MMO A;  2Z3L A;  4ZYQ A;  1YLO A;  2AFZ A;  3ISX A;  2FXF A;  4NGQ A;  4Q7A A;  3KAS A;  5DWN A;  1LAP A;  3H8F A;  3D4U A;  3KQX A;  4A2Z A;  4A39 A;  3WC5 A;  2G3A A;  2K5T A;  4JJX A;  3H8G A;  2BCO A;  2PIY A;  4FD5 A;  4PPZ A;  3CT9 A;  3GQO A;  3CDX A;  4Q36 A;  4YGO A;  2CNM A;  1M4L A;  1TF9 A;  2PJ3 A;  3F0A A;  1JWQ A;  4PSX A;  1I12 A;  3VH9 A;  4NGP A;  3QAY A;  2HB6 A;  3B3S A;  3EXN A;  4KVX A;  3T9Y A;  2PR8 A;  1LAM A;  3I1U A;  4X8I A;  2ANP A;  3EWO A;  5AIL A;  2PRB A;  4OLL A;  4B6Z A;  4F0Y A;  3B3C A;  3SJG A;  4L89 A;  4C2X A;  4LUA A;  1XBU A;  2CIJ A;  3EC4 A;  2RC4 A;  4KLW A;  1BLL E;  3C26 A;  4MCP A;  3S6G A;  4C7H A;  1B87 A;  4U9Z A;  1QMU A;  1MK4 A;  1BAV A;  1Y7E A;  4I49 A;  4MCR A;  2BO9 A;  2FSR A;  5JH9 A;  4NGR A;  4ZY0 A;  4MHY A;  4ZI6 A;  1KWM A;  1YVK A;  2F7V A;  3FH4 A;  3FF3 A;  1I1D A;  1IYK A;  5JGF A;  3NH4 A;  2IJZ A;  2AFO A;  5HMN A;  2J8M A;  1QSN A;  4PSW A;  4KLV A;  2FIW A;  3ZJ0 A;  4CRY B;  2Q04 A;  4PXC A;  2J9A A;  3PRT A;  2AFU A;  3R9F A;  3CXS A;  5CMS A;  3D7G A;  3VAT A;  3NFZ A;  4UCM A;  3LD2 A;  2P6G A;  5G22 A;  4B5O A;  3BI0 A;  4OME A;  1QSM A;  2PVV A;  1YW6 A;  3B2Y A;  2EK9 A;  2O4H A;  3CXP A;  3CPX A;  3KHX A;  3NE8 A;  4YWY A;  3SXO A;  4CGN A;  5IV0 A;  1VKC A;  1IU8 A;  3B3V A;  4F8Z A;  1XMT A;  4KSF A;  3SII A;  3VAR A;  4K30 A;  2QML A;  4AVC A;  1YD9 A;  5FSX A;  1Z8W A;  5I0C A;  5CPA A;  4NEX A;  4UIA A;  4U5Y A;  1J4J A;  2V8H A;  2IMO A;  4LQG A;  2ZEO A;  3TC8 A;  3TOB A;  4RUH A;  3KHZ A;  4NGN A;  1M44 A;  4P4E A;  2PDO A;  2B5G B;  4PK2 A;  4ONW A;  5D29 A;  3WAB A;  4NXY A;  3EW5 A;  2VL1 A;  2Z3K A;  4P4D A;  2XEJ A;  4Q38 A;  2X7B A;  1S5K A;  3IU1 A;  3S9M A;  3GPG A;  5FSV A;  2YNC C;  4MI4 A;  2ODF A;  4FD6 A;  2ARH A;  2Z0Z A;  2FCK A;  2ZOF A;  3NH5 A;  1AMP A;  1CG2 A;  2ZOG A;  3D2P A;  4A37 A;  2Z3N A;  2D4O A;  2DPT A;  4NFR A;  2B4B A;  4OIW A;  3KL9 A;  6CPA A;  2DX6 A;  1ZR5 A;  1DE4 C;  1QSO A;  1WK4 A;  4HNW B;  2GFQ A;  4CGP A;  3I9S A;  2ZW7 A;  5C82 