4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
4ZI6A 2FXKA 4KYBA 5LRKA 4RUHA 3BI1A 3KL9A 1PCAA 2Q51A 3IIBA 1TXZA 4UEEA 5K8OA 1TKHA 4MCPA 2X47A 4MHNA 3KR4A 4JVVA 2FG1A 4MCSA 1ZLHA 2IQ6A 1YW4A 3PFOA 4YU9A 2ZEGA 4NGRA 1UWYA 5LYDA 2BFQA 4J5SA 1HDQA 4MHYA 2PJCA 3CPXA 2PJ3A 3SIGA 3SI0A 2XEIA 1HDUA 4OC3A 3FMCA 7CPAA 4P4BA 2V8GA 4OP4A 1YLOA 3Q6ZA 2PJ2A 1YSJA 2V8HA 2AFZA 3FEDA 4LQGA 1CX8A 4R7MA 5LYIA 1Y0RA 3ETIA 2FAVA 2EK9A 4R6TA 4NGSA 1Y7EA 4P4FA 4MMOA 2PJ0A 5D8NA 4ZYQA 4A39A 1XBUA 4GM5A 2VRIA 3EWRA 1R3NA 4KSIA 2WZNA 1Q7LA 5FSYA 4P4EA 2PE3A 3CDXA 5FSVA 2ZOFA 1TF8A 3VARA 3EWPA 4EFDA 2NSMA 2PJ8A 4PXBA 3L2NA 3B3SA 4B6ZA 1CP7A 3WABA 2ZEDA 5CBMA 1LANA 4MRIA 4IQYA 2PJ6A 3FX6A 4JYWA 1BAVA 3ISXA 3BI0A 4MCQA 4R8FA 3LMSA 2ABZA 2XEJA 4ZX8A 3LWUA 4P4IA 4IAVA 1ARMA 3D7GA 4TNUA 4A37A 3DLJA 1ARLA 4K0CA 2RFHA 4J5RA 4P10A 3FEEA 1F57A 3SIIA 2JEWA 4K3NA 1QMUA 3TC8A 2C6CA 3JZTA 3PFEA 1LAMA 2ZOGA 2AFUA 3EJGA 1Y0YA 2LGRA 4JLLA 2OOTA 1TXRA 1ZR5A 3B2YA 4ETKA 4P4DA 2IMOA 3GQEA 4ZY2A 4FUUA 2FVGA 4GVWA 2GU2A 3D7DA 3GLJA 3PBEA 5LRGA 4ABKA 4NJQA 4P45A 3SJFA 2F7VA 1VHOA 4X2TA 2V8DA 3MN8A 1AYEA 5DUSA 2QJ8A 4MHZA 5LYLA 2EK8A 3NH8A 1YW6A 2ZEEA 4F9UA 3KQXA 1Z5RA 5DS0A 2XEFA 8CPAA 1BPNA 3H8EA 4J5QA 1ELMP 3MRUA 4GUAA 5HVHA 2C6GA 3FH4A 1TY8A 1HEEA 4OKOA 3D7FA 3WC6A 2BCOA 2G9DA 1TF9A 4WJBA 1IY7A 4FBEA 3PEIA 5K8NA 1VGYA 2CTCA 3SJGA 3GUXA 3FJUA 2PCUA 4FAIA 4EMEA 1FNOA 2PIZA 3D4UA 4R76A 1JQGA 4NGQA 3B35A 1CBXA 5THWA 5CB3A 4OIDA 4ETJA 2PJ1A 3IIFA 3V45A 3SI1A 3T8WA 3SJXA 2VL1A 4TWEA 4UIAA 2AFOA 5F09A 3CT9A 2GLJA 2NYQA 1CPXA 4UEZA 3EJFA 2ZEPA 5FSZA 1YD9A 1Z8LA 3PB8X 1HJZA 5JM6A 5D29A 4DUKA 4G1PA 2JBJA 3TX8A 4NJRA 2J9AA 2Q43A 2XEGA 3H8GA 1ZG7A 1F2OA 2QYVA 1NSAA 2PJ7A 2GLFA 2CTBA 5HIHA 1RTQA 4NGMA 4CPAA 1VIXA 5LYFA 2POKA 3S9NA 4H2KA 4J4ZA 4DYOA 5HVGA 3IIDA 4A94A 3PB9X 4PPZA 2AFCA 2C1CA 2JBKA 4MHPA 3B3CA 3D7HA 5FSUA 4BD9A 2CIJA 3D68A 5CPAA 3K2KA 5K8PA 2PJAA 2ZELA 3NA6A 1ZLIA 2ZEOA 4AXVA 1CP6A 2OR4A 1GYTA 5ELYA 3Q71A 1SPVA 4ZY0A 2BFRA 5K8MA 4JCAA 5HOLA 4EWTA 2HB6A 4NGPA 2AFMA 3S9LA 1YMEA 3RAMA 5HVFA 4MXUA 6CPAA 2IJZA 3V38A 3IEHA 3V7ZA 3WC5A 1LAPA 3EW5A 3SIHA 3KHZA 4OC0A 1TKJA 3S9MA 1R43A 1ZR3A 2I3CA 4Q7AA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4F8ZA 4NGTA 1EE3P 1OBRA 1DE4C 1LFWA 4TU0A 1M4LA 4PQAA 3SIJA 2GREA 4NFRA 3KQZA 1QQ9A 3IC1A 2EEEA 4OC1A 1H8LA 2ACFA 3FF3A 4MCRA 2EWBA 3KI9A 3PB4X 4PXCA 5LRJA 2WYRA 2ANPA 2ZENA 5AILA 3GPGA 4P4JA 1AMPA 2BOAA 2PVVA 4W9YA 1VHUA 1TKFA 4WWVA 2AFXA 3VFQA 3HLPA 4F9VA 3CPAA 3V2BA 3RBUA 1BLLE 3IJ3A 4OC4A 5J1QA 4UF4A 5HXDA 3FECA 3KZWA 4ZX9A 4ABLA 2F8HA 3HUVA 4ZY1A 1IGBA 5I4MA 3B3TA 3SJEA 2V77A 3PRTA 3GB0A 2XD7A 4OMEA 2DEAA 1XRYA 3PB7X 4ESSA 1XJOA 2O4HA 5JH9A 3KR5A 3DGVA 4PXDA 4JZ0A 1Z2LA 5E3BA 4OIWA 3EWOA 3IFEA 2PJ9A 4O23A 3NH5A 3ISZA 1ELLP 1BPMA 4FWUA 1PYTB 3KGQA 4OC5A 4DJLA 3GPOA 3EWQA 1LOKA 3I1UA 4NGNA 4P44A 5CB5A 3GPQA 2ZEHA 4ONWA 4X3RA 4JGKA 3GQOA 2ZEMA 3VH9A 1XFOA 2AFWA 1CPSA 4UEFA 2PIYA 3D66A 5CMSA 4YWYA 3RZAA 3BHXA 2O53A 3WC7A 3KASA 4A38A 1XMBA 4GVVA 4IHMA 4PXEA 2PRQA 3JRUA 3FVLA 2PJBA 3IO1A 3VATA 1LCPA 2QVPA 3EKEA 3NH4A 2Q4ZA 3IWWA 3BXMA 3PB6X 3K9TA 3D67A 4UIBA 3NFZA 4D86A 1NJRA 3KHXA 2C6PA 4UMLA 2DX6A 5FSXA 4OC2A 3WT4A 3QNVA 5IB9A 3SI2A 1KWMA 4X8IA 1FT7A 3B7IA 4IK2A 2PJ5A 2RB7A 1ZG9A 2PJ4A 1CG2A 2PVWA 4P6YA 3H8FA 1ZG8A 4Z65A 3B3VA 1VHEA 3B3WA 2BO9A 2V8VA 1F2PA 2HC9A 2L8RA 2CF4A
chains in the Genus database with same CATH superfamily
4ZI6A 2J8MA 3S6FA 2FXKA 4KYBA 5LRKA 4RUHA 3BI1A 2Q44A 4QUSA 2Y0MA 3KL9A 1PCAA 3IWGA 5AG4A 2Q51A 2KQVA 3IIBA 1TXZA 1QSNA 4UEEA 1TKHA 4MCPA 3FB3A 5K8OA 1QSTA 2BSWA 2X47A 1GHEA 4MHNA 3KR4A 4JVVA 2FG1A 4MCSA 3EC4A 1ZLHA 2JEVA 5KTAA 2IQ6A 2B5GA 1YW4A 3W91A 3PFOA 4UWJA 2CNMA 3GYAA 4YU9A 2ZEGA 4NGRA 4CAEA 3QAHA 1XOVA 2FCKA 1UWYA 2FXFA 2Z3KA 2BFQA 3D3SA 3IGRA 5LYDA 4KORA 4J5SA 1HDQA 5EC4A 5FVJA 4MHYA 2PJCA 4A30A 3CPXA 2PJ3A 3SIGA 4KUBA 3SI0A 2XEIA 3FBUA 1Z8TA 2OZGA 3BJ8A 1HDUA 4DNCA 4OC3A 1S7FA 2R7HA 3FMCA 7CPAA 2Q4YA 4P4BA 2V8GA 4M6GA 4OP4A 1YLOA 4LX9A 3Q6ZA 2GE3A 2PJ2A 4UFWA 1RO5A 1YSJA 2V8HA 2AFZA 5AG7A 4CAVA 2J8NA 3FEDA 5J8CA 4LQGA 1CX8A 1Z8XA 4HNXB 4R7MA 5LYIA 4HKFA 4JLYA 1Y0RA 5F47A 3ETIA 2FAVA 1K4JA 2EK9A 4R6TA 4NGSA 4PSWA 1Y7EA 1KUXA 4P4FA 1Z9UA 2IL4A 4MMOA 4B13A 2PJ0A 5D8NA 1Z4EA 3JVNA 4ZYQA 2FE7A 5AG6A 3NE8A 