4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
4GVVA 5AILA 1FNOA 1R43A 1QQ9A 4IHMA 4NGQA 1XRYA 2NSMA 3V38A 5K8OA 3RBUA 2CF4A 1TKJA 3SJGA 3NFZA 4F9UA 4P4EA 1CP6A 4RUHA 3FEDA 4OMEA 4P45A 4UF4A 3CT9A 1FT7A 1PYTB 2PVWA 3B3TA 2JEWA 4ZY2A 2XEGA 2AFZA 3IO1A 2HB6A 3EJGA 4R6TA 1HJZA 3IIDA 3N5FA 4MCPA 2PJ0A 2AFMA 3SIHA 2ZEFA 1Z2LA 4A39A 1UWYA 5LYDA 2G9DA 1NJRA 5K8NA 1ELLP 1TY8A 2IMOA 5ELYA 1AMPA 3KR4A 2PJ9A 4P4BA 1XFOA 1BPMA 4R7MA 3MRUA 5CBMA 3SJXA 3D66A 1Z5RA 3D7DA 5D29A 4EMEA 3SI0A 5FSUA 3IEHA 3IIBA 2ACFA 3ISZA 4MCSA 5JH9A 4NGMA 3VATA 3D7GA 1BPNA 4UMLA 3BHXA 2VRIA 3PBEA 3WT4A 4UEFA 1LAMA 4OIWA 2F7VA 2ZOGA 8CPAA 4ABKA 4X8IA 2PJBA 3CPAA 4P4JA 4TWEA 2Q51A 4MMOA 2JBJA 3BXMA 1M4LA 3HLPA 5FSVA 4PPZA 4NGSA 1PCAA 4TNUA 2JBKA 3LMSA 3SJFA 2PRQA 2AFUA 5FSZA 4MHNA 4IQYA 1JQGA 2V8GA 5K8MA 4PXDA 2LGRA 2WYRA 5D8NA 1YD9A 1YW6A 1ZG8A 2C6GA 4DJLA 2PJ5A 3K9TA 4NGPA 4EWTA 1LANA 2PJ8A 4JLLA 3NH5A 1HEEA 3KZWA 2POKA 3NH8A 3FVLA 4IAVA 3PFEA 4JGKA 2PVVA 4WWVA 3H8GA 2AFCA 3B3CA 4K0CA 2PJ3A 3DGVA 2PCUA 2OR4A 3B35A 4NGRA 4K3NA 3TC8A 3ETIA 1IGBA 4R8FA 5LYIA 4PXBA 2PJCA 3WC7A 3S9LA 3GUXA 3KI9A 3EWRA 3PB9X 2XEFA 1IY7A 1F57A 3S9MA 4MHYA 4ETJA 2V8HA 2V8VA 3JRUA 1Y7EA 2PIYA 1AYEA 1EE3P 3PB7X 2O4HA 4NGTA 3D4UA 4A38A 3HUVA 5FSYA 3FX6A 5HVFA 1YW4A 2EK8A 3FH4A 1VHOA 3WABA 1VIXA 5HIHA 3B2YA 4MRIA 4MHZA 1CP7A 2C6PA 4ABLA 1CPXA 2EEEA 1TF8A 2CIJA 2ZEDA 4A94A 2CTCA 4MHPA 5CPAA 5JM6A 2XEJA 5HOLA 3PBBA 1NSAA 5FSXA 4PXCA 3MN8A 2ZEOA 1LCPA 4OC5A 1CG2A 3LWUA 1CBXA 4GVWA 3FECA 3GQEA 2XEIA 1XJOA 5LRKA 4GM5A 1DE4C 4PQAA 3DLJA 2AFWA 2OOTA 2FG1A 3D7HA 3KASA 4OC2A 1LAPA 4FUUA 2EWBA 4OC0A 3KL9A 1SPVA 4NJQA 2ZEGA 4NFRA 1CPSA 4AXVA 2PE3A 2BFQA 2QJ8A 3VARA 2DX6A 3FEEA 4WJBA 5HVHA 1ZR3A 1Z8LA 2GLFA 1ZLIA 1ZR5A 4UEEA 4NGNA 5LYFA 3BI1A 3PFOA 4F9VA 3V2BA 4JVVA 5J1QA 3SI2A 4UIBA 3PB8X 1YMEA 3PEIA 2PIZA 1Q7LA 2ZEHA 1TKFA 3FMCA 1LFWA 4OC4A 4DUKA 3KHZA 2ANPA 4FAIA 2FAVA 3IJ3A 4EFDA 3EWPA 3NH4A 3SJEA 1BAVA 4ZYQA 2ZEEA 3K2KA 4D86A 2ABZA 2X47A 3JZTA 4OP4A 1VHUA 3VFQA 4JZ0A 3PB6X 5E3BA 1YLOA 3IC1A 2I3CA 3BI0A 4ZY1A 3GPOA 2Q43A 1ARLA 2J9AA 1H8LA 1ZG9A 4NJRA 5F09A 5JGFA 6CPAA 2XD7A 3RZAA 2PJ2A 4J5SA 5I4MA 1DTDA 3WC6A 3H8FA 1HDUA 1ZLHA 2FXKA 5HVGA 1ARMA 2NYQA 3PRTA 5LRJA 2EK9A 1QMUA 3GB0A 1GYTA 3ISXA 3GPQA 3B3VA 4UEZA 3VH9A 2GLJA 2PJAA 3KGQA 3KR5A 2RFHA 2AFOA 2AFXA 2BCOA 5CB3A 4G1PA 3H8EA 3T8WA 3L2NA 4J4ZA 1YSJA 3IIFA 5THWA 4Z65A 5IB9A 1CX8A 1OBRA 2C1CA 2VL1A 2DEAA 4TU0A 5DUSA 2BFRA 3KHXA 2C6CA 4JYWA 4IK2A 1KWMA 4X2TA 1TXRA 3D68A 2AFSA 4J5RA 3GQOA 2IJZA 4P4IA 1R3NA 1XMBA 7CPAA 3SIGA 4UIAA 1HDQA 1Y0RA 2ZELA 2IQ6A 2BOAA 4A37A 2HC9A 4OIDA 3B7IA 1VGYA 4PXEA 3I1UA 2ZEMA 3EJFA 4ZI6A 2V8DA 4H2KA 3IFEA 3CDXA 4MCRA 2PJ1A 2ZEPA 5DS0A 3RAMA 1F2OA 4YU9A 4GUAA 4O23A 4F8ZA 4ZY0A 3Q71A 1Y0YA 2ZENA 4KYBA 3SIJA 4B6ZA 4ZX9A 3D7FA 2QVPA 2QYVA 4ONWA 3EKEA 2PJ4A 4P4FA 4YWYA 3EW5A 3B3WA 4P6YA 4ZX8A 3S9NA 2V77A 3CPXA 2PJ7A 2GU2A 2O53A 4Q7AA 2Q4ZA 4FWUA 4DYOA 4W9YA 5LYLA 5HXDA 2GREA 4ESSA 4MXUA 3SI1A 3V7ZA 4J5QA 1ZG7A 2CTBA 3WC5A 4JCAA 5CMSA 1LOKA 3FJUA 4LQGA 4P44A 3KQZA 1TXZA 3KQXA 4X3RA 3IWWA 2FVGA 3EWOA 2F8HA 2PJ6A 1BLLE 4ETKA 3D67A 4P4DA 2L8RA 3FF3A 3NA6A 5CB5A 4R76A 5K8PA 1VHEA 3V45A 2ZOFA 5LRGA 4CPAA 3SIIA 3GLJA 3B3SA 4OKOA 1RTQA 4BD9A 4OC3A 3QNVA 3Q6ZA 1TKHA 4OC1A 4FBEA 4KSIA 3EWQA 3GPGA 1TF9A 2RB7A 4P10A 2BO9A 2WZNA 1ELMP 1F2PA 3TX8A 4MCQA 3PB4X 1XBUA
chains in the Genus database with same CATH superfamily
4B14A 4GVVA 2C27A 5G20A 5AILA 4I49A 1FNOA 1R43A 4M85A 2DPSA 4ONUA 1QQ9A 4IHMA 4NGQA 1CM0A 2ZXVA 3C26A 1XRYA 2NSMA 3V38A 3FYNA 4XPDC 1N71A 5K8OA 2EVNA 3RBUA 2CF4A 4UCMA 1TKJA 2FCKA 2Z3MA 3NFZA 3SJGA 3BJ7A 1M4IA 4F9UA 1XMTA 2CXAA 3FB3A 4PSWA 5GCNA 1NSLA 3TO9A 1UFHA 4KOTA 4P4EA 1CP6A 4RUHA 3DSBA 3FEDA 4OMEA 1CJWA 4P45A 4UF4A 3CT9A 2PDOA 1FT7A 1PYTB 4YGOA 3SXNA 5E96A 2PVWA 3B3TA 2JEWA 4ZY2A 2XEGA 2RNKA 3TTHA 2AFZA 3LD2A 4GXHA 4Y49C 5J8FA 2ARHA 3IO1A 2HB6A 1RXTA 3EJGA 4R6TA 1HJZA 2B4DB 4X5KA 3IIDA 3N5FA 3P2FA 2PJ0A 4MCPA 2AFMA 3SIHA 4F0XA 2ZEFA 1QSNA 1Z2LA 3PP9A 4A39A 1UWYA 5LYDA 2G9DA 1S5KA 1NJRA 1YVOA 4C2ZA 1ELLP 4F0YA 5K8NA 1TY8A 4FD5A 2IMOA 5G22A 1S60A 3G3SA 5ELYA 2B3UA 2ODFA 1AMPA 1WWZA 3CZXA 2J8NA 3KR4A 2PJ9A 3DDDA 1XF8A 4P4BA 1XFOA 1BPMA 4R7MA 1MJAA 2WPWA 5CBMA 3MRUA 3NE8A 4FD6A 4XNHC 1KUVA 2VBQA 3SJXA 