A;  3ISZ A;  2Q7B A;  4A38 A;  2Q0Y A;  3FMC A;  2WCT A;  3FVL A;  1SPV A;  2PJ6 A;  3GPO A;  2OZG A;  4NGM A;  4HPS A;  2W2G A;  1H8L A;  1QSR A;  2ATR A;  3RAM A;  2X47 A;  3GB0 A;  4UCP A;  2RFH A;  3PP9 A;  2B58 A;  3GQE A;  4OAD A;  1IOF A;  5F49 A;  3FEE A;  5AGE A;  2XEF A;  4UFV A;  2H5M A;  1Z9U A;  3IIB A;  4GVV A;  1KUX A;  5KTD A;  1X12 A;  2LGR A;  5HH1 A;  4QB9 A;  1R43 A;  2Z10 A;  4MHN A;  3FNC A;  1M4I A;  5JM6 A;  1P4N A;  2POK A;  4L8A A;  4GXH A;  1NE9 A;  1CPX A;  3BLN A;  4C7I A;  4B11 A;  5LYF A;  4KOR A;  2CTB A;  3EWR A;  2BFR A;  1JQG A;  3RZA A;  1MJ9 A;  4MBU A;  3PB8 X;  4OP4 A;  3D3S A;  4JD6 A;  4FD7 A;  1M4D A;  2PVW A;  4MCQ A;  2ZPA A;  4UBR A;  4F6A A;  4IQY A;  2NSM A;  1PCA A;  4OC1 A;  4MCS A;  1Y7R A;  2OU2 A;  3D7H A;  3FEC A;  1IB1 E;  3MGD A;  4QBJ A;  2PRQ A;  2QVP A;  4KSI A;  1YLE A;  3PGP A;  5CNP A;  5F48 A;  1Z8T A;  4WJB A;  2BL1 A;  5H86 A;  2ZEM A;  1K4J A;  3R96 A;  3B3W A;  4AVA A;  4YFJ A;  2FS5 A;  4XPK A;  1ZG8 A;  3WT4 A;  4BBH A;  5AG4 A;  1UWY A;  4XPD B;  4KZT A;  1QST A;  2CNT A;  1HDQ A;  3IWG A;  4QC6 A;  1L0C A;  4M6G A;  4PK3 A;  5LYD A;  4BMH A;  2R7H A;  2YGW A;  2CF4 A;  3TCV A;  3MN8 A;  4R6T A;  1OBR A;  2NYQ A;  1CPS A;  3FED A;  1VHO A;  5IB9 A;  4MHP A;  3GPQ A;  4E8O A;  3F8K A;  1VHE A;  2ZEH A;  3TTH A;  4NSQ A;  2OR4 A;  3V45 A;  2PJ7 A;  4OID A;  1LOK A;  2PJB A;  1TKH A;  3NE7 A;  4ZY1 A;  5GCN A;  3W6S A;  1Z4E A;  3PB7 X;  3TT2 A;  2BUE A;  1Z2L A;  3GLJ A;  5D8N A;  4KYB A;  3T8W A;  2B4D A;  3QB8 A;  1GHE A;  4JXQ A;  4P6Y A;  4EFD A;  2EK8 A;  2GIV A;  5EMI A;  4CGM A;  3BJ8 A;  2BSW A;  4MFZ A;  4NGT A;  3RO0 A;  3IWW A;  1RXT A;  4GM5 A;  3KQZ A;  2C6C A;  2PJC A;  3IU2 A;  5ELY A;  2Z3O A;  3S9L A;  4IF5 A;  3GIU A;  1RTQ A;  2XD7 A;  3S6H A;  2EUI A;  3ZZI A;  4MFJ A;  3KR5 A;  4J4Z A;  4OKO A;  4P45 A;  3EJG A;  2R98 A;  2PJ5 A;  4FAI A;  4CRZ B;  1X10 A;  4UWI A;  1S7L A;  2BOA A;  3PBE A;  4MXU A;  1ZG7 A;  4J3G A;  3TOA A;  2FE7 A;  3FBU A;  3RYO A;  4O23 A;  3JZT A;  