4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
3NH4A 3FVLA 2XEFA 4X8IA 1CG2A 1F57A 3SIHA 3SIIA 4DUKA 2OR4A 4TWEA 2CTBA 4MHZA 1CPSA 4X2TA 1LOKA 4OC5A 4ZX8A 3KHXA 2BFRA 3PBEA 5CBMA 1F2PA 1JQGA 3D67A 3L2NA 4PXEA 1LAMA 2DX6A 4MCPA 4JLLA 4OMEA 4ZX9A 4OC0A 4W9YA 4RUHA 2C6CA 2ACFA 1PCAA 5ELYA 3GQOA 2ZOGA 1AYEA 3EKEA 3D68A 2GREA 1ZG7A 2IJZA 2FAVA 3SJEA 2NYQA 4ETJA 2J9AA 4R76A 1M4LA 2PJAA 3D7DA 2ZELA 4IK2A 2O53A 3S9LA 5LYIA 2BFQA 4ABKA 2ZEHA 2HB6A 1CX8A 4FBEA 1ZR3A 4EWTA 3EJGA 4A94A 7CPAA 5JH9A 3DLJA 3B7IA 2HC9A 4CPAA 4MHYA 3IWWA 2PE3A 1CP7A 3VH9A 3CPXA 2O4HA 1VGYA 2AFCA 3IC1A 1NSAA 3V2BA 3IIFA 2V77A 3SI0A 3FH4A 4FWUA 3EWRA 1ARMA 1BAVA 4OKOA 4MXUA 5J1QA 4UEZA 3ISZA 2I3CA 2QYVA 4GM5A 1YSJA 3GPQA 3JZTA 3IO1A 5LRGA 1HDQA 2AFSA 3PB9X 4NFRA 1CP6A 4BD9A 2AFWA 3KR4A 5F09A 3N5FA 4GVVA 2PIZA 3B3CA 3GQEA 1VIXA 3LWUA 5LYDA 1TKHA 4R6TA 3VFQA 3NFZA 2JBJA 3B35A 3LMSA 3K2KA 3IJ3A 3KQZA 5I4MA 3RAMA 4UMLA 3IFEA 4J5SA 4MMOA 3EJFA 1H8LA 3PFOA 1QQ9A 1YLOA 3PB6X 4J5RA 3CPAA 2V8DA 1TKJA 3QNVA 3BI0A 1LCPA 4KSIA 1TY8A 3IEHA 3SIGA 2Q51A 3IIBA 5D29A 2FG1A 3D7FA 2XEJA 2PCUA 4WJBA 4OIDA 4PXDA 4P4EA 1QMUA 2ZEPA 3GPOA 2FXKA 4OC1A 3D4UA 3ISXA 5E3BA 4ZY0A 2F8HA 1IGBA 2WZNA 2CTCA 3SIJA 5LRJA 3D7HA 3K9TA 2V8GA 3B3VA 3CT9A 1HJZA 3I1UA 2EEEA 4YU9A 1R43A 1FNOA 4D86A 4X3RA 2XEGA 3S9MA 3BHXA 1CPXA 2ZEOA 4KYBA 2PJ3A 3EWPA 1CBXA 5LYFA 3MN8A 2PVWA 2OOTA 2DEAA 4A39A 5DUSA 1ELLP 2ZEGA 1Y0RA 4O23A 4NJRA 4P4FA 4EFDA 1ZLHA 4ABLA 4FAIA 3H8EA 2VRIA 2BO9A 1XRYA 4JYWA 2L8RA 3KGQA 2JBKA 1XJOA 1LAPA 2F7VA 3WT4A 3GUXA 2EK9A 1DTDA 1OBRA 3FMCA 2X47A 1R3NA 4OC2A 4NGQA 3PBBA 3B2YA 3PB8X 4OIWA 1PYTB 3VATA 1Q7LA 2NSMA 4ESSA 3KASA 3KZWA 3T8WA 3SI1A 2C6GA 3FX6A 3PB4X 2EWBA 5THWA 3BXMA 3V7ZA 4ZI6A 1FT7A 4LQGA 5CPAA 2ANPA 3KL9A 1HDUA 4JGKA 5HVFA 5FSXA 3RBUA 3VARA 1XBUA 2XEIA 2ZOFA 4NGNA 3SJXA 4ONWA 1RTQA 3KR5A 4F8ZA 3Q71A 1LANA 4K0CA 2AFMA 3GB0A 3NA6A 3Q6ZA 3FEEA 1BPMA 2PJBA 4P44A 4UIBA 5CB5A 4NGSA 4NGTA 2PVVA 3NH8A 4DYOA 2ZEMA 3CDXA 5JM6A 1BPNA 5CB3A 4MCRA 3MRUA 4IAVA 3PB7X 1NJRA 1TF8A 3PFEA 4TU0A 5FSVA 2ZEFA 4ZY2A 4TNUA 4A38A 1IY7A 4R7MA 5K8OA 2PRQA 2RB7A 