3D66A 2I00A 1Z5RA 3D7DA 3FXTA 4CAVA 1M44A 4NCZA 4Q36A 4ZGYB 1XOVA 5D29A 1Y9KA 4EMEA 4QVTA 1Q2YA 1VKCA 4KOUA 3SI0A 5FSUA 3IEHA 3IIBA 2HQYA 2ACFA 3ISZA 3GY9A 4MCSA 5AG5A 2R8VA 5JH9A 2Q04A 4NGMA 3VATA 3D7GA 1Y7RA 3TFYA 4QB9A 1BPNA 2CNSA 1ON0A 4UMLA 3DNSA 3JUWA 3BHXA 2VRIA 4GS4A 2DF5A 2JLMA 1B6BA 3PBEA 1M4DA 3F0AA 3WT4A 4UEFA 1LAMA 4OIWA 2F7VA 2ZOGA 8CPAA 4ABKA 2F5IA 2QMLA 2PJBA 3CPAA 4X8IA 4CYNA 4P4JA 4TWEA 2Q51A 3KKWA 1M4GA 4KOXA 2ZW4A 4MMOA 2JBJA 3ZJ0A 3BXMA 1M4LA 3HLPA 5FSVA 1YLEA 3SXOA 4CGMA 5A28A 4XPKA 4PPZA 4R3LA 4NGSA 1PCAA 3CXPA 2JBKA 4TNUA 3F5BA 3LMSA 3SJFA 2PRQA 2Q7BA 2AFUA 4UA3A 4UFVA 5FSZA 2YGWA 4MHNA 4IQYA 4QC6A 1JQGA 1Z8TA 2WSAA 4E0AA 1GHEA 2V8GA 4LX9A 2DXQA 5K8MA 4PXDA 2LGRA 1V0CA 5D8NA 1YD9A 1YW6A 2WYRA 1ZG8A 4NF1A 1Q2DA 2C6GA 2G3AA 4M6GA 5AG7A 4II9A 1ZO0A 4DJLA 2PJ5A 4KVXA 1I1DA 2DPTA 2JDCA 3K9TA 4NGPA 5AG6A 4DNCA 1LANA 4EWTA 2PJ8A 4JLLA 3NH5A 1HEEA 3UY5A 3KZWA 2POKA 3FRMA 3FVLA 2JZDA 1PUAA 3H4QA 3NH8A 2YNDA 4IAVA 3PFEA 4JGKA 3RNZA 3TE4A 2PVVA 4WWVA 1IYLA 3H8GA 2AFCA 1JWQA 3B3CA 3GKRA 4K0CA 1YK3A 2X7BA 5EC4A 2PJ3A 1S7FA 2ZW6A 4MFKA 4AB7A 4MFQA 1QSRA 3DGVA 4CYQA 3IWGA 5H84A 2PCUA 2FS5A 4NEXA 4IUSA 2OR4A 3R9EA 5KTCA 4XPLA 2BEIA 2PR1A 2ZPAA 2QIRA 4R87A 4CGLA 3B35A 2P6GA 4NGRA 4K3NA 3TC8A 1U6MA 3ETIA 1IGBA 2H5MA 4R8FA 4PXBA 5LYIA 3TOBA 2PJCA 3WC7A 5A27A 3VWDA 4AVAA 3S9LA 4LQ6A 3GUXA 3W6SA 3KI9A 3EWRA 1XE4A 3PB9X 2XEFA 4QBJA 1IY7A 5EBVA 3OWCA 3PGPA 1F57A 3TT2A 3S9MA 4MHYA 4ETJA 2V8HA 3EFAA 2B5GA 2V8VA 3JRUA 1Y7EA 2PIYA 1AYEA 4KUBA 3GYAA 1EE3P 3PB7X 4RI1A 4R9MA 2O4HA 4MBUA 4NGTA 3D4UA 4A38A 3HUVA 1LRZA 4RN7A 4MY0A 4PV6A 5FSYA 3FX6A 5HVFA 1YW4A 3BLNA 1X12A 2EK8A 4C68A 1WK4A 2EBJA 2FSRA 3FH4A 3GIUA 3S6HA 4B11A 2BL1A 4CAWA 1MJ9A 1VHOA 3WABA 1VIXA 4EVYA 5HIHA 3B2YA 4L8AA 4MHZA 4MRIA 1CP7A 2Z3KA 2W2GA 2C6PA 4OLLA 4ABLA 4B5PA 1CPXA 2EEEA 1TF8A 2B4BA 2CIJA 2ZEDA 1IIDA 2EO8A 4KOVA 2CTCA 4XNHB 4MHPA 4A94A 5CPAA 1IYKA 2P6FA 5JM6A 1TIQA 3JVNA 1I12A 3I9SA 2XEJA 5HOLA 3PBBA 2VZZA 1NSAA 4AVBA 2CNTA 1J4JA 2AE6A 5FSXA 4PXCA 3MN8A 1Z8XA 1RO5A 2ZW7A 1S7KA 2ZEOA 1LCPA 4OC5A 2VQYA 1AUGA 1CG2A 3LWUA 5KTAA 1CBXA 3TOAA 4CGOA 4RS2A 2A4NA 2R1IA 2REEA 4GVWA 4A30A 2B58A 3FECA 4KVOE 3GQEA 1IB1E 2Q44A 1XJOA 2XEIA 4MFLA 4UWIA 5C88A 5LRKA 3IWEA 4GM5A 1DE4C 3EY5A 4PQAA 3DLJA 1L0CA 2AFWA 2OOTA 4HKFA 2FG1A 3D7HA 4OAEA 1P4NA 4K30A 1YX0A 3KASA 4OC2A 2PC1A 3DR8A 1LAPA 4FUUA 2EWBA 3EO4A 3KL9A 4OC0A 3W91A 1SPVA 1YQEA 1Z9UA 2PR8A 4NJQA 1Z4EA 2I79A 2P6EA 3TO7A 2ZEGA 4NFRA 1CPSA 2OU2A 3RYOA 4AXVA 4A33A 2PE3A 2CY2A 2BFQA 4MY3A 3R96A 5JPHA 4B12A 2QJ8A 1BOBA 3VARA 2DX6A 5F49A 1Z8WA 3I3GA 3PZJA 4KOSA 4E8OA 3FEEA 4WJBA 5HVHA 1ZR3A 2FT0A 1Z8LA 2GLFA 1ZLIA 1ZR5A 2K5TA 4MFJA 4UEEA 2BSWA 2Z3NA 3BJ8A 4NGNA 4OADA 2KQVA 4E2AA 5LYFA 3BI1A 3F8KA 4XPDB 3PFOA 4AG7A 4F6AA 2WUUA 3V2BA 3N7ZA 4F9VA 4JVVA 1KUXA 5J1QA 2JZFA 4U9YA 3CXSA 2VI7A 3SI2A 4ORFA 4UIBA 3R1KA 4AVCA 2WCTA 1SQHA 3PB8X 4UCNA 4C2XA 1YMEA 3PEIA 5IX3A 4U5YA 2PIZA 1Q7LA 2ZEHA 1TKFA 2OZGA 3FMCA 3LACA 1LFWA 1K4JA 4OC4A 5AGEA 4DUKA 4MHDA 3KHZA 2ANPA 3TCVA 2FAVA 3IJ3A 4FAIA 1YVKA 4EFDA 2IL4A 2Q7SA 3EWPA 3NH4A 4H6UA 4M3SA 3SJEA 1BAVA 3DR6A 4ZYQA 2ZEEA 3K2KA 4D86A 2ABZA 4IF5A 4YFJA 2X47A 2JEVA 3JZTA 4OP4A 1VHUA 3VFQA 2PRBA 4JWPA 4JZ0A 3PB6X 2PQ8A 5E3BA 1YLOA 2VZYA 3IU2A 3IC1A 2I3CA 3BI0A 4ZY1A 3H5ZA 2Q0YA 3D2PA 3D3SA 3CXQA 4B5PB 3GPOA 1BO4A 2Q43A 4HPSA 1ARLA 2J9AA 1H8LA 1ZG9A 1P0HA 3E0KA 5I0CA 2Y0MA 1Z4RA 4NJRA 5F09A 5JGFA 5BWAB 6CPAA 2XD7A 3QAYA 3RZAA 2PJ2A 4Y49B 4A2ZA 3IGRA 2EUIA 4J5SA 5I4MA 2D4PA 2GANA 2G3TA 1M1DA 1QSMA 5F46A 5G1ZA 3SHPA 1DTDA 1NMTA 3H8FA 3WC6A 1HDUA 1ZLHA 2YNCC 5ISVA 2FXKA 5HVGA 1ARMA 5F47A 2B3VA 2NYQA 2B5GB 3PRTA 5LRJA 2EK9A 1QMUA 2O28A 2Z3PA 3GB0A 3R9FA 1GYTA 3ISXA 1QSOA 1R57A 4JLYA 2CNMA 3EXNA 4JXRA 3GPQA 4KORA 3B3VA 3FBUA 3WR7A 4KSFA 4UEZA 5C82A 5IB0A 3VH9A 2GLJA 2PJAA 3G8WA 3KGQA 3LODA 2REFA 4BMHA 4HNYB 3KR5A 4CRZB 2J8RA 2RFHA 4HNWB 3S6KA 4UWJA 2AFOA 2AFXA 2BCOA 5CB3A 4G1PA 4BBHA 3NE7A 1IOFA 4MJ8A 3S6GA 3H8EA 2KCWA 3T8WA 4M6IA 3L2NA 4J4ZA 1YSJA 3IIFA 5F48A 5THWA 4Z65A 4PSXA 2NMTA 1CX8A 5IB9A 2P0WA 1OBRA 2C1CA 3D2MA 2VL1A 1Q2CA 4TU0A 2DEAA 5DUSA 2BFRA 3KHXA 2OZUA 4L89A 2C6CA 4JYWA 4Q38A 1VHSA 5H86A 4ZBGA 4CYPA 4IK2A 4KLWA 1KWMA 4X2TA 1IU8A 1TXRA 3QAHA 3ZZIA 1PU9A 3D68A 2AFSA 4QUSA 4J5RA 1Y9WA 