1Q2YA 4A39A 1XBUA 2GFQA 2VZYA 4GM5A 4QVTA 4PSXA 1NE9A 2VRIA 3EWRA 1R3NA 4KSIA 2WZNA 1Q7LA 5FSYA 4OAEA 4BMHA 4P4EA 3TOBA 2PE3A 3CDXA 5FSVA 2ATRA 3ZZIA 1X10A 2ZOFA 1TF8A 1UFHA 2Q4VA 3VARA 2D4OA 3EWPA 3JTKA 4UFXA 4EFDA 2NSMA 2PJ8A 1YVOA 4KLVA 3L2NA 4PXBA 5AG5A 1U6MA 3B3SA 5BWAB 4B6ZA 4CGNA 3S6HA 1CP7A 4KVXA 3WABA 2ZEDA 4XNHC 3IU1A 1IB1E 4MFZA 1KZFA 1QSRA 5CBMA 1LANA 4MRIA 4CS0B 2WPWA 4IQYA 2PJ6A 2AJ6A 3FX6A 4JYWA 1BAVA 1CJWA 1V0CA 3ISXA 3BI0A 2G3AA 4R3KA 4MCQA 4R8FA 5C88A 2OZUA 3LMSA 2ABZA 2REFA 4ZX8A 2XEJA 3LWUA 4P4IA 4IAVA 3SXNA 1ARMA 2OU2A 3D7GA 4TNUA 1XMTA 3CZXA 4A37A 3DLJA 3LODA 1ARLA 2J8RA 3I9SA 3IU2A 4II9A 4K0CA 2RFHA 5IV0A 4J5RA 4P10A 3FEEA 3TOAA 1F57A 4Y49B 2DXQA 3SIIA 3I3GA 2JEWA 4K3NA 3DSBA 1QMUA 4H6UA 3TC8A 2B3UA 4JXQA 2C6CA 3JZTA 2Q0YA 2YNCA 5F46A 4ZGYB 2FSRA 2GIVA 1LAMA 3PFEA 2ZOGA 2AFUA 2WUUA 3EJGA 1CM0A 2LGRA 1WK4A 1Y0YA 2PQ8A 2VBQA 4JLLA 3W6SA 2OOTA 1TXRA 1ZR5A 1P0HA 2R98A 3R95A 3B2YA 4ETKA 4P4DA 4A33A 2IMOA 3GQEA 4ZY2A 4KZTA 4FUUA 1TIQA 4UCPA 2FVGA 4GVWA 2GU2A 3D7DA 3GLJA 2FL4A 1M1DA 3PBEA 4U5YA 5F48A 4ABKA 5LRGA 4NJQA 4B5OA 3G3SA 4P45A 3SJFA 2F7VA 2B4DB 4KOVA 2F5IA 2JDCA 3R9EA 4C2YA 1VHOA 1XIXA 4MHDA 3SHPA 4X2TA 2V8DA 3EXNA 3MN8A 3RYOA 1AYEA 5DUSA 3R9GA 2QJ8A 4OLLA 1VKCA 4MHZA 3MGDA 5LYLA 1Y9WA 1MJ9A 1YQEA 2EK8A 2P0WA 3NH8A 1YW6A 2ZEEA 4UWIA 4F9UA 3KQXA 1Z5RA 2R8VA 5DS0A 4CGLA 5IB0A 2JZEA 2XEFA 2P6GA 8CPAA 1BPNA 3H8EA 4J5QA 1J4JA 1ELMP 3MRUA 4GUAA 3TO7A 5HVHA 2C6GA 4AB7A 2DPTA 4MFKA 3FH4A 2PR8A 4AVCA 1TY8A 3H5ZA 1HEEA 1QSMA 2JLMA 4OKOA 3TFYA 3D7FA 1XE4A 5G1ZA 2BCOA 2YNEA 3QAYA 2G9DA 3WC6A 2ZXVA 1TF9A 2H5MA 3F8KA 1MJAA 1IY7A 4H6ZA 4WJBA 4CGPA 3PEIA 4FBEA 4QB9A 5K8NA 1VGYA 4M3SA 2CTCA 1S7KA 4YRHA 3SJGA 2D4PA 2X7BA 3GUXA 3FJUA 3TCVA 5JQ4A 2PCUA 4K30A 2G0BA 1S3ZA 4FAIA 4I49A 3FIXA 4EMEA 2EVNA 4B5PA 1FNOA 2Z3NA 2PIZA 4R76A 1JQGA 3D4UA 4NGQA 3B35A 2BUEA 4IF5A 2Z3LA 2RC4A 1CBXA 3C26A 5THWA 4PV6A 5CB3A 4OIDA 4CYPA 2WSAA 4C2ZA 4ETJA 2PJ1A 3IIFA 3V45A 3SI1A 2VZZA 3R96A 4OADA 3T8WA 3EFAA 2VL1A 4MFPA 4TWEA 5G21A 3SJXA 4BINA 4AG7A 4UIAA 2AFOA 5F09A 3CT9A 1XEBA 2GLJA 1CPXA 2NYQA 4NF1A 2RNKA 4KLWA 4R57A 4UEZA 5J8FA 2ZW4A 3EJFA 1S7LA 2ZEPA 3F0AA 5FSZA 3LACA 1S7NA 1YD9A 4RS2A 3H4QA 1Z4RA 1Z8LA 3PB8X 1HJZA 1Q2CA 2CXAA 2ZW5A 5JM6A 2JDDA 4R87A 5D29A 4DUKA 4G1PA 2JBJA 1S60A 3BLNA 3QB8A 3TX8A 4CAWA 4KOWA 5I0CA 2EBJA 2PSWA 4NJRA 4J3GA 2J9AA 2Q43A 1WWZA 2WCTA 2B58A 2KCWA 3H8GA 1NMTA 1ZG7A 2DF5A 2XEGA 4JXRA 4MFLA 4R3LA 4QBJA 2FT0A 1F2OA 2QYVA 3B8GA 4C7HA 1NSAA 2PJ7A 2GLFA 2CTBA 2K5TA 5HIHA 1YK3A 1RTQA 2B4DA 3A9LA 2HUZA 4NGMA 4YGOA 2AE6A 4CPAA 3FYNA 1VIXA 2CNTA 5LYFA 2POKA 2PRBA 3IWEA 4CRZB 4KVOE 4HPSA 3S9NA 2A4NA 4H2KA 4J4ZA 3SXOA 1I1DA 4CGOA 4DYOA 4EVYA 5HVGA 3IIDA 4KOUA 3UY5A 4A94A 3PB9X 4PPZA 2AFCA 3D8PA 4BBHA 2C1CA 1YGHA 2JBKA 4MHPA 3VWEA 3B3CA 3D7HA 5FSUA 2PDOA 2CIJA 3D68A 4BD9A 5CPAA 3K2KA 2Z11A 4CAXA 5K8PA 2QIRA 2PJAA 2VQYA 2ZELA 3NA6A 1ZLIA 2ZEOA 4L8AA 2Q7BA 1CP6A 1N71A 2OR4A 1GYTA 2ZW7A 3DR6A 5ELYA 3Q71A 4CYQA 1SPVA 2C27A 4ZY0A 2BFRA 1M4DA 5K8MA 4JCAA 5HOLA 4A2ZA 4EWTA 5ISVA 3G8WA 2HB6A 4NGPA 4AVBA 2AFMA 3S9LA 1YMEA 3RAMA 5HVFA 4MXUA 4LUAA 4U9ZA 6CPAA 2IJZA 2I00A 3IEHA 3V38A 3V7ZA 1PUAA 5EMIA 4GS4A 3OWCA 3T9YA 1LAPA 3TTHA 3WC5A 3EW5A 2HQYA 3SIHA 3WR7A 2JZFA 4FD6A 4A95A 4E8OA 1PU9A 2DPSA 3KHZA 2FIWA 4CGMA 1I12A 2YNCC 5A28A 1XF8A 4KS9A 2I79A 1TKJA 4H89A 4OC0A 3S6GA 4JWPA 3S9MA 4E2AA 1R43A 1ZR3A 2I3CA 4PK2A 4Q7AA 4UBRA 3N7ZA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4B14A 4NGTA 4F8ZA 3D2PA 3NE7A 1EE3P 1MK4A 4XPDC 1OBRA 5A27A 1DE4C 1LFWA 4CYNA 4TU0A 1M4LA 1YREA 4PQAA 4AG9A 1KUVA 4A32A 3SIJA 4F6AA 4F0YA 2GREA 4NFRA 3KQZA 5C82A 1RXTA 1QQ9A 3CXQA 1ON0A 3IC1A 2EEEA 1S5KA 4OC1A 1KUYA 1H8LA 3FNCA 4KOTA 3DR8A 1IYLA 2ACFA 3BJ7A 3FF3A 5JPHA 4MCRA 3W6XA 3RO0A 4MY0A 4UA3A 4C7IA 2EWBA 3KI9A 3PB4X 4MBUA 2PC1A 4NXYA 4PXCA 5LRJA 3D2MA 2WYRA 2ANPA 3VWDA 2ZENA 4M6HA 5AILA 3GPGA 4P4JA 2B4BA 4AVAA 1AMPA 4LQ6A 2EUIA 2R1IA 2BOAA 5KTDA 2HV2A 4UFVA 2O28A 2PVVA 4W9YA 1VHUA 1TKFA 3GY9A 4WWVA 4FD7A 2AFXA 3VFQA 2REEA 4JD6A 4NSQA 4QC6A 3HLPA 4F9VA 3CPAA 2QECA 5E96A 3V2BA 4U9YA 3RBUA 1BLLE 3IJ3A 4OC4A 5J1QA 1VHSA 4B10A 1YLEA 2VI7A 2Q7SA 4UF4A 1JWQA 5HXDA 3FECA 3KZWA 4RI1A 4ZX9A 2B3VA 1B6BA 1QSOA 3CXSA 4NEXA 1M4GA 4ABLA 3PZJA 2F8HA 1I21A 2GANA 3HUVA 4ZY1A 2ZW6A 