5FSZA 3SJFA 2PJCA 2C1CA 1ZG8A 2V8VA 3B3SA 8CPAA 3H8GA 4P4JA 3B3WA 2GLFA 4PPZA 2AFXA 1Y7EA 1YW6A 2G9DA 5LYLA 4P4BA 5K8PA 3SJGA 4NGRA 2ZENA 2PJ1A 4F9UA 1Z8LA 5LRKA 2ZEEA 1XMBA 1EE3P 4G1PA 6CPAA 2IMOA 2WYRA 2AFZA 5IB9A 2GU2A 3FF3A 4IHMA 3HLPA 4JVVA 3DGVA 2RFHA 5FSUA 5HVGA 2PJ8A 4P10A 3GPGA 4R8FA 3FEDA 1VHOA 4H2KA 4OC4A 4PXBA 1YW4A 4UEEA 5JGFA 4P6YA 1GYTA 3B3TA 3D66A 4NGPA 2PJ5A 3GLJA 1ELMP 3KI9A 1AMPA 3V38A 1HEEA 3KQXA 2PJ4A 1VHEA 4JZ0A 4A37A 2AFOA 4MCSA 5HVHA 4IQYA 4J5QA 4MHNA 1VHUA 5K8MA 3V45A 1TXZA 2PJ9A 4Q7AA 4ZYQA 3EWQA 2AFUA 3RZAA 3EW5A 3H8FA 4ZY1A 2CIJA 3ETIA 4YWYA 2ABZA 2CF4A 2QVPA 3WC7A 2Q43A 4MRIA 4B6ZA 5HXDA 5FSYA 4WWVA 3PRTA 3S9NA 3HUVA 2JEWA 5DS0A 5D8NA 3TX8A 4JCAA 1TKFA 2BOAA 2QJ8A 4GVWA 5HIHA 2GLJA 4NGMA 4F9VA 1KWMA 1ZG9A 4OP4A 2XD7A 4OC3A 3BI1A 1Z2LA 5CMSA 3SI2A 3KHZA 2PJ2A 3JRUA 3TC8A 1TF9A 2PJ0A 2POKA 4P4DA 1Z5RA 4PXCA 4MCQA 2Q4ZA 4Z65A 1SPVA 3FJUA 4MHPA 4GUAA 1ZLIA 4PQAA 4FUUA 2PIYA 2IQ6A 1DE4C 1UWYA 1F2OA 4P45A 3EWOA 3PEIA 2PJ6A 3WC5A 4EMEA 2LGRA 4ETKA 1TXRA 1XFOA 3WC6A 3FECA 4K3NA 1YMEA 1YD9A 2EK8A 4UEFA 4DJLA 1ARLA 1ZR5A 4AXVA 2VL1A 5K8NA 1Y0YA 2PJ7A 3WABA 1LFWA 3D7GA 2FVGA 4UF4A 4UIAA 4J4ZA 2V8HA 3NH5A 4NJQA 2BCOA 2ZEDA 5HOLA 4P4IA 3IIDA 5AILA 1BLLE 2C6PA
chains in the Genus database with same CATH superfamily
4XPKA 4B10A 4QB9A 3IWGA 3DNSA 3NH4A 4U5YA 3FVLA 2XEFA 4AG9A 4X8IA 1AUGA 1CG2A 2CNMA 2HV2A 1F57A 3SIHA 3SIIA 4UA3A 4DUKA 2BSWA 2OR4A 2WPWA 4TWEA 3TT2A 1CJWA 2CTBA 4MHZA 3EFAA 1CPSA 4Y49B 4X2TA 1LOKA 2PDOA 4OC5A 4J3GA 4ZX8A 3KHXA 4B5PB 2EVNA 4RI1A 2BFRA 3PBEA 1Z4RA 5CBMA 2I00A 1F2PA 1JQGA 3D67A 3L2NA 4IUSA 1LAMA 2DX6A 4PXEA 4MCPA 4JLLA 1XEBA 3EO4A 4ZX9A 4OAEA 4OC0A 4OMEA 5H86A 4W9YA 4RUHA 2ATRA 1N71A 2C6CA 4R3LA 2ACFA 1PCAA 4X5KA 5ELYA 3R9GA 5A28A 3GQOA 1IICA 2ZOGA 4ORFA 4CYQA 5HMNA 2Z11A 3V8IA 1AYEA 3EKEA 3D68A 4KOYA 2GREA 2B5GB 2JLMA 3OWCA 4M6GA 4MFQA 1XMTA 1ZG7A 4UFVA 4AVAA 2IJZA 3R96A 2FAVA 1KUXA 4Q36A 2NYQA 3SJEA 4E8OA 3QB8A 4JD6A 1ON0A 4A95A 2Z0ZA 4ETJA 2J9AA 4R76A 1M4LA 2PJAA 3D7DA 2ZELA 4IK2A 2O53A 2RC4A 3S9LA 5LYIA 1KUVA 2BFQA 4ABKA 3CXQA 4NF1A 2ZEHA 2HB6A 3H5ZA 