3EWQ A;  1LAN A;  2AE6 A;  2GE3 A;  2Q4V A;  1AYE A;  1UFH A;  1GYT A;  3DDD A;  4KOY A;  2ZW6 A;  4R3L A;  4CAX A;  3TE4 A;  4W9Y A;  2P6F A;  2VEZ A;  4CYN A;  4TNU A;  1MJA A;  4OC3 A;  1VHU A;  4MY0 A;  4RN7 A;  1N71 A;  4X2T A;  3KKW A;  3LMS A;  4P4B A;  5EBV A;  2G9D A;  4JGK A;  1LRZ A;  1I21 A;  4IUS A;  1XE4 A;  3QNV A;  4IK2 A;  1TXZ A;  5E96 A;  2PE3 A;  3W91 A;  4CYQ A;  2C1C A;  3CXQ A;  3EFA A;  2RNK A;  3CPA A;  1Y0Y A;  2Q44 A;  2PR1 A;  2BFQ A;  3S6K A;  1ARL A;  2YNC A;  4KSA A;  1XFO A;  5FSU A;  2HV2 A;  4EWT A;  1TF8 A;  2JLM A;  2HC9 A;  2Q4Y A;  4KUA A;  2WSA A;  4CYP A;  5HIH A;  3IFE A;  4KOU A;  4JLY A;  4CAV A;  3F5B A;  3N5F A;  3SIJ A;  4KVO E;  4B10 A;  4MFP A;  2KCW A;  2ZEN A;  3A9L A;  4KUB A;  2WYR A;  3N7Z A;  3SXN A;  1XMB A;  4PV6 A;  3TX8 A;  1LCP A;  5JPH A;  1YGH A;  2I79 A;  3BJ7 A;  2C27 A;  3D7F A;  4LQ6 A;  4PQA A;  3PFE A;  2GU2 A;  1EE3 P;  2ZW5 A;  2JEW A;  3RNZ A;  3H8E A;  2ZEP A;  1PU9 A;  3K9T A;  3FRM A;  4UFX A;  3EO4 A;  4JZ0 A;  4CAW A;  2Q4Z A;  4MHZ A;  3D2M A;  5KTA A;  4B13 A;  4H6U A;  3FJU A;  4CS0 B;  1Z4R A;  4JCA A;  4DUK A;  1YSJ A;  3PFO A;  4DNC A;  4F0X A;  3R9G A;  3R9E A;  1ARM A;  2Q43 A;  4UML A;  2B3V A;  3QAH A;  2B4D B;  5C88 A;  2ZEF A;  2V8V A;  3HLP A;  1P0H A;  2AFX A;  2CXA A;  2PJ4 A;  4YRH A;  4MJ8 A;  3TO6 A;  2PSW A;  4B12 A;  2EEE A;  1CJW A;  3IGR A;  3SJF A;  3V38 A;  1S7K A;  2JBK A;  4ABL A;  1NSL A;  4H6Z A;  1YVO A;  1TXR A;  1S7N A;  1YQE A;  4R7M A;  5FVJ A;  4A30 A;  1XOV A;  2QJ8 A;  3GYA A;  4HKF A;  4CPA A;  4P4J A;  4ZX9 A;  5J8C A;  3PEI A;  2WZN A;  3GY9 A;  5J8F A;  1KUY A;  2QEC A;  3D8P A;  4BD9 A;  5G20 A;  1WWZ A;  3EY5 A;  5G1Z A;  3SI1 A;  3E0K A;  4F9U A;  4A33 A;  5CB5 A;  1B6B A;  5DS0 A;  2ZEG A;  3DGV A;  1U6M A;  3PB9 X;  2G3T A;  3GKR A;  4A95 A;  1NSA A;  1YW4 A;  2BEI A;  2YNE A;  5ISV A;  5E3B A;  4II9 A;  5LYI A;  2QYV A;  4JLL A;  3SHP A;  1FNO A;  4E2A A;  4YU9 A;  4RI1 A;  2ZED A;  4D86 A;  4CAE A;  5A28 A;  2D4P A;  1FT7 A;  1HEE A;  3DR6 