1IGBA 3P2FA 4RN7A 4XPDB 5CNPA 5I4MA 3B3TA 3SJEA 2V77A 4MFJA 2W2GA 3PRTA 4Y49C 4X5KA 3V8IA 2XD7A 3GB0A 2QMLA 4M6IA 4OMEA 2VXKA 4FD5A 5AGEA 4C2XA 5HMNA 3JUWA 3TO6A 3TT2A 2DEAA 1XRYA 2NMTA 1IYKA 3CXPA 3PB7X 4NCZA 4KOYA 4ESSA 1XJOA 2O4HA 2FIAA 3KR5A 4UCMA 5JH9A 2YNDA 3DGVA 3DDDA 4PXDA 4JZ0A 4IUSA 3S6KA 2Q04A 3LD2A 1Z2LA 5E3BA 4OIWA 4MI4A 3EWOA 1P4NA 5HH1A 3IFEA 2PJ9A 5KTCA 4PK3A 4KSAA 4F0XA 4O23A 1X12A 2BEIA 1M44A 3NH5A 3ISZA 3RNZA 1ELLP 2JZDA 1BPMA 4ORFA 4FWUA 2YGWA 1PYTB 4CYOA 4C68A 1Y9KA 3PGPA 4L89A 3KGQA 4OC5A 4XNHB 5DWMA 1A2ZA 4DJLA 2ARHA 3EY5A 5G22A 3GPOA 3TE4A 5DWNA 3EWQA 1IIDA 1LOKA 3I1UA 3PP9A 4NGNA 4P44A 5CB5A 3FXTA 3GPQA 2ZEHA 2Z3PA 4ONWA 4X3RA 3R9FA 4JGKA 4GXHA 3GQOA 2ODFA 2ZEMA 3VH9A 4HNYB 4M85A 1XFOA 1AUGA 2AFWA 2Z10A 2Z3MA 2PR1A 4CRYB 1Q2DA 4KOXA 4HNWB 4Q38A 5IX3A 3DNSA 4YFJA 1CPSA 4UEFA 1BO4A 2PIYA 3D66A 5CMSA 1IOFA 1BOBA 4YWYA 3RZAA 1L0CA 3BHXA 2O53A 4MJ8A 3WC7A 4B12A 3KASA 4A38A 1XMBA 2Z3OA 4KUAA 5EBVA 4ONUA 2WPXA 4GVVA 3GKRA 4IHMA 3TO9A 2EO8A 1ZO0A 4PXEA 4AXVA 4A31A 2PRQA 3JRUA 3FVLA 2PJBA 3IO1A 5G20A 3VATA 1LCPA 3FRMA 1YX0A 4CAFA 2QVPA 3EKEA 3NH4A 1Y7RA 2Q4ZA 1IOIA 3IWWA 1FY7A 3BXMA 3PB6X 1LRZA 3K9TA 3D67A 3R1KA 4MFQA 4UIBA 3NFZA 4D86A 3K9UA 1NJRA 3F5BA 3KHXA 4B11A 2C6PA 4B5PB 4UMLA 3EO4A 2DX6A 2B5GB 5FSXA 5GCNA 4KSFA 4OC2A 3WT4A 3QNVA 4UCNA 2OZHA 1YVKA 5IB9A 5H86A 3SI2A 3KKWA 4MY3A 1B87A 1KWMA 3T90A 4X8IA 2P6EA 1FT7A 3B7IA 2BL1A 4IK2A 4Q36A 1M4IA 1IU8A 1MJBA 2G3TA 2PJ5A 3P2HA 2RB7A 1ZG9A 2PJ4A 1CG2A 2CNSA 2VEZA 2PVWA 4P6YA 4FD4A 1SQHA 4KVME 5F49A 2OB0A 2P6FA 3H8FA 1ZG8A 1OZPA 1R57A 4KOSA 4Z65A 3B3VA 1VHEA 4JJXA 2CY2A 1YR0A 3B3WA 3GIUA 2OH1A 5H84A 2BO9A 2V8VA 4E0AA 4R9MA 4XPLA 4ZBGA 2FS5A 3ZJ0A 1F2PA 1IICA 1NSLA 2HC9A 2ZPAA 1Z8WA 3E0KA 4XPKA 2L8RA 2CF4A 2Z0ZA
chains in the Genus database with same CATH topology
4ZI6A 2FXKA 4KYBA 5LRKA 4RUHA 3BI1A 3KL9A 1PCAA 2Q51A 3IIBA 1TXZA 4UEEA 5K8OA 1TKHA 4MCPA 2X47A 4MHNA 3KR4A 4JVVA 2FG1A 4MCSA 1ZLHA 2IQ6A 1YW4A 3PFOA 4YU9A 2ZEGA 4NGRA 1UWYA 5LYDA 2BFQA 4J5SA 1HDQA 4MHYA 2PJCA 3CPXA 2PJ3A 3SIGA 3SI0A 2XEIA 1HDUA 4OC3A 3FMCA 7CPAA 4P4BA 2V8GA 4OP4A 1YLOA 3Q6ZA 2PJ2A 1YSJA 2V8HA 2AFZA 3FEDA 4LQGA 1CX8A 4R7MA 5LYIA 1Y0RA 3ETIA 2FAVA 2EK9A 4R6TA 4NGSA 1Y7EA 4P4FA 4MMOA 2PJ0A 5D8NA 4ZYQA 4A39A 1XBUA 4GM5A 2VRIA 3EWRA 1R3NA 4KSIA 2WZNA 1Q7LA 5FSYA 4P4EA 2PE3A 3CDXA 5FSVA 2ZOFA 1TF8A 3VARA 3EWPA 4EFDA 2NSMA 2PJ8A 4PXBA 3L2NA 3B3SA 4B6ZA 1CP7A 3WABA 2ZEDA 5CBMA 1LANA 4MRIA 4IQYA 2PJ6A 3FX6A 4JYWA 1BAVA 3ISXA 3BI0A 4MCQA 4R8FA 3LMSA 2ABZA 2XEJA 4ZX8A 3LWUA 4P4IA 4IAVA 1ARMA 3D7GA 4TNUA 4A37A 3DLJA 1ARLA 4K0CA 2RFHA 4J5RA 4P10A 3FEEA 1F57A 3SIIA 2JEWA 4K3NA 1QMUA 3TC8A 2C6CA 3JZTA 3PFEA 1LAMA 2ZOGA 2AFUA 3EJGA 1Y0YA 2LGRA 4JLLA 2OOTA 1TXRA 1ZR5A 3B2YA 4ETKA 4P4DA 2IMOA 3GQEA 4ZY2A 4FUUA 2FVGA 4GVWA 2GU2A 3D7DA 3GLJA 3PBEA 5LRGA 4ABKA 4NJQA 4P45A 3SJFA 2F7VA 1VHOA 4X2TA 2V8DA 3MN8A 1AYEA 5DUSA 2QJ8A 4MHZA 5LYLA 2EK8A 3NH8A 1YW6A 2ZEEA 4F9UA 3KQXA 1Z5RA 5DS0A 2XEFA 8CPAA 1BPNA 3H8EA 4J5QA 1ELMP 3MRUA 4GUAA 5HVHA 2C6GA 3FH4A 1TY8A 1HEEA 4OKOA 3D7FA 3WC6A 2BCOA 2G9DA 1TF9A 4WJBA 1IY7A 4FBEA 3PEIA 5K8NA 1VGYA 2CTCA 3SJGA 3GUXA 3FJUA 2PCUA 4FAIA 4EMEA 1FNOA 2PIZA 3D4UA 4R76A 1JQGA 4NGQA 3B35A 1CBXA 5THWA 5CB3A 4OIDA 4ETJA 2PJ1A 3IIFA 3V45A 3SI1A 3T8WA 3SJXA 2VL1A 4TWEA 4UIAA 2AFOA 5F09A 3CT9A 2GLJA 2NYQA 1CPXA 4UEZA 3EJFA 2ZEPA 5FSZA 1YD9A 1Z8LA 3PB8X 1HJZA 5JM6A 5D29A 4DUKA 4G1PA 2JBJA 3TX8A 4NJRA 2J9AA 2Q43A 2XEGA 3H8GA 1ZG7A 1F2OA 2QYVA 1NSAA 2PJ7A 2GLFA 2CTBA 5HIHA 1RTQA 4NGMA 4CPAA 1VIXA 5LYFA 2POKA 3S9NA 4H2KA 4J4ZA 4DYOA 5HVGA 3IIDA 4A94A 3PB9X 4PPZA 2AFCA 2C1CA 2JBKA 4MHPA 3B3CA 3D7HA 5FSUA 4BD9A 2CIJA 3D68A 5CPAA 3K2KA 5K8PA 2PJAA 2ZELA 3NA6A 1ZLIA 2ZEOA 4AXVA 1CP6A 2OR4A 1GYTA 5ELYA 3Q71A 1SPVA 4ZY0A 2BFRA 5K8MA 4JCAA 5HOLA 4EWTA 2HB6A 4NGPA 2AFMA 3S9LA 1YMEA 3RAMA 5HVFA 4MXUA 6CPAA 2IJZA 3V38A 3IEHA 3V7ZA 3WC5A 1LAPA 3EW5A 3SIHA 3KHZA 4OC0A 1TKJA 3S9MA 1R43A 1ZR3A 2I3CA 4Q7AA 2AFSA 3N5FA 1DTDA 5JGFA 2ZEFA 3PBBA 4F8ZA 4NGTA 1EE3P 1OBRA 1DE4C 1LFWA 4TU0A 1M4LA 4PQAA 3SIJA 2GREA 4NFRA 3KQZA 1QQ9A 3IC1A 2EEEA 4OC1A 1H8LA 2ACFA 3FF3A 4MCRA 2EWBA 3KI9A 3PB4X 4PXCA 5LRJA 2WYRA 2ANPA 2ZENA 5AILA 3GPGA 4P4JA 1AMPA 2BOAA 2PVVA 4W9YA 1VHUA 1TKFA 4WWVA 2AFXA 3VFQA 3HLPA 4F9VA 3CPAA 3V2BA 3RBUA 1BLLE 