2WCTA 1CX8A 4FBEA 1QSOA 1ZR3A 4UCMA 3EJGA 3MGDA 4EWTA 3W91A 2DPSA 4A94A 4CAWA 1NMTA 1YX0A 7CPAA 5JH9A 3DLJA 2R8VA 1MJBA 2Q4VA 2HC9A 3B7IA 4UWJA 4A32A 4CPAA 4KUAA 5F48A 3IWEA 4M6IA 4MHYA 3IWWA 2PE3A 1CP7A 3VH9A 2Z3LA 3CPXA 2O4HA 1VGYA 2AFCA 5A27A 4ONUA 2ZXVA 5G22A 4ZBGA 1IOFA 3IC1A 1NSAA 3V2BA 3IIFA 2V77A 4YGOA 3SI0A 4BINA 3FRMA 3FH4A 2KCWA 3E0KA 4FWUA 4XNHC 4CYOA 3EWRA 5F47A 1ARMA 4PSWA 1BAVA 4JXQA 4OKOA 2B4DB 2JDDA 4MXUA 1J4JA 4PV6A 4UEZA 5J1QA 2PRBA 2ARHA 3TCVA 3ISZA 4MFJA 4DNCA 3NE7A 2I3CA 2QYVA 2J8RA 4GM5A 1YSJA 3GPQA 3JZTA 3IO1A 4L8AA 1MJAA 3W6XA 1XE4A 2YNCA 5LRGA 1HDQA 2ZW6A 3EC4A 4MY3A 2AFSA 3PB9X 3C26A 4UFWA 4NFRA 1CP6A 4BD9A 2AFWA 3KR4A 1YGHA 5F09A 3N5FA 4GVVA 2PIZA 5AGEA 2D4PA 3B3CA 3GQEA 4E0AA 1VIXA 3LWUA 5LYDA 3TO6A 4CGNA 1TKHA 2FSRA 3G8WA 4KZTA 4R6TA 3VFQA 2REEA 3CXSA 3NFZA 4C7IA 4CS0B 1M1DA 5EC4A 2JBJA 2R1IA 2CXAA 3B35A 3LMSA 3K2KA 3K9UA 5AG4A 3IJ3A 3KQZA 2AJ6A 1M44A 2JZEA 2FIAA 1XIXA 5I4MA 4CRZB 4KOTA 3RAMA 4BMHA 2YNCC 2Z3PA 2JZFA 4UMLA 3CXPA 2QECA 3IFEA 2F5IA 4J5SA 2D4OA 3GYAA 4MMOA 4XNHB 3EJFA 1H8LA 3PFOA 1QQ9A 1Y7RA 1YLOA 3RO0A 3PB6X 4J5RA 3CPAA 2V8DA 2VI7A 1WWZA 1TKJA 2I79A 1S5KA 3D2PA 3QNVA 3CZXA 3D8PA 1QSRA 3LODA 2BL1A 3BI0A 1LCPA 4KSIA 1TY8A 5HH1A 3IEHA 3SIGA 2Q51A 3D2MA 3IIBA 5D29A 2FG1A 3D7FA 2XEJA 4MJ8A 2PCUA 3FBUA 4WJBA 4OIDA 4U9YA 2YNDA 4PXDA 1Y9WA 2IL4A 3TE4A 4P4EA 1QMUA 2ZEPA 3GPOA 3JTKA 4UCNA 2FXKA 3IU1A 3D4UA 4OC1A 1P0HA 5I0CA 3ISXA 5E3BA 4ZY0A 2F8HA 2G3TA 4KUBA 5JPHA 1QSNA 2Q04A 1IGBA 2Q0YA 2WZNA 4KVOE 4C7HA 3BLNA 1Q2CA 3IU2A 2CTCA 5KTDA 3SIJA 1SQHA 2OZHA 2OZUA 5LRJA 1S60A 2R98A 2DXQA 3D7HA 3K9TA 4XPDC 2V8GA 3B3VA 3CT9A 1HJZA 3I1UA 2EEEA 4HKFA 4YU9A 3A9LA 1M4GA 4AB7A 2VQYA 1R43A 2B3UA 5IX3A 4KOWA 1FNOA 4D86A 4PSXA 4X3RA 2XEGA 3S9MA 4CGOA 4R87A 4F0YA 3BHXA 3VWEA 4Q38A 1CPXA 5DWNA 2RNKA 2ZEOA 4KOUA 1Q2YA 3G3SA 4KYBA 2PJ3A 1KUYA 3EWPA 3P2HA 4A31A 1CBXA 5LYFA 4LUAA 5ISVA 3MN8A 2PVWA 2OOTA 2DEAA 4LQ6A 4A39A 5DUSA 1ELLP 4LX9A 2ZEGA 5EMIA 1Y0RA 3T90A 4O23A 4NJRA 5JQ4A 4P4FA 4R3KA 1ZLHA 2Z3OA 3EXNA 4ABLA 4RN7A 4EFDA 2P0WA 3H8EA 4FAIA 2VRIA 2BO9A 4M85A 1XRYA 4JYWA 2L8RA 