4A32A 3GQOA 2IJZA 4NXYA 5IV0A 4P4IA 4JXQA 1R3NA 1XMBA 4CAEA 7CPAA 3SIGA 3FIXA 4UIAA 1FY7A 4CYOA 1HDQA 1Y0RA 1X10A 2IQ6A 2BOAA 2YNCA 2HC9A 2ZELA 2GFQA 4OIDA 4A37A 2VEZA 3B7IA 1VGYA 4PXEA 5G21A 3I1UA 4BINA 2FL4A 2ZEMA 3EJFA 4ZI6A 2V8DA 4KUAA 4H2KA 3K9UA 3IFEA 3CDXA 2JDDA 4MCRA 4FD4A 2PJ1A 2R7HA 2ZEPA 5DS0A 3RAMA 3T90A 2VXKA 4R3KA 1F2OA 4H6ZA 3IU1A 4NSQA 2RC4A 1XIXA 3MGDA 4GUAA 4O23A 4YU9A 4F8ZA 5DWNA 3R95A 5KTDA 5J8CA 2GE3A 4ZY0A 3Q71A 1Y0YA 2D4OA 4KS9A 2ZENA 4KYBA 3SIJA 1IOIA 4ZX9A 3D7FA 2QVPA 2QYVA 5EMIA 4ONWA 4B6ZA 4CGPA 3EKEA 3EC4A 2Z0ZA 4C7HA 4A95A 2PJ4A 4UFXA 4B13A 4P4FA 5JQ4A 4UBRA 4YWYA 2JZEA 3EW5A 2Z10A 2Z11A 2Z3LA 3B3WA 5AG4A 4P6YA 4ZX8A 2FIAA 4CGNA 4CAFA 3S9NA 2OZHA 2V77A 3CPXA 2PJ7A 2GU2A 2O53A 2OB0A 2AJ6A 4FD7A 1KZFA 4Q7AA 4PK2A 2Q4ZA 4FWUA 4CRYB 4W9YA 4CAXA 4DYOA 5HXDA 5LYLA 2Q4YA 1YREA 2Z3OA 2GREA 2R98A 3A9LA 4ESSA 4MXUA 3SI1A 1S7LA 3S6FA 4J5QA 3V7ZA 4H89A 2ATRA 1ZG7A 2WPXA 4PK3A 5HMNA 3FNCA 3P2HA 4MFPA 2CTBA 3WC5A 4JCAA 5CMSA 5CNPA 1LOKA 3FJUA 4KOWA 1MK4A 4JJXA 4MI4A 4UFWA 4LQGA 4YRHA 2FIWA 4KOYA 4P44A 2BUEA 5DWMA 3RO0A 3KQZA 1TXZA 4LUAA 3KQXA 4X3RA 2PSWA 4U9ZA 1QSTA 3IWWA 2FVGA 4M6HA 3EWOA 4KVME 2F8HA 2PJ6A 1BLLE 4R57A 4ETKA 2HUZA 5HH1A 4HNXB 4MFZA 4B10A 4B5OA 3D67A 4P4DA 5FVJA 2L8RA 1I21A 3FF3A 3NA6A 5CB5A 4R76A 5K8PA 1VHEA 2B4DA 3V45A 2YNEA 2ZOFA 5LRGA 4CPAA 3SIIA 4A31A 1MJBA 3GLJA 3B3SA 2J8MA 4OKOA 1RTQA 3W6XA 1B87A 1S3ZA 1YGHA 4KZTA 4BD9A 4OC3A 3QNVA 3Q6ZA 1IICA 1NE9A 1TKHA 4C2YA 4AG9A 4KLVA 4KSAA 4OC1A 3D8PA 2G0BA 2GIVA 2Q4VA 3TO6A 2QECA 4FBEA 4KSIA 1XEBA 3EWQA 3R9GA 3GPGA 3VWEA 1TF9A 3QB8A 1OZPA 2RB7A 2FXFA 4C7IA 3V8IA 4UCPA 3B8GA 1KUYA 4P10A 2BO9A 2HV2A 2ZW5A 1YR0A 2WZNA 2FE7A 1ELMP 3T9YA 1F2PA 1A2ZA 4CS0B 3TX8A 3JTKA 4JD6A 3PB4X 4MCQA 1XBUA 4J3GA 2OH1A 1S7NA
chains in the Genus database with same CATH topology
4GVVA 5AILA 1FNOA 1R43A 1QQ9A 4IHMA 4NGQA 1XRYA 2NSMA 3V38A 5K8OA 3RBUA 2CF4A 1TKJA 3SJGA 3NFZA 4F9UA 4P4EA 1CP6A 4RUHA 3FEDA 4OMEA 4P45A 4UF4A 3CT9A 1FT7A 1PYTB 2PVWA 3B3TA 2JEWA 4ZY2A 2XEGA 2AFZA 3IO1A 2HB6A 3EJGA 4R6TA 1HJZA 3IIDA 3N5FA 4MCPA 2PJ0A 2AFMA 3SIHA 2ZEFA 1Z2LA 4A39A 1UWYA 5LYDA 2G9DA 1NJRA 5K8NA 1ELLP 1TY8A 2IMOA 5ELYA 1AMPA 3KR4A 2PJ9A 4P4BA 1XFOA 1BPMA 4R7MA 3MRUA 5CBMA 3SJXA 3D66A 1Z5RA 3D7DA 5D29A 4EMEA 3SI0A 5FSUA 3IEHA 3IIBA 2ACFA 3ISZA 4MCSA 5JH9A 4NGMA 3VATA 3D7GA 1BPNA 4UMLA 3BHXA 2VRIA 3PBEA 3WT4A 4UEFA 1LAMA 4OIWA 2F7VA 2ZOGA 8CPAA 4ABKA 4X8IA 2PJBA 3CPAA 4P4JA 4TWEA 2Q51A 4MMOA 2JBJA 3BXMA 1M4LA 3HLPA 5FSVA 4PPZA 4NGSA 1PCAA 4TNUA 2JBKA 3LMSA 3SJFA 2PRQA 2AFUA 5FSZA 4MHNA 4IQYA 1JQGA 2V8GA 5K8MA 4PXDA 2LGRA 2WYRA 5D8NA 1YD9A 1YW6A 1ZG8A 2C6GA 4DJLA 2PJ5A 3K9TA 4NGPA 4EWTA 1LANA 2PJ8A 4JLLA 3NH5A 1HEEA 3KZWA 2POKA 3NH8A 3FVLA 4IAVA 3PFEA 4JGKA 2PVVA 4WWVA 3H8GA 2AFCA 3B3CA 4K0CA 2PJ3A 3DGVA 2PCUA 2OR4A 3B35A 4NGRA 4K3NA 3TC8A 3ETIA 1IGBA 4R8FA 5LYIA 4PXBA 2PJCA 3WC7A 3S9LA 3GUXA 3KI9A 3EWRA 3PB9X 2XEFA 1IY7A 1F57A 3S9MA 4MHYA 4ETJA 2V8HA 2V8VA 3JRUA 1Y7EA 2PIYA 1AYEA 1EE3P 3PB7X 2O4HA 4NGTA 3D4UA 4A38A 3HUVA 5FSYA 3FX6A 5HVFA 1YW4A 2EK8A 3FH4A 1VHOA 3WABA 1VIXA 5HIHA 3B2YA 4MRIA 4MHZA 1CP7A 2C6PA 4ABLA 1CPXA 2EEEA 1TF8A 2CIJA 2ZEDA 4A94A 2CTCA 4MHPA 5CPAA 5JM6A 2XEJA 5HOLA 3PBBA 1NSAA 5FSXA 4PXCA 3MN8A 2ZEOA 1LCPA 4OC5A 1CG2A 3LWUA 1CBXA 4GVWA 3FECA 3GQEA 2XEIA 1XJOA 5LRKA 4GM5A 1DE4C 4PQAA 3DLJA 2AFWA 2OOTA 2FG1A 3D7HA 3KASA 4OC2A 1LAPA 4FUUA 2EWBA 4OC0A 3KL9A 1SPVA 4NJQA 2ZEGA 4NFRA 1CPSA 4AXVA 2PE3A 2BFQA 2QJ8A 3VARA 2DX6A 3FEEA 4WJBA 5HVHA 1ZR3A 1Z8LA 2GLFA 1ZLIA 1ZR5A 4UEEA 4NGNA 5LYFA 3BI1A 3PFOA 4F9VA 3V2BA 4JVVA 5J1QA 3SI2A 4UIBA 3PB8X 1YMEA 3PEIA 2PIZA 1Q7LA 2ZEHA 1TKFA 3FMCA 1LFWA 4OC4A 4DUKA 3KHZA 2ANPA 4FAIA 2FAVA 3IJ3A 4EFDA 3EWPA 3NH4A 3SJEA 1BAVA 4ZYQA 2ZEEA 3K2KA 4D86A 2ABZA 2X47A 3JZTA 4OP4A 1VHUA 3VFQA 4JZ0A 3PB6X 5E3BA 1YLOA 3IC1A 2I3CA 3BI0A 4ZY1A 3GPOA 2Q43A 1ARLA 2J9AA 1H8LA 1ZG9A 4NJRA 5F09A 5JGFA 6CPAA 2XD7A 3RZAA 2PJ2A 4J5SA 5I4MA 1DTDA 3WC6A 3H8FA 1HDUA 1ZLHA 2FXKA 5HVGA 1ARMA 2NYQA 3PRTA 5LRJA 2EK9A 1QMUA 3GB0A 1GYTA 3ISXA 3GPQA 3B3VA 4UEZA 3VH9A 2GLJA 2PJAA 3KGQA 3KR5A 2RFHA 2AFOA 2AFXA 2BCOA 5CB3A 4G1PA 3H8EA 3T8WA 3L2NA 4J4ZA 1YSJA 3IIFA 5THWA 4Z65A 5IB9A 1CX8A 1OBRA 2C1CA 2VL1A 2DEAA 4TU0A 5DUSA 2BFRA 3KHXA 2C6CA 4JYWA 4IK2A 1KWMA 4X2TA 