3IJ3A 4OC4A 5J1QA 4UF4A 5HXDA 3FECA 3KZWA 4ZX9A 4ABLA 2F8HA 3HUVA 4ZY1A 1IGBA 5I4MA 3B3TA 3SJEA 2V77A 3PRTA 3GB0A 2XD7A 4OMEA 2DEAA 1XRYA 3PB7X 4ESSA 1XJOA 2O4HA 5JH9A 3KR5A 3DGVA 4PXDA 4JZ0A 1Z2LA 5E3BA 4OIWA 3EWOA 3IFEA 2PJ9A 4O23A 3NH5A 3ISZA 1ELLP 1BPMA 4FWUA 1PYTB 3KGQA 4OC5A 4DJLA 3GPOA 3EWQA 1LOKA 3I1UA 4NGNA 4P44A 5CB5A 3GPQA 2ZEHA 4ONWA 4X3RA 4JGKA 3GQOA 2ZEMA 3VH9A 1XFOA 2AFWA 1CPSA 4UEFA 2PIYA 3D66A 5CMSA 4YWYA 3RZAA 3BHXA 2O53A 3WC7A 3KASA 4A38A 1XMBA 4GVVA 4IHMA 4PXEA 2PRQA 3JRUA 3FVLA 2PJBA 3IO1A 3VATA 1LCPA 2QVPA 3EKEA 3NH4A 2Q4ZA 3IWWA 3BXMA 3PB6X 3K9TA 3D67A 4UIBA 3NFZA 4D86A 1NJRA 3KHXA 2C6PA 4UMLA 2DX6A 5FSXA 4OC2A 3WT4A 3QNVA 5IB9A 3SI2A 1KWMA 4X8IA 1FT7A 3B7IA 4IK2A 2PJ5A 2RB7A 1ZG9A 2PJ4A 1CG2A 2PVWA 4P6YA 3H8FA 1ZG8A 4Z65A 3B3VA 1VHEA 3B3WA 2BO9A 2V8VA 1F2PA 2HC9A 2L8RA 2CF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZI6 A;  2FXK A;  4KYB A;  5LRK A;  4RUH A;  3BI1 A;  3KL9 A;  1PCA A;  2Q51 A;  3IIB A;  1TXZ A;  4UEE A;  5K8O A;  1TKH A;  4MCP A;  2X47 A;  4MHN A;  3KR4 A;  4JVV A;  2FG1 A;  4MCS A;  1ZLH A;  2IQ6 A;  1YW4 A;  3PFO A;  4YU9 A;  2ZEG A;  4NGR A;  1UWY A;  5LYD A;  2BFQ A;  4J5S A;  1HDQ A;  4MHY A;  2PJC A;  3CPX A;  2PJ3 A;  3SIG A;  3SI0 A;  2XEI A;  1HDU A;  4OC3 A;  3FMC A;  7CPA A;  4P4B A;  2V8G A;  4OP4 A;  1YLO A;  3Q6Z A;  2PJ2 A;  1YSJ A;  2V8H A;  2AFZ A;  3FED A;  4LQG A;  1CX8 A;  4R7M A;  5LYI A;  1Y0R A;  3ETI A;  2FAV A;  2EK9 A;  4R6T A;  4NGS A;  1Y7E A;  4P4F A;  4MMO A;  2PJ0 A;  5D8N A;  4ZYQ A;  4A39 A;  1XBU A;  4GM5 A;  2VRI A;  3EWR A;  1R3N A;  4KSI A;  2WZN A;  1Q7L A;  5FSY A;  4P4E A;  2PE3 A;  3CDX A;  5FSV A;  2ZOF A;  1TF8 A;  3VAR A;  3EWP A;  4EFD A;  2NSM A;  2PJ8 A;  4PXB A;  3L2N A;  3B3S A;  4B6Z A;  1CP7 A;  3WAB A;  2ZED A;  5CBM A;  1LAN A;  4MRI A;  4IQY A;  2PJ6 A;  3FX6 A;  4JYW A;  1BAV A;  3ISX A;  3BI0 A;  4MCQ A;  4R8F A;  3LMS A;  2ABZ A;  2XEJ A;  4ZX8 A;  3LWU A;  4P4I A;  4IAV A;  1ARM A;  3D7G A;  4TNU A;  4A37 A;  3DLJ A;  1ARL A;  4K0C A;  2RFH A;  4J5R A;  4P10 A;  3FEE A;  1F57 A;  3SII A;  2JEW A;  4K3N A;  1QMU A;  3TC8 A;  2C6C A;  3JZT A;  3PFE A;  1LAM A;  2ZOG A;  2AFU A;  3EJG A;  1Y0Y A;  2LGR A;  4JLL A;  2OOT A;  1TXR A;  1ZR5 A;  3B2Y A;  4ETK A;  4P4D A;  2IMO A;  3GQE A;  4ZY2 A;  4FUU A;  2FVG A;  4GVW A;  2GU2 A;  3D7D A;  3GLJ A;  3PBE A;  5LRG A;  4ABK A;  4NJQ A;  4P45 A;  3SJF A;  2F7V A;  1VHO A;  4X2T A;  2V8D A;  3MN8 A;  1AYE A;  5DUS A;  2QJ8 A;  4MHZ A;  5LYL A;  2EK8 A;  3NH8 A;  1YW6 A;  2ZEE A;  4F9U A;  3KQX A;  1Z5R A;  5DS0 A;  2XEF A;  8CPA A;  1BPN A;  3H8E A;  4J5Q A;  1ELM P;  3MRU A;  4GUA A;  5HVH A;  2C6G A;  3FH4 A;  1TY8 A;  1HEE A;  4OKO A;  3D7F A;  3WC6 A;  2BCO A;  2G9D A;  1TF9 A;  4WJB A;  1IY7 A;  4FBE A;  3PEI A;  5K8N A;  1VGY A;  2CTC A;  3SJG A;  3GUX A;  3FJU A;  2PCU A;  4FAI A;  4EME A;  1FNO A;  2PIZ A;  3D4U A;  4R76 A;  1JQG A;  4NGQ A;  3B35 A;  1CBX A;  5THW A;  5CB3 A;  4OID A;  4ETJ A;  2PJ1 A;  3IIF A;  3V45 A;  3SI1 A;  3T8W A;  3SJX A;  2VL1 A;  4TWE A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  2GLJ A;  2NYQ A;  1CPX A;  4UEZ A;  3EJF A;  2ZEP A;  5FSZ A;  1YD9 A;  1Z8L A;  3PB8 X;  1HJZ A;  5JM6 A;  5D29 A;  4DUK A;  4G1P A;  2JBJ A;  3TX8 A;  4NJR A;  2J9A A;  2Q43 A;  2XEG A;  3H8G A;  1ZG7 A;  1F2O A;  2QYV A;  1NSA A;  2PJ7 A;  2GLF A;  2CTB A;  5HIH A;  1RTQ A;  4NGM A;  4CPA A;  1VIX A;  5LYF A;  2POK A;  3S9N A;  4H2K A;  4J4Z A;  4DYO A;  5HVG A;  3IID A;  4A94 A;  3PB9 X;  4PPZ A;  2AFC A;  2C1C A;  2JBK A;  4MHP A;  3B3C A;  3D7H A;  5FSU A;  4BD9 A;  2CIJ A;  3D68 A;  5CPA A;  3K2K A;  5K8P A;  2PJA A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4AXV A;  1CP6 A;  2OR4 A;  1GYT A;  5ELY A;  3Q71 A;  1SPV A;  4ZY0 A;  2BFR A;  5K8M A;  4JCA A;  5HOL A;  4EWT A;  2HB6 A;  4NGP A;  2AFM A;  3S9L A;  1YME A;  3RAM A;  5HVF A;  4MXU A;  6CPA A;  2IJZ A;  3V38 A;  3IEH A;  3V7Z A;  3WC5 A;  1LAP A;  3EW5 A;  3SIH A;  3KHZ A;  4OC0 A;  1TKJ A;  3S9M A;  1R43 A;  1ZR3 A;  2I3C A;  4Q7A A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4F8Z A;  4NGT A;  1EE3 P;  1OBR A;  1DE4 C;  1LFW A;  4TU0 A;  1M4L A;  4PQA A;  3SIJ A;  2GRE A;  4NFR A;  3KQZ A;  