3KGQA 4OADA 4B14A 2JBKA 1XJOA 1LAPA 2F7VA 3RNZA 1S7FA 2JDCA 4KSAA 3ZZIA 1OZPA 2G0BA 2GE3A 3GUXA 3WT4A 2EK9A 4AVCA 4AVBA 3FNCA 4JJXA 1DTDA 1OBRA 1Z8XA 2X47A 3FMCA 1R3NA 1XOVA 2Q4YA 4M3SA 1YQEA 4NGQA 3PBBA 4OC2A 1M4DA 1X10A 3B2YA 3PB8X 4OIWA 1PYTB 2BUEA 2Q44A 4CAFA 3VATA 4B13A 4XPDB 1Q7LA 2NSMA 4C2ZA 4ESSA 2B3VA 3KASA 3KZWA 3T8WA 4JXRA 3SI1A 2C6GA 2WSAA 3FX6A 3PB4X 3F5BA 2EWBA 5THWA 4E2AA 3BXMA 3V7ZA 5C88A 1U6MA 4ZI6A 3GKRA 3TTHA 4F6AA 1FT7A 4LQGA 5CPAA 4BBHA 2ANPA 1YLEA 3KL9A 4OLLA 2Q7BA 5BWAB 3DR8A 1HDUA 4JGKA 3LACA 5AG6A 5HVFA 2A4NA 3SHPA 4CRYB 4MHDA 2CNTA 2Z3MA 3FYNA 5FSXA 3RBUA 1RO5A 2KQVA 4FD7A 2Y0MA 3TO7A 3VARA 1XBUA 2XEIA 2ZOFA 1IYLA 1S7KA 4FD4A 4NGNA 3SJXA 4ONWA 1RTQA 3KR5A 4F8ZA 3Q71A 1LANA 2B4BA 3JUWA 4C2XA 2DF5A 4K0CA 4CAEA 4CYPA 5J8CA 1YVKA 3QAYA 3R1KA 2AFMA 3GB0A 5AG5A 1KZFA 3NA6A 3Q6ZA 3VWDA 4B5PA 1Z8TA 2NMTA 1BPMA 1IB1E 2PJBA 3FEEA 4KORA 4P44A 4UFXA 4UIBA 3R95A 5CB5A 4NGSA 4NGTA 2PVVA 3NH8A 4DYOA 3GIUA 2ZEMA 4NEXA 3CDXA 2CY2A 3EY5A 5JM6A 4I49A 1BPNA 5CB3A 1NE9A 4MCRA 3MRUA 4IAVA 5DWMA 3PB7X 2OZGA 1CM0A 1NJRA 1S3ZA 4GS4A 1TF8A 5GCNA 3S6KA 2Z3KA 2P6GA 3PFEA 1IOIA 1IIDA 4TU0A 5FSVA 2ZEFA 4ZY2A 4TNUA 4A38A 1IY7A 1I12A 4UBRA 4R7MA 3F0AA 5K8OA 1YK3A 4GXHA 2PRQA 3TOAA 5KTAA 2RB7A 3F8KA 5FSZA 3SJFA 4NCZA 2PJCA 4MFKA 2C1CA 1ZG8A 2V8VA 4MBUA 2YGWA 3B3SA 8CPAA 3H8GA 4P4JA 3B3WA 4KOSA 4CYNA 2EO8A 2GLFA 2FS5A 2Z10A 4MFPA 4PPZA 3I9SA 1R57A 2AFXA 2FIWA 4QVTA 4YRHA 1Y7EA 1YW6A 2G9DA 4KVXA 2PR1A 1ZO0A 5LYLA 4P4BA 1GHEA 4H89A 1FY7A 5K8PA 3SJGA 2GANA 2ZENA 3FB3A 4NGRA 2PJ1A 4F9UA 1Z8LA 1A2ZA 5LRKA 1XMBA 2O28A 2VBQA 1EE3P 2ZEEA 3R9FA 4C2YA 4G1PA 2VXKA 6CPAA 3I3GA 4UWIA 3ZJ0A 2IMOA 2X7BA 2WYRA 2AFZA 5IB9A 4NXYA 2GU2A 3FF3A 4IHMA 4II9A 1PU9A 4KS9A 3HLPA 4JVVA 3DGVA 5FSUA 2RFHA 4QUSA 3TO9A 5HVGA 2PJ8A 4P10A 3RYOA 3GPGA 1VHSA 5G20A 2DPTA 4R8FA 4B12A 2J8NA 4L89A 3FEDA 1VHOA 4H2KA 4OC4A 4PXBA 1VKCA 2Z3NA 1YW4A 4JLYA 4MFLA 4UEEA 5JGFA 3SXNA 1I21A 2PQ8A 4P6YA 1GYTA 3B3TA 4KOVA 2WPXA 1IYKA 3D66A 4H6UA 4NGPA 2PJ5A 2PC1A 2ZW7A 1UFHA 3PZJA 3GLJA 4AG7A 3PGPA 5C82A 4ZGYB 1ELMP 2EUIA 3KI9A 4FD6A 1AMPA 2QIRA 3V38A 2PR8A 