A;  1BPN A;  1BOB A;  2PJ0 A;  4UEE A;  5DWM A;  4A31 A;  4AXV A;  2IQ6 A;  3SJE A;  2CNS A;  8CPA A;  1Y9K A;  5F46 A;  3TFY A;  2FAV A;  4K3N A;  1VIX A;  3IO1 A;  3EWP A;  2VXK A;  4KOT A;  2VZZ A;  4R8F A;  3W6X A;  4TWE A;  3I3G A;  2F8H A;  1TIQ A;  3D66 A;  2FG1 A;  1Q7L A;  3PB4 X;  4PXD A;  4UWJ A;  2Q7S A;  2JZD A;  3D68 A;  3DR8 A;  1FY7 A;  4FWU A;  4X5K A;  2DF5 A;  4Y49 C;  5HVH A;  1XIX A;  2GRE A;  2PQ8 A;  3R95 A;  4R9M A;  4CGL A;  3VFQ A;  1CM0 A;  2OH1 A;  3B7I A;  3B8G A;  3LWU A;  2J8R A;  4C68 A;  5KTC A;  2DPS A;  4CYO A;  2I3C A;  3KI9 A;  5H84 A;  1OZP A;  2ZXV A;  4PXE A;  1CP7 A;  4QUS A;  2XEI A;  3JTK A;  3FYN A;  4UEF A;  2FVG A;  4FD4 A;  4UIB A;  4ZGY B;  4ETJ A;  4J5S A;  1Z8L A;  2DEA A;  1Z8X A;  4XNH C;  2O53 A;  3RBU A;  2RB7 A;  2P0W A;  5THW A;  5BWA B;  4UF4 A;  5I4M A;  3JVN A;  2JZF A;  3B3T A;  2Z3P A;  4CGO A;  4Z65 A;  2ACF A;  1IID A;  4NJQ A;  3Q71 A;  4ABK A;  2HUZ A;  3EKE A;  4P10 A;  3SIG A;  4BIN A;  2DXQ A;  1IY7 A;  1F2O A;  2REE A;  1NMT A;  3G8W A;  4HNX B;  3JRU A;  5AG7 A;  4MFL A;  4AB7 A;  2L8R A;  4KS9 A;  1YRE A;  2WPX A;  4C2Z A;  3TO9 A;  3BI1 A;  1MJB A;  2F5I A;  2PJ9 A;  3PZJ A;  4OC5 A;  4AG9 A;  1PYT B;  3V8I A;  5IB0 A;  4MFQ A;  4E0A A;  5EC4 A;  1BO4 A;  1TKJ A;  1ZR3 A;  1XJO A;  5CBM A;  2PJ2 A;  3D67 A;  3WC6 A;  5LRG A;  1HDU A;  3K9U A;  5K8N A;  3KZW A;  1AUG A;  1ELL P;  4WWV A;  4AG7 A;  2YND A;  3K2K A;  5F47 A;  4ESS A;  2C6G A;  3TO7 A;  3IIF A;  5LRK A;  1NJR A;  2NMT A;  2EVN A;  2CTC A;  2AFC A;  3H4Q A;  4B14 A;  2Y0M A;  5JQ4 A;  2R8V A;  4ZY2 A;  2P6E A;  4OC4 A;  5DUS A;  3SI0 A;  3KR4 A;  3IWE A;  2EWB A;  4ETK A;  1YME A;  3FIX A;  4Y49 B;  5AG6 A;  4EVY A;  1YX0 A;  4G1P A;  4ONU A;  4H89 A;  4NGS A;  4P4I A;  5HVF A;  3WC7 A;  3BXM A;  5G21 A;  3FX6 A;  3R1K A;  4KOX A;  2VRI A;  4ZBG A;  2OOT A;  4OC0 A;  4M85 A;  4X3R A;  4FUU A;  3T90 A;  3EJF A;  1KZF A;  2GLF A;  2I00 A;  1YR0 A;  3IID A;  3SJX A;  1XRY A;  4KVM E;  3V7Z A;  4UCN A;  3GUX A;  4XNH B;  4DJL A;  