1QQ9 A;  3IC1 A;  2EEE A;  4OC1 A;  1H8L A;  2ACF A;  3FF3 A;  4MCR A;  2EWB A;  3KI9 A;  3PB4 X;  4PXC A;  5LRJ A;  2WYR A;  2ANP A;  2ZEN A;  5AIL A;  3GPG A;  4P4J A;  1AMP A;  2BOA A;  2PVV A;  4W9Y A;  1VHU A;  1TKF A;  4WWV A;  2AFX A;  3VFQ A;  3HLP A;  4F9V A;  3CPA A;  3V2B A;  3RBU A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  4UF4 A;  5HXD A;  3FEC A;  3KZW A;  4ZX9 A;  4ABL A;  2F8H A;  3HUV A;  4ZY1 A;  1IGB A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  3PRT A;  3GB0 A;  2XD7 A;  4OME A;  2DEA A;  1XRY A;  3PB7 X;  4ESS A;  1XJO A;  2O4H A;  5JH9 A;  3KR5 A;  3DGV A;  4PXD A;  4JZ0 A;  1Z2L A;  5E3B A;  4OIW A;  3EWO A;  3IFE A;  2PJ9 A;  4O23 A;  3NH5 A;  3ISZ A;  1ELL P;  1BPM A;  4FWU A;  1PYT B;  3KGQ A;  4OC5 A;  4DJL A;  3GPO A;  3EWQ A;  1LOK A;  3I1U A;  4NGN A;  4P44 A;  5CB5 A;  3GPQ A;  2ZEH A;  4ONW A;  4X3R A;  4JGK A;  3GQO A;  2ZEM A;  3VH9 A;  1XFO A;  2AFW A;  1CPS A;  4UEF A;  2PIY A;  3D66 A;  5CMS A;  4YWY A;  3RZA A;  3BHX A;  2O53 A;  3WC7 A;  3KAS A;  4A38 A;  1XMB A;  4GVV A;  4IHM A;  4PXE A;  2PRQ A;  3JRU A;  3FVL A;  2PJB A;  3IO1 A;  3VAT A;  1LCP A;  2QVP A;  3EKE A;  3NH4 A;  2Q4Z A;  3IWW A;  3BXM A;  3PB6 X;  3K9T A;  3D67 A;  4UIB A;  3NFZ A;  4D86 A;  1NJR A;  3KHX A;  2C6P A;  4UML A;  2DX6 A;  5FSX A;  4OC2 A;  3WT4 A;  3QNV A;  5IB9 A;  3SI2 A;  1KWM A;  4X8I A;  1FT7 A;  3B7I A;  4IK2 A;  2PJ5 A;  2RB7 A;  1ZG9 A;  2PJ4 A;  1CG2 A;  2PVW A;  4P6Y A;  3H8F A;  1ZG8 A;  4Z65 A;  3B3V A;  1VHE A;  3B3W A;  2BO9 A;  2V8V A;  1F2P A;  2HC9 A;  2L8R A;  2CF4 A; 
#chains in the Genus database with same CATH topology
 4ZI6 A;  2J8M A;  3S6F A;  2FXK A;  4KYB A;  5LRK A;  4RUH A;  3BI1 A;  2Q44 A;  4QUS A;  2Y0M A;  3KL9 A;  1PCA A;  3IWG A;  5AG4 A;  2Q51 A;  2KQV A;  3IIB A;  1TXZ A;  1QSN A;  4UEE A;  1TKH A;  4MCP A;  3FB3 A;  5K8O A;  1QST A;  2BSW A;  2X47 A;  1GHE A;  4MHN A;  3KR4 A;  4JVV A;  2FG1 A;  4MCS A;  3EC4 A;  1ZLH A;  2JEV A;  5KTA A;  2IQ6 A;  2B5G A;  1YW4 A;  3W91 A;  3PFO A;  4UWJ A;  2CNM A;  3GYA A;  4YU9 A;  2ZEG A;  4NGR A;  4CAE A;  3QAH A;  1XOV A;  2FCK A;  1UWY A;  2FXF A;  2Z3K A;  2BFQ A;  3D3S A;  3IGR A;  5LYD A;  4KOR A;  4J5S A;  1HDQ A;  5EC4 A;  5FVJ A;  4MHY A;  2PJC A;  4A30 A;  3CPX A;  2PJ3 A;  3SIG A;  4KUB A;  3SI0 A;  2XEI A;  3FBU A;  1Z8T A;  2OZG A;  3BJ8 A;  1HDU A;  4DNC A;  4OC3 A;  1S7F A;  2R7H A;  3FMC A;  7CPA A;  2Q4Y A;  4P4B A;  2V8G A;  4M6G A;  4OP4 A;  1YLO A;  4LX9 A;  3Q6Z A;  2GE3 A;  2PJ2 A;  4UFW A;  1RO5 A;  1YSJ A;  2V8H A;  2AFZ A;  5AG7 A;  4CAV A;  2J8N A;  3FED A;  5J8C A;  4LQG A;  1CX8 A;  1Z8X A;  4HNX B;  4R7M A;  5LYI A;  4HKF A;  4JLY A;  1Y0R A;  5F47 A;  3ETI A;  2FAV A;  1K4J A;  2EK9 A;  4R6T A;  4NGS A;  4PSW A;  1Y7E A;  1KUX A;  4P4F A;  1Z9U A;  2IL4 A;  4MMO A;  4B13 A;  2PJ0 A;  5D8N A;  1Z4E A;  3JVN A;  4ZYQ A;  2FE7 A;  5AG6 A;  3NE8 A;  1Q2Y A;  4A39 A;  1XBU A;  2GFQ A;  2VZY A;  4GM5 A;  4QVT A;  4PSX A;  1NE9 A;  2VRI A;  3EWR A;  1R3N A;  4KSI A;  2WZN A;  1Q7L A;  5FSY A;  4OAE A;  4BMH A;  4P4E A;  3TOB A;  2PE3 A;  3CDX A;  5FSV A;  2ATR A;  3ZZI A;  1X10 A;  2ZOF A;  1TF8 A;  1UFH A;  2Q4V A;  3VAR A;  2D4O A;  3EWP A;  3JTK A;  4UFX A;  4EFD A;  2NSM A;  2PJ8 A;  1YVO A;  4KLV A;  3L2N A;  4PXB A;  5AG5 A;  1U6M A;  3B3S A;  5BWA B;  4B6Z A;  4CGN A;  3S6H A;  1CP7 A;  4KVX A;  3WAB A;  2ZED A;  4XNH C;  3IU1 A;  1IB1 E;  4MFZ A;  1KZF A;  1QSR A;  5CBM A;  1LAN A;  4MRI A;  4CS0 B;  2WPW A;  4IQY A;  2PJ6 A;  2AJ6 A;  3FX6 A;  4JYW A;  1BAV A;  1CJW A;  1V0C A;  3ISX A;  3BI0 A;  2G3A A;  4R3K A;  4MCQ A;  4R8F A;  5C88 A;  2OZU A;  3LMS A;  2ABZ A;  2REF A;  4ZX8 A;  2XEJ A;  3LWU A;  4P4I A;  4IAV A;  3SXN A;  1ARM A;  2OU2 A;  3D7G A;  4TNU A;  1XMT A;  3CZX A;  4A37 A;  3DLJ A;  3LOD A;  1ARL A;  2J8R A;  3I9S A;  3IU2 A;  4II9 A;  4K0C A;  2RFH A;  5IV0 A;  4J5R A;  4P10 A;  3FEE A;  3TOA A;  1F57 A;  4Y49 B;  2DXQ A;  3SII A;  3I3G A;  2JEW A;  4K3N A;  3DSB A;  1QMU A;  4H6U A;  3TC8 A;  2B3U A;  4JXQ A;  2C6C A;  3JZT A;  2Q0Y A;  2YNC A;  5F46 A;  4ZGY B;  2FSR A;  2GIV A;  1LAM A;  3PFE A;  2ZOG A;  2AFU A;  2WUU A;  3EJG A;  1CM0 A;  2LGR A;  1WK4 A;  1Y0Y A;  2PQ8 