1HEEA 3KQXA 1L0CA 2PJ4A 3D3SA 5IB0A 1VHEA 2K5TA 2ODFA 4JZ0A 4A37A 3DSBA 2AFOA 4MCSA 5CNPA 4IQYA 1YR0A 5HVHA 1I1DA 1Z9UA 2AE6A 4J5QA 4YFJA 1LRZA 4MHNA 1QSTA 3UY5A 2FCKA 4HNYB 1VHUA 5K8MA 3V45A 1TXZA 2PJ9A 4Q7AA 4ZYQA 3EWQA 2AFUA 4H6ZA 5EBVA 3RZAA 3EW5A 3H8FA 4ZY1A 1TIQA 2CIJA 3ETIA 4YWYA 4M6HA 3KKWA 3R9EA 2ABZA 2CF4A 2QVPA 2B58A 3WC7A 4A33A 2Q43A 4MRIA 4B6ZA 4CGMA 5HXDA 1QSMA 5FSYA 4C68A 3NE8A 4WWVA 3PRTA 3S9NA 3WR7A 1V0CA 2JEVA 3HUVA 2JEWA 5E96A 2ZW4A 3P2FA 3W6SA 3S6GA 3PP9A 1K4JA 5DS0A 4EVYA 5D8NA 2WUUA 3TX8A 4IF5A 4JCAA 1B87A 1BO4A 1TKFA 2HUZA 2BOAA 3N7ZA 2QJ8A 4GVWA 2H5MA 2OB0A 4PK3A 4F0XA 5HIHA 2GLJA 4NGMA 4F9VA 1XF8A 5FVJA 1KWMA 1MK4A 2GIVA 4XPLA 3S6HA 3FIXA 1ZG9A 4OP4A 2FL4A 4CGLA 4PK2A 2XD7A 4OC3A 3DR6A 3BI1A 1Z2LA 3BJ7A 1YVOA 3H4QA 2JZDA 1S7NA 5F46A 2HQYA 2Q7SA 4MY0A 5CMSA 3TFYA 3SI2A 1MJ9A 3TOBA 3KHZA 2PJ2A 4CAVA 1S7LA 3JRUA 3TC8A 2ZPAA 1TF9A 2VZYA 4HPSA 1RXTA 2PJ0A 2FT0A 2YNEA 2FXFA 4FD5A 2POKA 5H84A 4P4DA 2BEIA 4HNWB 5IV0A 4KLVA 4U9ZA 1Z5RA 4PXCA 4RS2A 4MCQA 4JWPA 1Z4EA 2CNSA 2Q4ZA 2B5GA 4Z65A 1SPVA 1WK4A 3FJUA 4MHPA 5F49A 4GUAA 1ZLIA 2VEZA 4PQAA 4QC6A 3BJ8A 4FUUA 2PIYA 2IQ6A 1DE4C 1UWYA 2EBJA 1F2OA 4Y49C 1JWQA 3JVNA 4MI4A 4P45A 3EWOA 1X12A 1PUAA 2C27A 3T9YA 3PEIA 2PJ6A 3WC5A 4EMEA 4B11A 2LGRA 4ETKA 1TXRA 1XFOA 3FXTA 4K30A 3FECA 3WC6A 4K3NA 1Q2DA 2GFQA 2P6EA 1YMEA 1YD9A 3IGRA 3DDDA 4R57A 3SXOA 2EK8A 2FE7A 2P6FA 4UEFA 4DJLA 4CAXA 4QBJA 1ARLA 1ZR5A 4B5OA 2J8MA 5G21A 4AXVA 2VL1A 2ZW5A 2W2GA 1Y0YA 3GY9A 5K8NA 3QAHA 1YREA 2PJ7A 1LFWA 3D7GA 4R9MA 3WABA 2FVGA 4CGPA 5KTCA 1IU8A 2OH1A 3S6FA 4HNXB 1P4NA 4KLWA 4MFZA 4UCPA 4UF4A 4A30A 4KOXA 4J4ZA 1BOBA 2V8HA 4KVME 4UIAA 3LD2A 3NH5A 4NJQA 1NSLA 2BCOA 5J8FA 2ZEDA 2VZZA 1Z8WA 5HOLA 4KSFA 4P4IA 3IIDA 2R7HA 5AILA 1BLLE 4NSQA 5G1ZA 1M4IA 4A2ZA 2C6PA 2PSWA 2QMLA 2REFA 2OU2A 2B4DA 5AG7A 3B8GA 1Y9KA 1B6BA 2G3AA
chains in the Genus database with same CATH topology