2VBQ A;  2B3U A;  4J5R A;  1CBX A;  1F2P A;  2HQY A;  3UY5 A;  4NCZ A;  2O28 A;  2VI7 A;  3B35 A;  2PJ1 A;  1V0C A;  1M4G A;  3P2F A;  1Q2D A;  4P44 A;  4KOS A;  4KOV A;  2V8G A;  3D7D A;  4PXB A;  2AFM A;  4FBE A;  4ORF A;  1TY8 A;  5K8P A;  3DNS A;  4K0C A;  5IX3 A;  4F9V A;  1ON0 A;  3IEH A;  3WR7 A;  4IAV A;  2JEV A;  2JDC A;  4XPD C;  2R1I A;  3IJ3 A;  4NJR A;  2OZH A;  2JZE A;  1LFW A;  3NH8 A;  1YK3 A;  4AVB A;  4B5P A;  2ZEE A;  5LYL A;  5K8M A;  4M6H A;  1Y0R A;  1Z5R A;  1XF8 A;  1ZG9 A;  2J8N A;  3DSB A;  4U9Y A;  3VWD A;  4NF1 A;  1PUA A;  2GLJ A;  4R87 A;  1QQ9 A;  3VWE A;  4GS4 A;  4M6I A;  1CP6 A;  2EO8 A;  1BPM A;  5FSY A;  1SQH A;  2Q51 A;  3FXT A;  4LX9 A;  5F09 A;  1HJZ A;  4J5Q A;  3SIH A;  1S3Z A;  3MRU A;  5HVG A;  2PCU A;  5HOL A;  1VHS A;  2V77 A;  4EME A;  5K8O A;  2IL4 A;  1DTD A;  3FB3 A;  3JUW A;  4MY3 A;  1IOI A;  7CPA A;  2EBJ A;  3OWC A;  2JDD A;  4C2Y A;  3PB6 X;  1Y9W A;  2CY2 A;  2FL4 A;  3HUV A;  1S7F A;  4GVW A;  4MHD A;  2G0B A;  2Z11 A;  2ZW4 A;  2C6P A;  1F57 A;  1ZLI A;  2VQY A;  4UFW A;  4P4F A;  2FT0 A;  4UEZ A;  3LOD A;  1RO5 A;  3PBB A;  3Q6Z A;  4M3S A;  1Q2Y A; 
#chains in the Genus database with same CATH homology
 2AFW A;  4GUA A;  2PJA A;  3IC1 A;  3BHX A;  5FSZ A;  2ABZ A;  5J1Q A;  5LRJ A;  4MRI A;  3SI2 A;  4JYW A;  2AFS A;  4ZX8 A;  1ZLH A;  1TKF A;  4TU0 A;  2ZEL A;  4JVV A;  1IGB A;  3NA6 A;  4R76 A;  5HXD A;  1ELM P;  3V2B A;  2V8D A;  2XEG A;  4IHM A;  2PJ8 A;  2PIZ A;  3KGQ A;  3DLJ A;  4OC2 A;  3ETI A;  2FXK A;  1R3N A;  3S9N A;  1CX8 A;  4H2K A;  4DYO A;  5CB3 A;  2JBJ A;  3L2N A;  4A94 A;  1VGY A;  4MMO A;  4ZYQ A;  1YLO A;  2AFZ A;  3ISX A;  4NGQ A;  4Q7A A;  3KAS A;  1LAP A;  3H8F A;  3D4U A;  3KQX A;  4A39 A;  3WC5 A;  3H8G A;  2BCO A;  2PIY A;  4PPZ A;  3CT9 A;  3GQO A;  3CDX A;  2PJ3 A;  1M4L A;  1TF9 A;  3VH9 A;  4NGP A;  2HB6 A;  3B3S A;  4X8I A;  1LAM A;  3I1U A;  2ANP A;  3EWO A;  5AIL A;  4B6Z A;  3B3C A;  3SJG A;  1XBU A;  2CIJ A;  4MCP A;  1BLL E;  1QMU A;  1BAV A;  1Y7E A;  4MCR A;  2BO9 