A;  2VBQ A;  4JLL A;  3W6S A;  2OOT A;  1TXR A;  1ZR5 A;  1P0H A;  2R98 A;  3R95 A;  3B2Y A;  4ETK A;  4P4D A;  4A33 A;  2IMO A;  3GQE A;  4ZY2 A;  4KZT A;  4FUU A;  1TIQ A;  4UCP A;  2FVG A;  4GVW A;  2GU2 A;  3D7D A;  3GLJ A;  2FL4 A;  1M1D A;  3PBE A;  4U5Y A;  5F48 A;  4ABK A;  5LRG A;  4NJQ A;  4B5O A;  3G3S A;  4P45 A;  3SJF A;  2F7V A;  2B4D B;  4KOV A;  2F5I A;  2JDC A;  3R9E A;  4C2Y A;  1VHO A;  1XIX A;  4MHD A;  3SHP A;  4X2T A;  2V8D A;  3EXN A;  3MN8 A;  3RYO A;  1AYE A;  5DUS A;  3R9G A;  2QJ8 A;  4OLL A;  1VKC A;  4MHZ A;  3MGD A;  5LYL A;  1Y9W A;  1MJ9 A;  1YQE A;  2EK8 A;  2P0W A;  3NH8 A;  1YW6 A;  2ZEE A;  4UWI A;  4F9U A;  3KQX A;  1Z5R A;  2R8V A;  5DS0 A;  4CGL A;  5IB0 A;  2JZE A;  2XEF A;  2P6G A;  8CPA A;  1BPN A;  3H8E A;  4J5Q A;  1J4J A;  1ELM P;  3MRU A;  4GUA A;  3TO7 A;  5HVH A;  2C6G A;  4AB7 A;  2DPT A;  4MFK A;  3FH4 A;  2PR8 A;  4AVC A;  1TY8 A;  3H5Z A;  1HEE A;  1QSM A;  2JLM A;  4OKO A;  3TFY A;  3D7F A;  1XE4 A;  5G1Z A;  2BCO A;  2YNE A;  3QAY A;  2G9D A;  3WC6 A;  2ZXV A;  1TF9 A;  2H5M A;  3F8K A;  1MJA A;  1IY7 A;  4H6Z A;  4WJB A;  4CGP A;  3PEI A;  4FBE A;  4QB9 A;  5K8N A;  1VGY A;  4M3S A;  2CTC A;  1S7K A;  4YRH A;  3SJG A;  2D4P A;  2X7B A;  3GUX A;  3FJU A;  3TCV A;  5JQ4 A;  2PCU A;  4K30 A;  2G0B A;  1S3Z A;  4FAI A;  4I49 A;  3FIX A;  4EME A;  2EVN A;  4B5P A;  1FNO A;  2Z3N A;  2PIZ A;  4R76 A;  1JQG A;  3D4U A;  4NGQ A;  3B35 A;  2BUE A;  4IF5 A;  2Z3L A;  2RC4 A;  1CBX A;  3C26 A;  5THW A;  4PV6 A;  5CB3 A;  4OID A;  4CYP A;  2WSA A;  4C2Z A;  4ETJ A;  2PJ1 A;  3IIF A;  3V45 A;  3SI1 A;  2VZZ A;  3R96 A;  4OAD A;  3T8W A;  3EFA A;  2VL1 A;  4MFP A;  4TWE A;  5G21 A;  3SJX A;  4BIN A;  4AG7 A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  1XEB A;  2GLJ A;  1CPX A;  2NYQ A;  4NF1 A;  2RNK A;  4KLW A;  4R57 A;  4UEZ A;  5J8F A;  2ZW4 A;  3EJF A;  1S7L A;  2ZEP A;  3F0A A;  5FSZ A;  3LAC A;  1S7N A;  1YD9 A;  4RS2 A;  3H4Q A;  1Z4R A;  1Z8L A;  3PB8 X;  1HJZ A;  1Q2C A;  2CXA A;  2ZW5 A;  5JM6 A;  2JDD A;  4R87 A;  5D29 A;  4DUK A;  4G1P A;  2JBJ A;  1S60 A;  3BLN A;  3QB8 A;  3TX8 A;  4CAW A;  4KOW A;  5I0C A;  2EBJ A;  2PSW A;  4NJR A;  4J3G A;  2J9A A;  2Q43 A;  1WWZ A;  2WCT A;  2B58 A;  2KCW A;  3H8G A;  1NMT A;  1ZG7 A;  2DF5 A;  2XEG A;  4JXR A;  4MFL A;  4R3L A;  4QBJ A;  2FT0 A;  1F2O A;  2QYV A;  3B8G A;  4C7H A;  1NSA A;  2PJ7 A;  2GLF A;  2CTB A;  2K5T A;  5HIH A;  1YK3 A;  1RTQ A;  2B4D A;  3A9L A;  2HUZ A;  4NGM A;  4YGO A;  2AE6 A;  4CPA A;  3FYN A;  1VIX A;  2CNT A;  5LYF A;  2POK A;  2PRB A;  3IWE A;  4CRZ B;  4KVO E;  4HPS A;  3S9N A;  2A4N A;  4H2K A;  4J4Z A;  3SXO A;  1I1D A;  4CGO A;  4DYO A;  4EVY A;  5HVG A;  3IID A;  4KOU A;  3UY5 A;  4A94 A;  3PB9 X;  4PPZ A;  2AFC A;  3D8P A;  4BBH A;  2C1C A;  1YGH A;  2JBK A;  4MHP A;  3VWE A;  3B3C A;  3D7H A;  5FSU A;  2PDO A;  2CIJ A;  3D68 A;  4BD9 A;  5CPA A;  3K2K A;  2Z11 A;  4CAX A;  5K8P A;  2QIR A;  2PJA A;  2VQY A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4L8A A;  2Q7B A;  1CP6 A;  1N71 A;  2OR4 A;  1GYT A;  2ZW7 A;  3DR6 A;  5ELY A;  3Q71 A;  4CYQ A;  1SPV A;  2C27 A;  4ZY0 A;  2BFR A;  1M4D A;  5K8M A;  4JCA A;  5HOL A;  4A2Z A;  4EWT A;  5ISV A;  3G8W A;  2HB6 A;  4NGP A;  4AVB A;  2AFM A;  3S9L A;  1YME A;  3RAM A;  5HVF A;  4MXU A;  4LUA A;  4U9Z A;  6CPA A;  2IJZ A;  2I00 A;  3IEH A;  3V38 A;  3V7Z A;  1PUA A;  5EMI A;  4GS4 A;  3OWC A;  3T9Y A;  1LAP A;  3TTH A;  3WC5 A;  3EW5 A;  2HQY A;  3SIH A;  3WR7 A;  2JZF A;  4FD6 A;  4A95 A;  4E8O A;  1PU9 A;  2DPS A;  3KHZ A;  2FIW A;  4CGM A;  1I12 A;  2YNC C;  5A28 A;  1XF8 A;  4KS9 A;  2I79 A;  1TKJ A;  4H89 A;  4OC0 A;  3S6G A;  4JWP A;  3S9M A;  4E2A A;  1R43 A;  1ZR3 A;  2I3C A;  4PK2 A;  4Q7A A;  4UBR A;  3N7Z A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4B14 A;  4NGT A;  4F8Z A;  3D2P A;  3NE7 A;  1EE3 P;  1MK4 A;  4XPD C;  1OBR A;  5A27 A;  1DE4 C;  1LFW A;  4CYN A;  4TU0 A;  1M4L A;  1YRE A;  4PQA A;  4AG9 A;  1KUV A;  4A32 A;  3SIJ A;  4F6A A;  4F0Y A;  2GRE A;  4NFR A;  3KQZ A;  5C82 A;  1RXT A;  1QQ9 A;  3CXQ A;  1ON0 A;  3IC1 A;  2EEE A;  1S5K A;  4OC1 A;  1KUY A;  1H8L A;  3FNC A;  4KOT A;  3DR8 A;  1IYL A;  2ACF A;  3BJ7 