1TXRA 3D68A 2AFSA 4J5RA 3GQOA 2IJZA 4P4IA 1R3NA 1XMBA 7CPAA 3SIGA 4UIAA 1HDQA 1Y0RA 2ZELA 2IQ6A 2BOAA 4A37A 2HC9A 4OIDA 3B7IA 1VGYA 4PXEA 3I1UA 2ZEMA 3EJFA 4ZI6A 2V8DA 4H2KA 3IFEA 3CDXA 4MCRA 2PJ1A 2ZEPA 5DS0A 3RAMA 1F2OA 4YU9A 4GUAA 4O23A 4F8ZA 4ZY0A 3Q71A 1Y0YA 2ZENA 4KYBA 3SIJA 4B6ZA 4ZX9A 3D7FA 2QVPA 2QYVA 4ONWA 3EKEA 2PJ4A 4P4FA 4YWYA 3EW5A 3B3WA 4P6YA 4ZX8A 3S9NA 2V77A 3CPXA 2PJ7A 2GU2A 2O53A 4Q7AA 2Q4ZA 4FWUA 4DYOA 4W9YA 5LYLA 5HXDA 2GREA 4ESSA 4MXUA 3SI1A 3V7ZA 4J5QA 1ZG7A 2CTBA 3WC5A 4JCAA 5CMSA 1LOKA 3FJUA 4LQGA 4P44A 3KQZA 1TXZA 3KQXA 4X3RA 3IWWA 2FVGA 3EWOA 2F8HA 2PJ6A 1BLLE 4ETKA 3D67A 4P4DA 2L8RA 3FF3A 3NA6A 5CB5A 4R76A 5K8PA 1VHEA 3V45A 2ZOFA 5LRGA 4CPAA 3SIIA 3GLJA 3B3SA 4OKOA 1RTQA 4BD9A 4OC3A 3QNVA 3Q6ZA 1TKHA 4OC1A 4FBEA 4KSIA 3EWQA 3GPGA 1TF9A 2RB7A 4P10A 2BO9A 2WZNA 1ELMP 1F2PA 3TX8A 4MCQA 3PB4X 1XBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVV A;  5AIL A;  1FNO A;  1R43 A;  1QQ9 A;  4IHM A;  4NGQ A;  1XRY A;  2NSM A;  3V38 A;  5K8O A;  3RBU A;  2CF4 A;  1TKJ A;  3SJG A;  3NFZ A;  4F9U A;  4P4E A;  1CP6 A;  4RUH A;  3FED A;  4OME A;  4P45 A;  4UF4 A;  3CT9 A;  1FT7 A;  1PYT B;  2PVW A;  3B3T A;  2JEW A;  4ZY2 A;  2XEG A;  2AFZ A;  3IO1 A;  2HB6 A;  3EJG A;  4R6T A;  1HJZ A;  3IID A;  3N5F A;  4MCP A;  2PJ0 A;  2AFM A;  3SIH A;  2ZEF A;  1Z2L A;  4A39 A;  1UWY A;  5LYD A;  2G9D A;  1NJR A;  5K8N A;  1ELL P;  1TY8 A;  2IMO A;  5ELY A;  1AMP A;  3KR4 A;  2PJ9 A;  4P4B A;  1XFO A;  1BPM A;  4R7M A;  3MRU A;  5CBM A;  3SJX A;  3D66 A;  1Z5R A;  3D7D A;  5D29 A;  4EME A;  3SI0 A;  5FSU A;  3IEH A;  3IIB A;  2ACF A;  3ISZ A;  4MCS A;  5JH9 A;  4NGM A;  3VAT A;  3D7G A;  1BPN A;  4UML A;  3BHX A;  2VRI A;  3PBE A;  3WT4 A;  4UEF A;  1LAM A;  4OIW A;  2F7V A;  2ZOG A;  8CPA A;  4ABK A;  4X8I A;  2PJB A;  3CPA A;  4P4J A;  4TWE A;  2Q51 A;  4MMO A;  2JBJ A;  3BXM A;  1M4L A;  3HLP A;  5FSV A;  4PPZ A;  4NGS A;  1PCA A;  4TNU A;  2JBK A;  3LMS A;  3SJF A;  2PRQ A;  2AFU A;  5FSZ A;  4MHN A;  4IQY A;  1JQG A;  2V8G A;  5K8M A;  4PXD A;  2LGR A;  2WYR A;  5D8N A;  1YD9 A;  1YW6 A;  1ZG8 A;  2C6G A;  4DJL A;  2PJ5 A;  3K9T A;  4NGP A;  4EWT A;  1LAN A;  2PJ8 A;  4JLL A;  3NH5 A;  1HEE A;  3KZW A;  2POK A;  3NH8 A;  3FVL A;  4IAV A;  3PFE A;  4JGK A;  2PVV A;  4WWV A;  3H8G A;  2AFC A;  3B3C A;  4K0C A;  2PJ3 A;  3DGV A;  2PCU A;  2OR4 A;  3B35 A;  4NGR A;  4K3N A;  3TC8 A;  3ETI A;  1IGB A;  4R8F A;  5LYI A;  4PXB A;  2PJC A;  3WC7 A;  3S9L A;  3GUX A;  3KI9 A;  3EWR A;  3PB9 X;  2XEF A;  1IY7 A;  1F57 A;  3S9M A;  4MHY A;  4ETJ A;  2V8H A;  2V8V A;  3JRU A;  1Y7E A;  2PIY A;  1AYE A;  1EE3 P;  3PB7 X;  2O4H A;  4NGT A;  3D4U A;  4A38 A;  3HUV A;  5FSY A;  3FX6 A;  5HVF A;  1YW4 A;  2EK8 A;  3FH4 A;  1VHO A;  3WAB A;  1VIX A;  5HIH A;  3B2Y A;  4MRI A;  4MHZ A;  1CP7 A;  2C6P A;  4ABL A;  1CPX A;  2EEE A;  1TF8 A;  2CIJ A;  2ZED A;  4A94 A;  2CTC A;  4MHP A;  5CPA A;  5JM6 A;  2XEJ A;  5HOL A;  3PBB A;  1NSA A;  5FSX A;  4PXC A;  3MN8 A;  2ZEO A;  1LCP A;  4OC5 A;  1CG2 A;  3LWU A;  1CBX A;  4GVW A;  3FEC A;  3GQE A;  2XEI A;  1XJO A;  5LRK A;  4GM5 A;  1DE4 C;  4PQA A;  3DLJ A;  2AFW A;  2OOT A;  2FG1 A;  3D7H A;  3KAS A;  4OC2 A;  1LAP A;  4FUU A;  2EWB A;  4OC0 A;  3KL9 A;  1SPV A;  4NJQ A;  2ZEG A;  4NFR A;  1CPS A;  4AXV A;  2PE3 A;  2BFQ A;  2QJ8 A;  3VAR A;  2DX6 A;  3FEE A;  4WJB A;  5HVH A;  1ZR3 A;  1Z8L A;  2GLF A;  1ZLI A;  1ZR5 A;  4UEE A;  4NGN A;  5LYF A;  3BI1 A;  3PFO A;  4F9V A;  3V2B A;  4JVV A;  5J1Q A;  3SI2 A;  4UIB A;  3PB8 X;  1YME A;  3PEI A;  2PIZ A;  1Q7L A;  2ZEH A;  1TKF A;  3FMC A;  1LFW A;  4OC4 A;  4DUK A;  3KHZ A;  2ANP A;  4FAI A;  2FAV A;  3IJ3 A;  4EFD A;  3EWP A;  3NH4 A;  3SJE A;  1BAV A;  4ZYQ A;  2ZEE A;  3K2K A;  4D86 A;  2ABZ A;  2X47 A;  3JZT A;  4OP4 A;  1VHU A;  3VFQ A;  4JZ0 A;  3PB6 X;  5E3B A;  1YLO A;  3IC1 A;  2I3C A;  3BI0 A;  4ZY1 A;  3GPO A;  2Q43 A;  1ARL A;  2J9A A;  1H8L A;  1ZG9 A;  4NJR A;  5F09 A;  5JGF A;  6CPA A;  2XD7 A;  3RZA A;  2PJ2 A;  4J5S A;  5I4M A;  1DTD A;  3WC6 A;  3H8F A;  1HDU A;  1ZLH A;  2FXK A;  5HVG A;  1ARM A;  2NYQ A;  3PRT A;  5LRJ A;  2EK9 A;  1QMU A;  3GB0 A;  1GYT A;  3ISX A;  3GPQ A;  3B3V A;  4UEZ A;  3VH9 A;  2GLJ A;  