A;  5JH9 A;  4NGR A;  4ZY0 A;  4MHY A;  4ZI6 A;  1KWM A;  2F7V A;  3FH4 A;  3FF3 A;  5JGF A;  3NH4 A;  2IJZ A;  2AFO A;  4PXC A;  2J9A A;  3PRT A;  2AFU A;  5CMS A;  3D7G A;  3VAT A;  3NFZ A;  3BI0 A;  4OME A;  2PVV A;  1YW6 A;  3B2Y A;  2EK9 A;  2O4H A;  3CPX A;  3KHX A;  4YWY A;  3B3V A;  4F8Z A;  3SII A;  3VAR A;  1YD9 A;  5FSX A;  5CPA A;  4UIA A;  2V8H A;  2IMO A;  4LQG A;  2ZEO A;  3TC8 A;  4RUH A;  3KHZ A;  4NGN A;  4P4E A;  5D29 A;  3WAB A;  4ONW A;  3EW5 A;  2VL1 A;  4P4D A;  2XEJ A;  3S9M A;  3GPG A;  5FSV A;  3NH5 A;  2ZOF A;  1AMP A;  1CG2 A;  2ZOG A;  4A37 A;  4NFR A;  4OIW A;  3KL9 A;  6CPA A;  2DX6 A;  1ZR5 A;  1DE4 C;  3ISZ A;  4A38 A;  3FMC A;  3FVL A;  1SPV A;  2PJ6 A;  3GPO A;  4NGM A;  1H8L A;  3RAM A;  2X47 A;  3GB0 A;  2RFH A;  3GQE A;  3FEE A;  2XEF A;  3IIB A;  4GVV A;  2LGR A;  1R43 A;  4MHN A;  5JM6 A;  2POK A;  1CPX A;  5LYF A;  2CTB A;  3EWR A;  2BFR A;  1JQG A;  3RZA A;  3PB8 X;  4OP4 A;  2PVW A;  4MCQ A;  4IQY A;  2NSM A;  1PCA A;  4OC1 A;  4MCS A;  3D7H A;  3FEC A;  2PRQ A;  2QVP A;  4KSI A;  4WJB A;  2ZEM A;  3B3W A;  1ZG8 A;  3WT4 A;  1UWY A;  1HDQ A;  5LYD A;  2CF4 A;  3MN8 A;  4R6T A;  1OBR A;  2NYQ A;  1CPS A;  3FED A;  1VHO A;  5IB9 A;  4MHP A;  3GPQ A;  1VHE A;  2ZEH A;  2OR4 A;  3V45 A;  2PJ7 A;  4OID A;  1LOK A;  2PJB A;  1TKH A;  4ZY1 A;  3PB7 X;  1Z2L A;  3GLJ A;  5D8N A;  4KYB A;  3T8W A;  4P6Y A;  4EFD A;  2EK8 A;  4NGT A;  3IWW A;  4GM5 A;  3KQZ A;  2C6C A;  2PJC A;  5ELY A;  3S9L A;  1RTQ A;  2XD7 A;  3KR5 A;  4J4Z A;  4OKO A;  4P45 A;  3EJG A;  4FAI A;  2PJ5 A;  4MXU A;  2BOA A;  3PBE A;  1ZG7 A;  4O23 A;  3JZT A;  3EWQ A;  1LAN A;  1AYE A;  1GYT A;  4W9Y A;  4TNU A;  4OC3 A;  1VHU A;  4X2T A;  3LMS A;  4P4B A;  2G9D A;  4JGK A;  3QNV A;  4IK2 A;  1TXZ A;  2PE3 A;  2C1C A;  3CPA A;  1Y0Y A;  2BFQ A;  1ARL A;  1XFO A;  5FSU A;  4EWT A;  1TF8 A;  2HC9 A;  5HIH A;  3IFE A;  3N5F A;  3SIJ A;  2ZEN A;  2WYR A;  1XMB A;  3TX8 A;  1LCP A;  3D7F A;  4PQA A;  3PFE A;  2GU2 A;  1EE3 P;  2JEW A;  3H8E A;  2ZEP A;  3K9T A;  