A;  3FF3 A;  5JPH A;  4MCR A;  3W6X A;  3RO0 A;  4MY0 A;  4UA3 A;  4C7I A;  2EWB A;  3KI9 A;  3PB4 X;  4MBU A;  2PC1 A;  4NXY A;  4PXC A;  5LRJ A;  3D2M A;  2WYR A;  2ANP A;  3VWD A;  2ZEN A;  4M6H A;  5AIL A;  3GPG A;  4P4J A;  2B4B A;  4AVA A;  1AMP A;  4LQ6 A;  2EUI A;  2R1I A;  2BOA A;  5KTD A;  2HV2 A;  4UFV A;  2O28 A;  2PVV A;  4W9Y A;  1VHU A;  1TKF A;  3GY9 A;  4WWV A;  4FD7 A;  2AFX A;  3VFQ A;  2REE A;  4JD6 A;  4NSQ A;  4QC6 A;  3HLP A;  4F9V A;  3CPA A;  2QEC A;  5E96 A;  3V2B A;  4U9Y A;  3RBU A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  1VHS A;  4B10 A;  1YLE A;  2VI7 A;  2Q7S A;  4UF4 A;  1JWQ A;  5HXD A;  3FEC A;  3KZW A;  4RI1 A;  4ZX9 A;  2B3V A;  1B6B A;  1QSO A;  3CXS A;  4NEX A;  1M4G A;  4ABL A;  3PZJ A;  2F8H A;  1I21 A;  2GAN A;  3HUV A;  4ZY1 A;  2ZW6 A;  1IGB A;  3P2F A;  4RN7 A;  4XPD B;  5CNP A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  4MFJ A;  2W2G A;  3PRT A;  4Y49 C;  4X5K A;  3V8I A;  2XD7 A;  3GB0 A;  2QML A;  4M6I A;  4OME A;  2VXK A;  4FD5 A;  5AGE A;  4C2X A;  5HMN A;  3JUW A;  3TO6 A;  3TT2 A;  2DEA A;  1XRY A;  2NMT A;  1IYK A;  3CXP A;  3PB7 X;  4NCZ A;  4KOY A;  4ESS A;  1XJO A;  2O4H A;  2FIA A;  3KR5 A;  4UCM A;  5JH9 A;  2YND A;  3DGV A;  3DDD A;  4PXD A;  4JZ0 A;  4IUS A;  3S6K A;  2Q04 A;  3LD2 A;  1Z2L A;  5E3B A;  4OIW A;  4MI4 A;  3EWO A;  1P4N A;  5HH1 A;  3IFE A;  2PJ9 A;  5KTC A;  4PK3 A;  4KSA A;  4F0X A;  4O23 A;  1X12 A;  2BEI A;  1M44 A;  3NH5 A;  3ISZ A;  3RNZ A;  1ELL P;  2JZD A;  1BPM A;  4ORF A;  4FWU A;  2YGW A;  1PYT B;  4CYO A;  4C68 A;  1Y9K A;  3PGP A;  4L89 A;  3KGQ A;  4OC5 A;  4XNH B;  5DWM A;  1A2Z A;  4DJL A;  2ARH A;  3EY5 A;  5G22 A;  3GPO A;  3TE4 A;  5DWN A;  3EWQ A;  1IID A;  1LOK A;  3I1U A;  3PP9 A;  4NGN A;  4P44 A;  5CB5 A;  3FXT A;  3GPQ A;  2ZEH A;  2Z3P A;  4ONW A;  4X3R A;  3R9F A;  4JGK A;  4GXH A;  3GQO A;  2ODF A;  2ZEM A;  3VH9 A;  4HNY B;  4M85 A;  1XFO A;  1AUG A;  2AFW A;  2Z10 A;  2Z3M A;  2PR1 A;  4CRY B;  1Q2D A;  4KOX A;  4HNW B;  4Q38 A;  5IX3 A;  3DNS A;  4YFJ A;  1CPS A;  4UEF A;  1BO4 A;  2PIY A;  3D66 A;  5CMS A;  1IOF A;  1BOB A;  4YWY A;  3RZA A;  1L0C A;  3BHX A;  2O53 A;  4MJ8 A;  3WC7 A;  4B12 A;  3KAS A;  4A38 A;  1XMB A;  2Z3O A;  4KUA A;  5EBV A;  4ONU A;  2WPX A;  4GVV A;  3GKR A;  4IHM A;  3TO9 A;  2EO8 A;  1ZO0 A;  4PXE A;  4AXV A;  4A31 A;  2PRQ A;  3JRU A;  3FVL A;  2PJB A;  3IO1 A;  5G20 A;  3VAT A;  1LCP A;  3FRM A;  1YX0 A;  4CAF A;  2QVP A;  3EKE A;  3NH4 A;  1Y7R A;  2Q4Z A;  1IOI A;  3IWW A;  1FY7 A;  3BXM A;  3PB6 X;  1LRZ A;  3K9T A;  3D67 A;  3R1K A;  4MFQ A;  4UIB A;  3NFZ A;  4D86 A;  3K9U A;  1NJR A;  3F5B A;  3KHX A;  4B11 A;  2C6P A;  4B5P B;  4UML A;  3EO4 A;  2DX6 A;  2B5G B;  5FSX A;  5GCN A;  4KSF A;  4OC2 A;  3WT4 A;  3QNV A;  4UCN A;  2OZH A;  1YVK A;  5IB9 A;  5H86 A;  3SI2 A;  3KKW A;  4MY3 A;  1B87 A;  1KWM A;  3T90 A;  4X8I A;  2P6E A;  1FT7 A;  3B7I A;  2BL1 A;  4IK2 A;  4Q36 A;  1M4I A;  1IU8 A;  1MJB A;  2G3T A;  2PJ5 A;  3P2H A;  2RB7 A;  1ZG9 A;  2PJ4 A;  1CG2 A;  2CNS A;  2VEZ A;  2PVW A;  4P6Y A;  4FD4 A;  1SQH A;  4KVM E;  5F49 A;  2OB0 A;  2P6F A;  3H8F A;  1ZG8 A;  1OZP A;  1R57 A;  4KOS A;  4Z65 A;  3B3V A;  1VHE A;  4JJX A;  2CY2 A;  1YR0 A;  3B3W A;  3GIU A;  2OH1 A;  5H84 A;  2BO9 A;  2V8V A;  4E0A A;  4R9M A;  4XPL A;  4ZBG A;  2FS5 A;  3ZJ0 A;  1F2P A;  1IIC A;  1NSL A;  2HC9 A;  2ZPA A;  1Z8W A;  3E0K A;  4XPK A;  2L8R A;  2CF4 A;  2Z0Z A; 
#chains in the Genus database with same CATH homology
 4ZI6 A;  2FXK A;  4KYB A;  5LRK A;  4RUH A;  3BI1 A;  3KL9 A;  1PCA A;  2Q51 A;  3IIB A;  1TXZ A;  4UEE A;  5K8O A;  1TKH A;  4MCP A;  2X47 A;  4MHN A;  3KR4 A;  4JVV A;  2FG1 A;  4MCS A;  1ZLH A;  2IQ6 A;  1YW4 A;  3PFO A;  4YU9 A;  2ZEG A;  4NGR A;  1UWY A;  5LYD A;  2BFQ A;  4J5S A;  1HDQ A;  4MHY A;  2PJC A;  3CPX A;  2PJ3 A;  3SIG A;  3SI0 A;  2XEI A;  1HDU A;  4OC3 A;  3FMC A;  7CPA A;  4P4B A;  2V8G A;  4OP4 A;  1YLO A;  3Q6Z A;  2PJ2 A;  1YSJ A;  2V8H A;  2AFZ A;  3FED A;  4LQG A;  1CX8 A;  4R7M A;  5LYI A;  1Y0R A;  3ETI A;  2FAV A;  2EK9 A;  4R6T A;  4NGS A;  1Y7E A;  4P4F A;  4MMO A;  2PJ0 A;  5D8N A;  4ZYQ A;  4A39 A;  1XBU A;  4GM5 A;  2VRI A;  3EWR A;  1R3N A;  4KSI