2PJA A;  3KGQ A;  3KR5 A;  2RFH A;  2AFO A;  2AFX A;  2BCO A;  5CB3 A;  4G1P A;  3H8E A;  3T8W A;  3L2N A;  4J4Z A;  1YSJ A;  3IIF A;  5THW A;  4Z65 A;  5IB9 A;  1CX8 A;  1OBR A;  2C1C A;  2VL1 A;  2DEA A;  4TU0 A;  5DUS A;  2BFR A;  3KHX A;  2C6C A;  4JYW A;  4IK2 A;  1KWM A;  4X2T A;  1TXR A;  3D68 A;  2AFS A;  4J5R A;  3GQO A;  2IJZ A;  4P4I A;  1R3N A;  1XMB A;  7CPA A;  3SIG A;  4UIA A;  1HDQ A;  1Y0R A;  2ZEL A;  2IQ6 A;  2BOA A;  4A37 A;  2HC9 A;  4OID A;  3B7I A;  1VGY A;  4PXE A;  3I1U A;  2ZEM A;  3EJF A;  4ZI6 A;  2V8D A;  4H2K A;  3IFE A;  3CDX A;  4MCR A;  2PJ1 A;  2ZEP A;  5DS0 A;  3RAM A;  1F2O A;  4YU9 A;  4GUA A;  4O23 A;  4F8Z A;  4ZY0 A;  3Q71 A;  1Y0Y A;  2ZEN A;  4KYB A;  3SIJ A;  4B6Z A;  4ZX9 A;  3D7F A;  2QVP A;  2QYV A;  4ONW A;  3EKE A;  2PJ4 A;  4P4F A;  4YWY A;  3EW5 A;  3B3W A;  4P6Y A;  4ZX8 A;  3S9N A;  2V77 A;  3CPX A;  2PJ7 A;  2GU2 A;  2O53 A;  4Q7A A;  2Q4Z A;  4FWU A;  4DYO A;  4W9Y A;  5LYL A;  5HXD A;  2GRE A;  4ESS A;  4MXU A;  3SI1 A;  3V7Z A;  4J5Q A;  1ZG7 A;  2CTB A;  3WC5 A;  4JCA A;  5CMS A;  1LOK A;  3FJU A;  4LQG A;  4P44 A;  3KQZ A;  1TXZ A;  3KQX A;  4X3R A;  3IWW A;  2FVG A;  3EWO A;  2F8H A;  2PJ6 A;  1BLL E;  4ETK A;  3D67 A;  4P4D A;  2L8R A;  3FF3 A;  3NA6 A;  5CB5 A;  4R76 A;  5K8P A;  1VHE A;  3V45 A;  2ZOF A;  5LRG A;  4CPA A;  3SII A;  3GLJ A;  3B3S A;  4OKO A;  1RTQ A;  4BD9 A;  4OC3 A;  3QNV A;  3Q6Z A;  1TKH A;  4OC1 A;  4FBE A;  4KSI A;  3EWQ A;  3GPG A;  1TF9 A;  2RB7 A;  4P10 A;  2BO9 A;  2WZN A;  1ELM P;  1F2P A;  3TX8 A;  4MCQ A;  3PB4 X;  1XBU A; 
#chains in the Genus database with same CATH topology
 4B14 A;  4GVV A;  2C27 A;  5G20 A;  5AIL A;  4I49 A;  1FNO A;  1R43 A;  4M85 A;  2DPS A;  4ONU A;  1QQ9 A;  4IHM A;  4NGQ A;  1CM0 A;  2ZXV A;  3C26 A;  1XRY A;  2NSM A;  3V38 A;  3FYN A;  4XPD C;  1N71 A;  5K8O A;  2EVN A;  3RBU A;  2CF4 A;  4UCM A;  1TKJ A;  2FCK A;  2Z3M A;  3NFZ A;  3SJG A;  3BJ7 A;  1M4I A;  4F9U A;  1XMT A;  2CXA A;  3FB3 A;  4PSW A;  5GCN A;  1NSL A;  3TO9 A;  1UFH A;  4KOT A;  4P4E A;  1CP6 A;  4RUH A;  3DSB A;  3FED A;  4OME A;  1CJW A;  4P45 A;  4UF4 A;  3CT9 A;  2PDO A;  1FT7 A;  1PYT B;  4YGO A;  3SXN A;  5E96 A;  2PVW A;  3B3T A;  2JEW A;  4ZY2 A;  2XEG A;  2RNK A;  3TTH A;  2AFZ A;  3LD2 A;  4GXH A;  4Y49 C;  5J8F A;  2ARH A;  3IO1 A;  2HB6 A;  1RXT A;  3EJG A;  4R6T A;  1HJZ A;  2B4D B;  4X5K A;  3IID A;  3N5F A;  3P2F A;  2PJ0 A;  4MCP A;  2AFM A;  3SIH A;  4F0X A;  2ZEF A;  1QSN A;  1Z2L A;  3PP9 A;  4A39 A;  1UWY A;  5LYD A;  2G9D A;  1S5K A;  1NJR A;  1YVO A;  4C2Z A;  1ELL P;  4F0Y A;  5K8N A;  1TY8 A;  4FD5 A;  2IMO A;  5G22 A;  1S60 A;  3G3S A;  5ELY A;  2B3U A;  2ODF A;  1AMP A;  1WWZ A;  3CZX A;  2J8N A;  3KR4 A;  2PJ9 A;  3DDD A;  1XF8 A;  4P4B A;  1XFO A;  1BPM A;  4R7M A;  1MJA A;  2WPW A;  5CBM A;  3MRU A;  3NE8 A;  4FD6 A;  4XNH C;  1KUV A;  2VBQ A;  3SJX A;  3D66 A;  2I00 A;  1Z5R A;  3D7D A;  3FXT A;  4CAV A;  1M44 A;  4NCZ A;  4Q36 A;  4ZGY B;  1XOV A;  5D29 A;  1Y9K A;  4EME A;  4QVT A;  1Q2Y A;  1VKC A;  4KOU A;  3SI0 A;  5FSU A;  3IEH A;  3IIB A;  2HQY A;  2ACF A;  3ISZ A;  3GY9 A;  4MCS A;  5AG5 A;  2R8V A;  5JH9 A;  2Q04 A;  4NGM A;  3VAT A;  3D7G A;  1Y7R A;  3TFY A;  4QB9 A;  1BPN A;  2CNS A;  1ON0 A;  4UML A;  3DNS A;  3JUW A;  3BHX A;  2VRI A;  4GS4 A;  2DF5 A;  2JLM A;  1B6B A;  3PBE A;  1M4D A;  3F0A A;  3WT4 A;  4UEF A;  1LAM A;  4OIW A;  2F7V A;  2ZOG A;  8CPA A;  4ABK A;  2F5I A;  2QML A;  2PJB A;  3CPA A;  4X8I A;  4CYN A;  4P4J A;  4TWE A;  2Q51 A;  3KKW A;  1M4G A;  4KOX A;  2ZW4 A;  4MMO A;  2JBJ A;  3ZJ0 A;  3BXM A;  1M4L A;  3HLP A;  5FSV A;  1YLE A;  3SXO A;  4CGM A;  5A28 A;  4XPK A;  4PPZ A;  4R3L A;  4NGS A;  1PCA A;  3CXP A;  2JBK A;  4TNU A;  3F5B A;  3LMS A;  3SJF A;  2PRQ A;  2Q7B A;  2AFU A;  4UA3 A;  4UFV A;  5FSZ A;  2YGW A;  4MHN A;  4IQY A;  4QC6 A;  1JQG A;  1Z8T A;  2WSA A;  4E0A A;  1GHE A;  2V8G A;  4LX9 A;  2DXQ A;  5K8M A;  4PXD A;  2LGR A;  1V0C A;  5D8N A;  1YD9 A;  1YW6 A;  2WYR A;  1ZG8 A;  4NF1 A;  1Q2D A;  2C6G A;  2G3A A;  4M6G A;  5AG7 A;  4II9 A;  1ZO0 A;  4DJL A;  2PJ5 A;  4KVX A;  1I1D A;  2DPT A;  2JDC A;  3K9T A;  4NGP A;  5AG6 A;  4DNC A;  1LAN A;  4EWT A;  