3NH4A 3FVLA 2XEFA 4X8IA 1CG2A 1F57A 3SIHA 3SIIA 4DUKA 2OR4A 4TWEA 2CTBA 4MHZA 1CPSA 4X2TA 1LOKA 4OC5A 4ZX8A 3KHXA 2BFRA 3PBEA 5CBMA 1F2PA 1JQGA 3D67A 3L2NA 4PXEA 1LAMA 2DX6A 4MCPA 4JLLA 4OMEA 4ZX9A 4OC0A 4W9YA 4RUHA 2C6CA 2ACFA 1PCAA 5ELYA 3GQOA 2ZOGA 1AYEA 3EKEA 3D68A 2GREA 1ZG7A 2IJZA 2FAVA 3SJEA 2NYQA 4ETJA 2J9AA 4R76A 1M4LA 2PJAA 3D7DA 2ZELA 4IK2A 2O53A 3S9LA 5LYIA 2BFQA 4ABKA 2ZEHA 2HB6A 1CX8A 4FBEA 1ZR3A 4EWTA 3EJGA 4A94A 7CPAA 5JH9A 3DLJA 3B7IA 2HC9A 4CPAA 4MHYA 3IWWA 2PE3A 1CP7A 3VH9A 3CPXA 2O4HA 1VGYA 2AFCA 3IC1A 1NSAA 3V2BA 3IIFA 2V77A 3SI0A 3FH4A 4FWUA 3EWRA 1ARMA 1BAVA 4OKOA 4MXUA 5J1QA 4UEZA 3ISZA 2I3CA 2QYVA 4GM5A 1YSJA 3GPQA 3JZTA 3IO1A 5LRGA 1HDQA 2AFSA 3PB9X 4NFRA 1CP6A 4BD9A 2AFWA 3KR4A 5F09A 3N5FA 4GVVA 2PIZA 3B3CA 3GQEA 1VIXA 3LWUA 5LYDA 1TKHA 4R6TA 3VFQA 3NFZA 2JBJA 3B35A 3LMSA 3K2KA 3IJ3A 3KQZA 5I4MA 3RAMA 4UMLA 3IFEA 4J5SA 4MMOA 3EJFA 1H8LA 3PFOA 1QQ9A 1YLOA 3PB6X 4J5RA 3CPAA 2V8DA 1TKJA 3QNVA 3BI0A 1LCPA 4KSIA 1TY8A 3IEHA 3SIGA 2Q51A 3IIBA 5D29A 2FG1A 3D7FA 2XEJA 2PCUA 4WJBA 4OIDA 4PXDA 4P4EA 1QMUA 2ZEPA 3GPOA 2FXKA 4OC1A 3D4UA 3ISXA 5E3BA 4ZY0A 2F8HA 1IGBA 2WZNA 2CTCA 3SIJA 5LRJA 3D7HA 3K9TA 2V8GA 3B3VA 3CT9A 1HJZA 3I1UA 2EEEA 4YU9A 1R43A 1FNOA 4D86A 4X3RA 2XEGA 3S9MA 3BHXA 1CPXA 2ZEOA 4KYBA 2PJ3A 3EWPA 1CBXA 5LYFA 3MN8A 2PVWA 2OOTA 2DEAA 4A39A 5DUSA 1ELLP 2ZEGA 1Y0RA 4O23A 4NJRA 4P4FA 4EFDA 1ZLHA 4ABLA 4FAIA 3H8EA 2VRIA 2BO9A 1XRYA 4JYWA 2L8RA 3KGQA 2JBKA 1XJOA 1LAPA 2F7VA 3WT4A 3GUXA 2EK9A 1DTDA 1OBRA 3FMCA 2X47A 1R3NA 4OC2A 4NGQA 3PBBA 3B2YA 3PB8X 4OIWA 1PYTB 3VATA 1Q7LA 2NSMA 4ESSA 3KASA 3KZWA 3T8WA 3SI1A 2C6GA 3FX6A 3PB4X 2EWBA 5THWA 3BXMA 3V7ZA 4ZI6A 1FT7A 4LQGA 5CPAA 2ANPA 3KL9A 1HDUA 4JGKA 5HVFA 5FSXA 3RBUA 3VARA 1XBUA 2XEIA 2ZOFA 4NGNA 3SJXA 4ONWA 1RTQA 3KR5A 4F8ZA 3Q71A 1LANA 4K0CA 2AFMA 3GB0A 3NA6A 3Q6ZA 3FEEA 1BPMA 2PJBA 4P44A 4UIBA 5CB5A 4NGSA 4NGTA 2PVVA 3NH8A 4DYOA 2ZEMA 3CDXA 5JM6A 1BPNA 5CB3A 4MCRA 3MRUA 4IAVA 3PB7X 1NJRA 1TF8A 3PFEA 4TU0A 5FSVA 2ZEFA 4ZY2A 4TNUA 4A38A 1IY7A 4R7MA 5K8OA 2PRQA 2RB7A 5FSZA 3SJFA 2PJCA 2C1CA 1ZG8A 2V8VA 3B3SA 8CPAA 3H8GA 4P4JA 3B3WA 2GLFA 4PPZA 2AFXA 1Y7EA 1YW6A 2G9DA 5LYLA 4P4BA 5K8PA 3SJGA 4NGRA 2ZENA 2PJ1A 4F9UA 1Z8LA 5LRKA 2ZEEA 1XMBA 1EE3P 4G1PA 6CPAA 2IMOA 2WYRA 2AFZA 5IB9A 2GU2A 3FF3A 4IHMA 3HLPA 4JVVA 