4JZ0 A;  2Q4Z A;  4MHZ A;  3FJU A;  4DUK A;  4JCA A;  1YSJ A;  3PFO A;  1ARM A;  2Q43 A;  4UML A;  2ZEF A;  2V8V A;  3HLP A;  2AFX A;  2PJ4 A;  2EEE A;  3SJF A;  3V38 A;  2JBK A;  4ABL A;  1TXR A;  4R7M A;  2QJ8 A;  4CPA A;  4P4J A;  4ZX9 A;  3PEI A;  2WZN A;  4BD9 A;  3SI1 A;  4F9U A;  5CB5 A;  5DS0 A;  2ZEG A;  3DGV A;  3PB9 X;  1NSA A;  1YW4 A;  5E3B A;  5LYI A;  2QYV A;  4JLL A;  1FNO A;  4YU9 A;  2ZED A;  4D86 A;  1FT7 A;  1HEE A;  1BPN A;  4UEE A;  2PJ0 A;  4AXV A;  2IQ6 A;  3SJE A;  8CPA A;  2FAV A;  4K3N A;  1VIX A;  3IO1 A;  3EWP A;  4R8F A;  4TWE A;  2F8H A;  3D66 A;  2FG1 A;  1Q7L A;  3PB4 X;  4PXD A;  3D68 A;  4FWU A;  5HVH A;  2GRE A;  3VFQ A;  3B7I A;  3LWU A;  2I3C A;  3KI9 A;  4PXE A;  1CP7 A;  4UEF A;  2XEI A;  2FVG A;  4UIB A;  2DEA A;  4ETJ A;  4J5S A;  1Z8L A;  2O53 A;  3RBU A;  2RB7 A;  5THW A;  4UF4 A;  5I4M A;  3B3T A;  4Z65 A;  2ACF A;  4NJQ A;  3Q71 A;  4ABK A;  4P10 A;  3EKE A;  3SIG A;  1IY7 A;  1F2O A;  3JRU A;  2L8R A;  3BI1 A;  4OC5 A;  2PJ9 A;  1PYT B;  1TKJ A;  1ZR3 A;  1XJO A;  5CBM A;  2PJ2 A;  3D67 A;  3WC6 A;  5LRG A;  1HDU A;  5K8N A;  3KZW A;  1ELL P;  4WWV A;  3K2K A;  4ESS A;  2C6G A;  3IIF A;  5LRK A;  1NJR A;  2CTC A;  2AFC A;  4OC4 A;  4ZY2 A;  5DUS A;  3SI0 A;  3KR4 A;  2EWB A;  4ETK A;  1YME A;  4G1P A;  4NGS A;  4P4I A;  5HVF A;  3WC7 A;  3BXM A;  3FX6 A;  2OOT A;  2VRI A;  4OC0 A;  4X3R A;  4FUU A;  3EJF A;  2GLF A;  3IID A;  3SJX A;  1XRY A;  3V7Z A;  3GUX A;  4DJL A;  4J5R A;  1CBX A;  1F2P A;  3B35 A;  2PJ1 A;  4P44 A;  2V8G A;  3D7D A;  4PXB A;  2AFM A;  4FBE A;  1TY8 A;  5K8P A;  4K0C A;  4F9V A;  3IEH A;  4IAV A;  3IJ3 A;  4NJR A;  3NH8 A;  1LFW A;  2ZEE A;  5LYL A;  5K8M A;  1Y0R A;  1Z5R A;  1ZG9 A;  2GLJ A;  1QQ9 A;  1CP6 A;  1BPM A;  5FSY A;  2Q51 A;  5F09 A;  1HJZ A;  4J5Q A;  3SIH A;  3MRU A;  5HVG A;  2PCU A;  5HOL A;  2V77 A;  4EME A;  5K8O A;  1DTD A;  7CPA A;  3PB6 X;  3HUV A;  4GVW A;  2C6P A;  1F57 A;  1ZLI A;  4P4F A;  4UEZ A;  3PBB A;  3Q6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...