2PJ8 A;  4JLL A;  3NH5 A;  1HEE A;  3UY5 A;  3KZW A;  2POK A;  3FRM A;  3FVL A;  2JZD A;  1PUA A;  3H4Q A;  3NH8 A;  2YND A;  4IAV A;  3PFE A;  4JGK A;  3RNZ A;  3TE4 A;  2PVV A;  4WWV A;  1IYL A;  3H8G A;  2AFC A;  1JWQ A;  3B3C A;  3GKR A;  4K0C A;  1YK3 A;  2X7B A;  5EC4 A;  2PJ3 A;  1S7F A;  2ZW6 A;  4MFK A;  4AB7 A;  4MFQ A;  1QSR A;  3DGV A;  4CYQ A;  3IWG A;  5H84 A;  2PCU A;  2FS5 A;  4NEX A;  4IUS A;  2OR4 A;  3R9E A;  5KTC A;  4XPL A;  2BEI A;  2PR1 A;  2ZPA A;  2QIR A;  4R87 A;  4CGL A;  3B35 A;  2P6G A;  4NGR A;  4K3N A;  3TC8 A;  1U6M A;  3ETI A;  1IGB A;  2H5M A;  4R8F A;  4PXB A;  5LYI A;  3TOB A;  2PJC A;  3WC7 A;  5A27 A;  3VWD A;  4AVA A;  3S9L A;  4LQ6 A;  3GUX A;  3W6S A;  3KI9 A;  3EWR A;  1XE4 A;  3PB9 X;  2XEF A;  4QBJ A;  1IY7 A;  5EBV A;  3OWC A;  3PGP A;  1F57 A;  3TT2 A;  3S9M A;  4MHY A;  4ETJ A;  2V8H A;  3EFA A;  2B5G A;  2V8V A;  3JRU A;  1Y7E A;  2PIY A;  1AYE A;  4KUB A;  3GYA A;  1EE3 P;  3PB7 X;  4RI1 A;  4R9M A;  2O4H A;  4MBU A;  4NGT A;  3D4U A;  4A38 A;  3HUV A;  1LRZ A;  4RN7 A;  4MY0 A;  4PV6 A;  5FSY A;  3FX6 A;  5HVF A;  1YW4 A;  3BLN A;  1X12 A;  2EK8 A;  4C68 A;  1WK4 A;  2EBJ A;  2FSR A;  3FH4 A;  3GIU A;  3S6H A;  4B11 A;  2BL1 A;  4CAW A;  1MJ9 A;  1VHO A;  3WAB A;  1VIX A;  4EVY A;  5HIH A;  3B2Y A;  4L8A A;  4MHZ A;  4MRI A;  1CP7 A;  2Z3K A;  2W2G A;  2C6P A;  4OLL A;  4ABL A;  4B5P A;  1CPX A;  2EEE A;  1TF8 A;  2B4B A;  2CIJ A;  2ZED A;  1IID A;  2EO8 A;  4KOV A;  2CTC A;  4XNH B;  4MHP A;  4A94 A;  5CPA A;  1IYK A;  2P6F A;  5JM6 A;  1TIQ A;  3JVN A;  1I12 A;  3I9S A;  2XEJ A;  5HOL A;  3PBB A;  2VZZ A;  1NSA A;  4AVB A;  2CNT A;  1J4J A;  2AE6 A;  5FSX A;  4PXC A;  3MN8 A;  1Z8X A;  1RO5 A;  2ZW7 A;  1S7K A;  2ZEO A;  1LCP A;  4OC5 A;  2VQY A;  1AUG A;  1CG2 A;  3LWU A;  5KTA A;  1CBX A;  3TOA A;  4CGO A;  4RS2 A;  2A4N A;  2R1I A;  2REE A;  4GVW A;  4A30 A;  2B58 A;  3FEC A;  4KVO E;  3GQE A;  1IB1 E;  2Q44 A;  1XJO A;  2XEI A;  4MFL A;  4UWI A;  5C88 A;  5LRK A;  3IWE A;  4GM5 A;  1DE4 C;  3EY5 A;  4PQA A;  3DLJ A;  1L0C A;  2AFW A;  2OOT A;  4HKF A;  2FG1 A;  3D7H A;  4OAE A;  1P4N A;  4K30 A;  1YX0 A;  3KAS A;  4OC2 A;  2PC1 A;  3DR8 A;  1LAP A;  4FUU A;  2EWB A;  3EO4 A;  3KL9 A;  4OC0 A;  3W91 A;  1SPV A;  1YQE A;  1Z9U A;  2PR8 A;  4NJQ A;  1Z4E A;  2I79 A;  2P6E A;  3TO7 A;  2ZEG A;  4NFR A;  1CPS A;  2OU2 A;  3RYO A;  4AXV A;  4A33 A;  2PE3 A;  2CY2 A;  2BFQ A;  4MY3 A;  3R96 A;  5JPH A;  4B12 A;  2QJ8 A;  1BOB A;  3VAR A;  2DX6 A;  5F49 A;  1Z8W A;  3I3G A;  3PZJ A;  4KOS A;  4E8O A;  3FEE A;  4WJB A;  5HVH A;  1ZR3 A;  2FT0 A;  1Z8L A;  2GLF A;  1ZLI A;  1ZR5 A;  2K5T A;  4MFJ A;  4UEE A;  2BSW A;  2Z3N A;  3BJ8 A;  4NGN A;  4OAD A;  2KQV A;  4E2A A;  5LYF A;  3BI1 A;  3F8K A;  4XPD B;  3PFO A;  4AG7 A;  4F6A A;  2WUU A;  3V2B A;  3N7Z A;  4F9V A;  4JVV A;  1KUX A;  5J1Q A;  2JZF A;  4U9Y A;  3CXS A;  2VI7 A;  3SI2 A;  4ORF A;  4UIB A;  3R1K A;  4AVC A;  2WCT A;  1SQH A;  3PB8 X;  4UCN A;  4C2X A;  1YME A;  3PEI A;  5IX3 A;  4U5Y A;  2PIZ A;  1Q7L A;  2ZEH A;  1TKF A;  2OZG A;  3FMC A;  3LAC A;  1LFW A;  1K4J A;  4OC4 A;  5AGE A;  4DUK A;  4MHD A;  3KHZ A;  2ANP A;  3TCV A;  2FAV A;  3IJ3 A;  4FAI A;  1YVK A;  4EFD A;  2IL4 A;  2Q7S A;  3EWP A;  3NH4 A;  4H6U A;  4M3S A;  3SJE A;  1BAV A;  3DR6 A;  4ZYQ A;  2ZEE A;  3K2K A;  4D86 A;  2ABZ A;  4IF5 A;  4YFJ A;  2X47 A;  2JEV A;  3JZT A;  4OP4 A;  1VHU A;  3VFQ A;  2PRB A;  4JWP A;  4JZ0 A;  3PB6 X;  2PQ8 A;  5E3B A;  1YLO A;  2VZY A;  3IU2 A;  3IC1 A;  2I3C A;  3BI0 A;  4ZY1 A;  3H5Z A;  2Q0Y A;  3D2P A;  3D3S A;  3CXQ A;  4B5P B;  3GPO A;  1BO4 A;  2Q43 A;  4HPS A;  1ARL A;  2J9A A;  1H8L A;  1ZG9 A;  1P0H A;  3E0K A;  5I0C A;  2Y0M A;  1Z4R A;  4NJR A;  5F09 A;  5JGF A;  5BWA B;  6CPA A;  2XD7 A;  3QAY A;  3RZA A;  2PJ2 A;  4Y49 B;  4A2Z A;  3IGR A;  2EUI A;  4J5S A;  5I4M A;  2D4P A;  2GAN A;  2G3T A;  1M1D A;  1QSM A;  5F46 A;  5G1Z A;  3SHP A;  1DTD A;  1NMT A;  3H8F A;  3WC6 A;  1HDU A;  1ZLH A;  2YNC C;  5ISV A;  2FXK A;  5HVG A;  1ARM A;  5F47 A;  2B3V A;  2NYQ A;  2B5G B;  3PRT A;  5LRJ A;  2EK9 A;  1QMU A;  2O28 A;  2Z3P A;  3GB0 A;  3R9F A;  1GYT A;  3ISX A;  1QSO A;  1R57 A;  4JLY A;  2CNM A;  3EXN