3DGVA 2RFHA 5FSUA 5HVGA 2PJ8A 4P10A 3GPGA 4R8FA 3FEDA 1VHOA 4H2KA 4OC4A 4PXBA 1YW4A 4UEEA 5JGFA 4P6YA 1GYTA 3B3TA 3D66A 4NGPA 2PJ5A 3GLJA 1ELMP 3KI9A 1AMPA 3V38A 1HEEA 3KQXA 2PJ4A 1VHEA 4JZ0A 4A37A 2AFOA 4MCSA 5HVHA 4IQYA 4J5QA 4MHNA 1VHUA 5K8MA 3V45A 1TXZA 2PJ9A 4Q7AA 4ZYQA 3EWQA 2AFUA 3RZAA 3EW5A 3H8FA 4ZY1A 2CIJA 3ETIA 4YWYA 2ABZA 2CF4A 2QVPA 3WC7A 2Q43A 4MRIA 4B6ZA 5HXDA 5FSYA 4WWVA 3PRTA 3S9NA 3HUVA 2JEWA 5DS0A 5D8NA 3TX8A 4JCAA 1TKFA 2BOAA 2QJ8A 4GVWA 5HIHA 2GLJA 4NGMA 4F9VA 1KWMA 1ZG9A 4OP4A 2XD7A 4OC3A 3BI1A 1Z2LA 5CMSA 3SI2A 3KHZA 2PJ2A 3JRUA 3TC8A 1TF9A 2PJ0A 2POKA 4P4DA 1Z5RA 4PXCA 4MCQA 2Q4ZA 4Z65A 1SPVA 3FJUA 4MHPA 4GUAA 1ZLIA 4PQAA 4FUUA 2PIYA 2IQ6A 1DE4C 1UWYA 1F2OA 4P45A 3EWOA 3PEIA 2PJ6A 3WC5A 4EMEA 2LGRA 4ETKA 1TXRA 1XFOA 3WC6A 3FECA 4K3NA 1YMEA 1YD9A 2EK8A 4UEFA 4DJLA 1ARLA 1ZR5A 4AXVA 2VL1A 5K8NA 1Y0YA 2PJ7A 3WABA 1LFWA 3D7GA 2FVGA 4UF4A 4UIAA 4J4ZA 2V8HA 3NH5A 4NJQA 2BCOA 2ZEDA 5HOLA 4P4IA 3IIDA 5AILA 1BLLE 2C6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH4 A;  3FVL A;  2XEF A;  4X8I A;  1CG2 A;  1F57 A;  3SIH A;  3SII A;  4DUK A;  2OR4 A;  4TWE A;  2CTB A;  4MHZ A;  1CPS A;  4X2T A;  1LOK A;  4OC5 A;  4ZX8 A;  3KHX A;  2BFR A;  3PBE A;  5CBM A;  1F2P A;  1JQG A;  3D67 A;  3L2N A;  4PXE A;  1LAM A;  2DX6 A;  4MCP A;  4JLL A;  4OME A;  4ZX9 A;  4OC0 A;  4W9Y A;  4RUH A;  2C6C A;  2ACF A;  1PCA A;  5ELY A;  3GQO A;  2ZOG A;  1AYE A;  3EKE A;  3D68 A;  2GRE A;  1ZG7 A;  2IJZ A;  2FAV A;  3SJE A;  2NYQ A;  4ETJ A;  2J9A A;  4R76 A;  1M4L A;  2PJA A;  3D7D A;  2ZEL A;  4IK2 A;  2O53 A;  3S9L A;  5LYI A;  2BFQ A;  4ABK A;  2ZEH A;  2HB6 A;  1CX8 A;  4FBE A;  1ZR3 A;  4EWT A;  3EJG A;  4A94 A;  7CPA A;  5JH9 A;  3DLJ A;  3B7I A;  2HC9 A;  4CPA A;  4MHY A;  3IWW A;  2PE3 A;  1CP7 A;  3VH9 A;  3CPX A;  2O4H A;  1VGY A;  2AFC A;  3IC1 A;  1NSA A;  3V2B A;  3IIF A;  2V77 A;  3SI0 A;  3FH4 A;  4FWU A;  3EWR A;  1ARM A;  1BAV A;  4OKO A;  4MXU A;  5J1Q A;  4UEZ A;  3ISZ A;  2I3C A;  2QYV A;  4GM5 A;  1YSJ A;  3GPQ A;  3JZT A;  3IO1 A;  5LRG A;  1HDQ A;  2AFS A;  3PB9 X;  4NFR A;  