A;  2WZN A;  1Q7L A;  5FSY A;  4P4E A;  2PE3 A;  3CDX A;  5FSV A;  2ZOF A;  1TF8 A;  3VAR A;  3EWP A;  4EFD A;  2NSM A;  2PJ8 A;  4PXB A;  3L2N A;  3B3S A;  4B6Z A;  1CP7 A;  3WAB A;  2ZED A;  5CBM A;  1LAN A;  4MRI A;  4IQY A;  2PJ6 A;  3FX6 A;  4JYW A;  1BAV A;  3ISX A;  3BI0 A;  4MCQ A;  4R8F A;  3LMS A;  2ABZ A;  2XEJ A;  4ZX8 A;  3LWU A;  4P4I A;  4IAV A;  1ARM A;  3D7G A;  4TNU A;  4A37 A;  3DLJ A;  1ARL A;  4K0C A;  2RFH A;  4J5R A;  4P10 A;  3FEE A;  1F57 A;  3SII A;  2JEW A;  4K3N A;  1QMU A;  3TC8 A;  2C6C A;  3JZT A;  3PFE A;  1LAM A;  2ZOG A;  2AFU A;  3EJG A;  1Y0Y A;  2LGR A;  4JLL A;  2OOT A;  1TXR A;  1ZR5 A;  3B2Y A;  4ETK A;  4P4D A;  2IMO A;  3GQE A;  4ZY2 A;  4FUU A;  2FVG A;  4GVW A;  2GU2 A;  3D7D A;  3GLJ A;  3PBE A;  5LRG A;  4ABK A;  4NJQ A;  4P45 A;  3SJF A;  2F7V A;  1VHO A;  4X2T A;  2V8D A;  3MN8 A;  1AYE A;  5DUS A;  2QJ8 A;  4MHZ A;  5LYL A;  2EK8 A;  3NH8 A;  1YW6 A;  2ZEE A;  4F9U A;  3KQX A;  1Z5R A;  5DS0 A;  2XEF A;  8CPA A;  1BPN A;  3H8E A;  4J5Q A;  1ELM P;  3MRU A;  4GUA A;  5HVH A;  2C6G A;  3FH4 A;  1TY8 A;  1HEE A;  4OKO A;  3D7F A;  3WC6 A;  2BCO A;  2G9D A;  1TF9 A;  4WJB A;  1IY7 A;  4FBE A;  3PEI A;  5K8N A;  1VGY A;  2CTC A;  3SJG A;  3GUX A;  3FJU A;  2PCU A;  4FAI A;  4EME A;  1FNO A;  2PIZ A;  3D4U A;  4R76 A;  1JQG A;  4NGQ A;  3B35 A;  1CBX A;  5THW A;  5CB3 A;  4OID A;  4ETJ A;  2PJ1 A;  3IIF A;  3V45 A;  3SI1 A;  3T8W A;  3SJX A;  2VL1 A;  4TWE A;  4UIA A;  2AFO A;  5F09 A;  3CT9 A;  2GLJ A;  2NYQ A;  1CPX A;  4UEZ A;  3EJF A;  2ZEP A;  5FSZ A;  1YD9 A;  1Z8L A;  3PB8 X;  1HJZ A;  5JM6 A;  5D29 A;  4DUK A;  4G1P A;  2JBJ A;  3TX8 A;  4NJR A;  2J9A A;  2Q43 A;  2XEG A;  3H8G A;  1ZG7 A;  1F2O A;  2QYV A;  1NSA A;  2PJ7 A;  2GLF A;  2CTB A;  5HIH A;  1RTQ A;  4NGM A;  4CPA A;  1VIX A;  5LYF A;  2POK A;  3S9N A;  4H2K A;  4J4Z A;  4DYO A;  5HVG A;  3IID A;  4A94 A;  3PB9 X;  4PPZ A;  2AFC A;  2C1C A;  2JBK A;  4MHP A;  3B3C A;  3D7H A;  5FSU A;  4BD9 A;  2CIJ A;  3D68 A;  5CPA A;  3K2K A;  5K8P A;  2PJA A;  2ZEL A;  3NA6 A;  1ZLI A;  2ZEO A;  4AXV A;  1CP6 A;  2OR4 A;  1GYT A;  5ELY A;  3Q71 A;  1SPV A;  4ZY0 A;  2BFR A;  5K8M A;  4JCA A;  5HOL A;  4EWT A;  2HB6 A;  4NGP A;  2AFM A;  3S9L A;  1YME A;  3RAM A;  5HVF A;  4MXU A;  6CPA A;  2IJZ A;  3V38 A;  3IEH A;  3V7Z A;  3WC5 A;  1LAP A;  3EW5 A;  3SIH A;  3KHZ A;  4OC0 A;  1TKJ A;  3S9M A;  1R43 A;  1ZR3 A;  2I3C A;  4Q7A A;  2AFS A;  3N5F A;  1DTD A;  5JGF A;  2ZEF A;  3PBB A;  4F8Z A;  4NGT A;  1EE3 P;  1OBR A;  1DE4 C;  1LFW A;  4TU0 A;  1M4L A;  4PQA A;  3SIJ A;  2GRE A;  4NFR A;  3KQZ A;  1QQ9 A;  3IC1 A;  2EEE A;  4OC1 A;  1H8L A;  2ACF A;  3FF3 A;  4MCR A;  2EWB A;  3KI9 A;  3PB4 X;  4PXC A;  5LRJ A;  2WYR A;  2ANP A;  2ZEN A;  5AIL A;  3GPG A;  4P4J A;  1AMP A;  2BOA A;  2PVV A;  4W9Y A;  1VHU A;  1TKF A;  4WWV A;  2AFX A;  3VFQ A;  3HLP A;  4F9V A;  3CPA A;  3V2B A;  3RBU A;  1BLL E;  3IJ3 A;  4OC4 A;  5J1Q A;  4UF4 A;  5HXD A;  3FEC A;  3KZW A;  4ZX9 A;  4ABL A;  2F8H A;  3HUV A;  4ZY1 A;  1IGB A;  5I4M A;  3B3T A;  3SJE A;  2V77 A;  3PRT A;  3GB0 A;  2XD7 A;  4OME A;  2DEA A;  1XRY A;  3PB7 X;  4ESS A;  1XJO A;  2O4H A;  5JH9 A;  3KR5 A;  3DGV A;  4PXD A;  4JZ0 A;  1Z2L A;  5E3B A;  4OIW A;  3EWO A;  3IFE A;  2PJ9 A;  4O23 A;  3NH5 A;  3ISZ A;  1ELL P;  1BPM A;  4FWU A;  1PYT B;  3KGQ A;  4OC5 A;  4DJL A;  3GPO A;  3EWQ A;  1LOK A;  3I1U A;  4NGN A;  4P44 A;  5CB5 A;  3GPQ A;  2ZEH A;  4ONW A;  4X3R A;  4JGK A;  3GQO A;  2ZEM A;  3VH9 A;  1XFO A;  2AFW A;  1CPS A;  4UEF A;  2PIY A;  3D66 A;  5CMS A;  4YWY A;  3RZA A;  3BHX A;  2O53 A;  3WC7 A;  3KAS A;  4A38 A;  1XMB A;  4GVV A;  4IHM A;  4PXE A;  2PRQ A;  3JRU A;  3FVL A;  2PJB A;  3IO1 A;  3VAT A;  1LCP A;  2QVP A;  3EKE A;  3NH4 A;  2Q4Z A;  3IWW A;  3BXM A;  3PB6 X;  3K9T A;  3D67 A;  4UIB A;  3NFZ A;  4D86 A;  1NJR A;  3KHX A;  2C6P A;  4UML A;  2DX6 A;  5FSX A;  4OC2 A;  3WT4 A;  3QNV A;  5IB9 A;  3SI2 A;  1KWM A;  4X8I A;  1FT7 A;  3B7I A;  4IK2 A;  2PJ5 A;  2RB7 A;  1ZG9 A;  2PJ4 A;  1CG2 A;  2PVW A;  4P6Y A;  3H8F A;  1ZG8 A;  4Z65 A;  3B3V A;  1VHE A;  3B3W A;  2BO9 A;  2V8V A;  1F2P A;  2HC9 A;  2L8R A;  2CF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...