A;  4JXR A;  3GPQ A;  4KOR A;  3B3V A;  3FBU A;  3WR7 A;  4KSF A;  4UEZ A;  5C82 A;  5IB0 A;  3VH9 A;  2GLJ A;  2PJA A;  3G8W A;  3KGQ A;  3LOD A;  2REF A;  4BMH A;  4HNY B;  3KR5 A;  4CRZ B;  2J8R A;  2RFH A;  4HNW B;  3S6K A;  4UWJ A;  2AFO A;  2AFX A;  2BCO A;  5CB3 A;  4G1P A;  4BBH A;  3NE7 A;  1IOF A;  4MJ8 A;  3S6G A;  3H8E A;  2KCW A;  3T8W A;  4M6I A;  3L2N A;  4J4Z A;  1YSJ A;  3IIF A;  5F48 A;  5THW A;  4Z65 A;  4PSX A;  2NMT A;  1CX8 A;  5IB9 A;  2P0W A;  1OBR A;  2C1C A;  3D2M A;  2VL1 A;  1Q2C A;  4TU0 A;  2DEA A;  5DUS A;  2BFR A;  3KHX A;  2OZU A;  4L89 A;  2C6C A;  4JYW A;  4Q38 A;  1VHS A;  5H86 A;  4ZBG A;  4CYP A;  4IK2 A;  4KLW A;  1KWM A;  4X2T A;  1IU8 A;  1TXR A;  3QAH A;  3ZZI A;  1PU9 A;  3D68 A;  2AFS A;  4QUS A;  4J5R A;  1Y9W A;  4A32 A;  3GQO A;  2IJZ A;  4NXY A;  5IV0 A;  4P4I A;  4JXQ A;  1R3N A;  1XMB A;  4CAE A;  7CPA A;  3SIG A;  3FIX A;  4UIA A;  1FY7 A;  4CYO A;  1HDQ A;  1Y0R A;  1X10 A;  2IQ6 A;  2BOA A;  2YNC A;  2HC9 A;  2ZEL A;  2GFQ A;  4OID A;  4A37 A;  2VEZ A;  3B7I A;  1VGY A;  4PXE A;  5G21 A;  3I1U A;  4BIN A;  2FL4 A;  2ZEM A;  3EJF A;  4ZI6 A;  2V8D A;  4KUA A;  4H2K A;  3K9U A;  3IFE A;  3CDX A;  2JDD A;  4MCR A;  4FD4 A;  2PJ1 A;  2R7H A;  2ZEP A;  5DS0 A;  3RAM A;  3T90 A;  2VXK A;  4R3K A;  1F2O A;  4H6Z A;  3IU1 A;  4NSQ A;  2RC4 A;  1XIX A;  3MGD A;  4GUA A;  4O23 A;  4YU9 A;  4F8Z A;  5DWN A;  3R95 A;  5KTD A;  5J8C A;  2GE3 A;  4ZY0 A;  3Q71 A;  1Y0Y A;  2D4O A;  4KS9 A;  2ZEN A;  4KYB A;  3SIJ A;  1IOI A;  4ZX9 A;  3D7F A;  2QVP A;  2QYV A;  5EMI A;  4ONW A;  4B6Z A;  4CGP A;  3EKE A;  3EC4 A;  2Z0Z A;  4C7H A;  4A95 A;  2PJ4 A;  4UFX A;  4B13 A;  4P4F A;  5JQ4 A;  4UBR A;  4YWY A;  2JZE A;  3EW5 A;  2Z10 A;  2Z11 A;  2Z3L A;  3B3W A;  5AG4 A;  4P6Y A;  4ZX8 A;  2FIA A;  4CGN A;  4CAF A;  3S9N A;  2OZH A;  2V77 A;  3CPX A;  2PJ7 A;  2GU2 A;  2O53 A;  2OB0 A;  2AJ6 A;  4FD7 A;  1KZF A;  4Q7A A;  4PK2 A;  2Q4Z A;  4FWU A;  4CRY B;  4W9Y A;  4CAX A;  4DYO A;  5HXD A;  5LYL A;  2Q4Y A;  1YRE A;  2Z3O A;  2GRE A;  2R98 A;  3A9L A;  4ESS A;  4MXU A;  3SI1 A;  1S7L A;  3S6F A;  4J5Q A;  3V7Z A;  4H89 A;  2ATR A;  1ZG7 A;  2WPX A;  4PK3 A;  5HMN A;  3FNC A;  3P2H A;  4MFP A;  2CTB A;  3WC5 A;  4JCA A;  5CMS A;  5CNP A;  1LOK A;  3FJU A;  4KOW A;  1MK4 A;  4JJX A;  4MI4 A;  4UFW A;  4LQG A;  4YRH A;  2FIW A;  4KOY A;  4P44 A;  2BUE A;  5DWM A;  3RO0 A;  3KQZ A;  1TXZ A;  4LUA A;  3KQX A;  4X3R A;  2PSW A;  4U9Z A;  1QST A;  3IWW A;  2FVG A;  4M6H A;  3EWO A;  4KVM E;  2F8H A;  2PJ6 A;  1BLL E;  4R57 A;  4ETK A;  2HUZ A;  5HH1 A;  4HNX B;  4MFZ A;  4B10 A;  4B5O A;  3D67 A;  4P4D A;  5FVJ A;  2L8R A;  1I21 A;  3FF3 A;  3NA6 A;  5CB5 A;  4R76 A;  5K8P A;  1VHE A;  2B4D A;  3V45 A;  2YNE A;  2ZOF A;  5LRG A;  4CPA A;  3SII A;  4A31 A;  1MJB A;  3GLJ A;  3B3S A;  2J8M A;  4OKO A;  1RTQ A;  3W6X A;  1B87 A;  1S3Z A;  1YGH A;  4KZT A;  4BD9 A;  4OC3 A;  3QNV A;  3Q6Z A;  1IIC A;  1NE9 A;  1TKH A;  4C2Y A;  4AG9 A;  4KLV A;  4KSA A;  4OC1 A;  3D8P A;  2G0B A;  2GIV A;  2Q4V A;  3TO6 A;  2QEC A;  4FBE A;  4KSI A;  1XEB A;  3EWQ A;  3R9G A;  3GPG A;  3VWE A;  1TF9 A;  3QB8 A;  1OZP A;  2RB7 A;  2FXF A;  4C7I A;  3V8I A;  4UCP A;  3B8G A;  1KUY A;  4P10 A;  2BO9 A;  2HV2 A;  2ZW5 A;  1YR0 A;  2WZN A;  2FE7 A;  1ELM P;  3T9Y A;  1F2P A;  1A2Z A;  4CS0 B;  3TX8 A;  3JTK A;  4JD6 A;  3PB4 X;  4MCQ A;  1XBU A;  4J3G A;  2OH1 A;  1S7N A; 
#chains in the Genus database with same CATH homology
 4GVV A;  5AIL A;  1FNO A;  1R43 A;  1QQ9 A;  4IHM A;  4NGQ A;  1XRY A;  2NSM A;  3V38 A;  5K8O A;  3RBU A;  2CF4 A;  1TKJ A;  3SJG A;  3NFZ A;  4F9U A;  4P4E A;  1CP6 A;  4RUH A;  3FED A;  4OME A;  4P45 A;  4UF4 A;  3CT9 A;  1FT7 A;  1PYT B;  2PVW A;  3B3T A;  2JEW A;  4ZY2 A;  2XEG A;  2AFZ A;  3IO1 A;  2HB6 A;  3EJG A;  4R6T A;  1HJZ A;  3IID A;  3N5F A;  4MCP A;  2PJ0 A;  2AFM A;  3SIH A;  2ZEF A;  1Z2L A;  4A39 A;  1UWY A;  5LYD A;  2G9D A;  1NJR A;  5K8N A;  1ELL P;  1TY8 A;  2IMO A;  5ELY A;  1AMP A;  3KR4 A;  2PJ9 A;  4P4B A;  1XFO A;  1BPM A;  4R7M A;  3MRU A;  5CBM A;  3SJX A;  3D66 A;  1Z5R A;  3D7D A;  5D29 A;  4EME A;  3SI0 A;  5FSU A;  3IEH A;  3IIB A;  2ACF A;  3ISZ A;  4MCS A;  5JH9 A;  4NGM A;  3VAT A;  3D7G A;  1BPN A;  4UML A;  3BHX A;  2VRI A;  3PBE A;  3WT4 A;  4UEF A;  1LAM A;  4OIW A;  2F7V A;  2ZOG A;  8CPA A;  4ABK A;  4X8I A;  2PJB A;  3CPA A;  4P4J A;  4TWE A;  2Q51 A;  4MMO A;  2JBJ A;  3BXM A;  1M4L A;  3HLP A;  5FSV A;  4PPZ A;  4NGS A;  1PCA A;  4TNU A;  2JBK A;  3LMS A;  3SJF A;  2PRQ A;  2AFU A;  5FSZ A;  4MHN A;  4IQY A;  1JQG A;  2V8G A;  5K8M A;  4PXD A;  2LGR A;  2WYR A;  5D8N A;  1YD9 A;  1YW6 A;  1ZG8 A;  2C6G A;  4DJL A;  2PJ5 A;  3K9T A;  4NGP A;  4EWT A;  1LAN A;  2PJ8 A;  4JLL A;  3NH5 A;  1HEE A;  3KZW A;  2POK A;  3NH8 A;  3FVL A;  4IAV A;  3PFE A;  4JGK A;  2PVV A;  4WWV A;  3H8G A;  2AFC A;  3B3C A;  4K0C A;  2PJ3 A;  3DGV A;  2PCU A;  2OR4 A;  3B35 A;  4NGR A;  4K3N A;  3TC8 A;  3ETI A;  1IGB A;  4R8F A;  5LYI A;  4PXB A;  2PJC A;  3WC7 A;  3S9L A;  3GUX A;  3KI9 A;  3EWR A;  3PB9 X;  2XEF A;  1IY7 A;  1F57 A;  3S9M A;  4MHY A;  4ETJ A;  2V8H A;  2V8V A;  3JRU A;  1Y7E A;  2PIY A;  1AYE A;  1EE3 P;  3PB7 X;  2O4H A;  4NGT A;  3D4U A;  4A38 A;  3HUV A;  5FSY A;  3FX6 A;  5HVF A;  1YW4 A;  2EK8 A;  3FH4 A;  1VHO A;  3WAB A;  1VIX A;  5HIH A;  3B2Y A;  4MRI A;  4MHZ A;  1CP7 A;  2C6P A;  4ABL A;  1CPX A;  2EEE A;  1TF8 A;  2CIJ A;  2ZED A;  4A94 A;  2CTC A;  4MHP A;  5CPA A;  5JM6 A;  2XEJ A;  5HOL A;  3PBB A;  1NSA A;  5FSX A;  4PXC A;  3MN8 A;  2ZEO A;  1LCP A;  4OC5 A;  1CG2 A;  3LWU A;  1CBX A;  4GVW A;  3FEC A;  3GQE A;  2XEI A;  1XJO A;  5LRK A;  4GM5 A;  1DE4 C;  4PQA A;  3DLJ A;  2AFW A;  2OOT A;  2FG1 A;  3D7H A;  3KAS A;  4OC2 A;  1LAP A;  4FUU A;  2EWB A;  4OC0 A;  3KL9 A;  1SPV A;  4NJQ A;  2ZEG A;  4NFR A;  1CPS A;  4AXV A;  2PE3 A;  2BFQ A;  2QJ8 A;  3VAR A;  2DX6 A;  3FEE A;  4WJB A;  5HVH A;  1ZR3 A;  1Z8L A;  2GLF A;  1ZLI A;  1ZR5 A;  4UEE A;  4NGN A;  5LYF A;  3BI1 A;  3PFO A;  4F9V A;  3V2B A;  4JVV A;  5J1Q A;  3SI2 A;  4UIB A;  3PB8 X;  1YME A;  3PEI A;  2PIZ A;  1Q7L A;  2ZEH A;  1TKF A;  3FMC A;  1LFW A;  4OC4 A;  4DUK A;  3KHZ A;  2ANP A;  4FAI A;  2FAV A;  3IJ3 A;  4EFD A;  3EWP A;  3NH4 A;  3SJE A;  1BAV A;  4ZYQ A;  2ZEE A;  3K2K A;  4D86 A;  2ABZ A;  2X47 A;  3JZT A;  4OP4 A;  1VHU A;  3VFQ A;  4JZ0 A;  3PB6 X;  5E3B A;  1YLO A;  3IC1 A;  2I3C A;  3BI0 A;  4ZY1 A;  3GPO A;  2Q43 A;  1ARL A;  2J9A A;  1H8L A;  1ZG9 A;  4NJR A;  5F09 A;  5JGF A;  6CPA A;  2XD7 A;  3RZA A;  2PJ2 A;  4J5S A;  5I4M A;  1DTD A;  3WC6 A;  3H8F A;  1HDU A;  1ZLH A;  2FXK A;  5HVG A;  1ARM A;  2NYQ A;  3PRT A;  5LRJ A;  2EK9 A;  1QMU A;  3GB0 A;  1GYT A;  3ISX A;  3GPQ A;  3B3V A;  4UEZ A;  3VH9 A;  2GLJ A;  2PJA A;  3KGQ A;  3KR5 A;  2RFH A;  2AFO A;  2AFX A;  2BCO A;  5CB3 A;  4G1P A;  3H8E A;  3T8W A;  3L2N A;  4J4Z A;  1YSJ A;  3IIF A;  5THW A;  4Z65 A;  5IB9 A;  1CX8 A;  1OBR A;  2C1C A;  2VL1 A;  2DEA A;  4TU0 A;  5DUS A;  2BFR A;  3KHX A;  2C6C A;  4JYW A;  4IK2 A;  1KWM A;  4X2T A;  1TXR A;  3D68 A;  2AFS A;  4J5R A;  3GQO A;  2IJZ A;  4P4I A;  1R3N A;  1XMB A;  7CPA A;  3SIG A;  4UIA A;  1HDQ A;  1Y0R A;  2ZEL A;  2IQ6 A;  2BOA A;  4A37 A;  2HC9 A;  4OID A;  3B7I A;  1VGY A;  4PXE A;  3I1U A;  2ZEM A;  3EJF A;  4ZI6 A;  2V8D A;  4H2K A;  3IFE A;  3CDX A;  4MCR A;  2PJ1 A;  2ZEP A;  5DS0 A;  3RAM A;  1F2O A;  4YU9 A;  4GUA A;  4O23 A;  4F8Z A;  4ZY0 A;  3Q71 A;  1Y0Y A;  2ZEN A;  4KYB A;  3SIJ A;  4B6Z A;  4ZX9 A;  3D7F A;  2QVP A;  2QYV A;  4ONW A;  3EKE A;  2PJ4 A;  4P4F A;  4YWY A;  3EW5 A;  3B3W A;  4P6Y A;  4ZX8 A;  3S9N A;  2V77 A;  3CPX A;  2PJ7 A;  2GU2 A;  2O53 A;  4Q7A A;  2Q4Z A;  4FWU A;  4DYO A;  4W9Y A;  5LYL A;  5HXD A;  2GRE A;  4ESS A;  4MXU A;  3SI1 A;  3V7Z A;  4J5Q A;  1ZG7 A;  2CTB A;  3WC5 A;  4JCA A;  5CMS A;  1LOK A;  3FJU A;  4LQG A;  4P44 A;  3KQZ A;  1TXZ A;  3KQX A;  4X3R A;  3IWW A;  2FVG A;  3EWO A;  2F8H A;  2PJ6 A;  1BLL E;  4ETK A;  3D67 A;  4P4D A;  2L8R A;  3FF3 A;  3NA6 A;  5CB5 A;  4R76 A;  5K8P A;  1VHE A;  3V45 A;  2ZOF A;  5LRG A;  4CPA A;  3SII A;  3GLJ A;  3B3S A;  4OKO A;  1RTQ A;  4BD9 A;  4OC3 A;  3QNV A;  3Q6Z A;  1TKH A;  4OC1 A;  4FBE A;  4KSI A;  3EWQ A;  3GPG A;  1TF9 A;  2RB7 A;  4P10 A;  2BO9 A;  2WZN A;  1ELM P;  1F2P A;  3TX8 A;  4MCQ A;  3PB4 X;  1XBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...