1CP6 A;  4BD9 A;  2AFW A;  3KR4 A;  5F09 A;  3N5F A;  4GVV A;  2PIZ A;  3B3C A;  3GQE A;  1VIX A;  3LWU A;  5LYD A;  1TKH A;  4R6T A;  3VFQ A;  3NFZ A;  2JBJ A;  3B35 A;  3LMS A;  3K2K A;  3IJ3 A;  3KQZ A;  5I4M A;  3RAM A;  4UML A;  3IFE A;  4J5S A;  4MMO A;  3EJF A;  1H8L A;  3PFO A;  1QQ9 A;  1YLO A;  3PB6 X;  4J5R A;  3CPA A;  2V8D A;  1TKJ A;  3QNV A;  3BI0 A;  1LCP A;  4KSI A;  1TY8 A;  3IEH A;  3SIG A;  2Q51 A;  3IIB A;  5D29 A;  2FG1 A;  3D7F A;  2XEJ A;  2PCU A;  4WJB A;  4OID A;  4PXD A;  4P4E A;  1QMU A;  2ZEP A;  3GPO A;  2FXK A;  4OC1 A;  3D4U A;  3ISX A;  5E3B A;  4ZY0 A;  2F8H A;  1IGB A;  2WZN A;  2CTC A;  3SIJ A;  5LRJ A;  3D7H A;  3K9T A;  2V8G A;  3B3V A;  3CT9 A;  1HJZ A;  3I1U A;  2EEE A;  4YU9 A;  1R43 A;  1FNO A;  4D86 A;  4X3R A;  2XEG A;  3S9M A;  3BHX A;  1CPX A;  2ZEO A;  4KYB A;  2PJ3 A;  3EWP A;  1CBX A;  5LYF A;  3MN8 A;  2PVW A;  2OOT A;  2DEA A;  4A39 A;  5DUS A;  1ELL P;  2ZEG A;  1Y0R A;  4O23 A;  4NJR A;  4P4F A;  4EFD A;  1ZLH A;  4ABL A;  4FAI A;  3H8E A;  2VRI A;  2BO9 A;  1XRY A;  4JYW A;  2L8R A;  3KGQ A;  2JBK A;  1XJO A;  1LAP A;  2F7V A;  3WT4 A;  3GUX A;  2EK9 A;  1DTD A;  1OBR A;  3FMC A;  2X47 A;  1R3N A;  4OC2 A;  4NGQ A;  3PBB A;  3B2Y A;  3PB8 X;  4OIW A;  1PYT B;  3VAT A;  1Q7L A;  2NSM A;  4ESS A;  3KAS A;  3KZW A;  3T8W A;  3SI1 A;  2C6G A;  3FX6 A;  3PB4 X;  2EWB A;  5THW A;  3BXM A;  3V7Z A;  4ZI6 A;  1FT7 A;  4LQG A;  5CPA A;  2ANP A;  3KL9 A;  1HDU A;  4JGK A;  5HVF A;  5FSX A;  3RBU A;  3VAR A;  1XBU A;  2XEI A;  2ZOF A;  4NGN A;  3SJX A;  4ONW A;  1RTQ A;  3KR5 A;  4F8Z A;  3Q71 A;  1LAN A;  4K0C A;  2AFM A;  3GB0 A;  3NA6 A;  3Q6Z A;  3FEE A;  1BPM A;  2PJB A;  4P44 A;  4UIB A;  5CB5 A;  4NGS A;  4NGT A;  2PVV A;  3NH8 A;  4DYO A;  2ZEM A;  3CDX A;  5JM6 A;  1BPN A;  5CB3 A;  4MCR A;  3MRU A;  4IAV A;  3PB7 X;  1NJR A;  1TF8 A;  3PFE A;  4TU0 A;  5FSV A;  2ZEF A;  4ZY2 A;  4TNU A;  4A38 A;  1IY7 A;  4R7M A;  5K8O A;  2PRQ A;  2RB7 A;  5FSZ A;  3SJF A;  2PJC A;  2C1C A;  1ZG8 A;  2V8V A;  3B3S A;  8CPA A;  3H8G A;  4P4J A;  3B3W A;  2GLF A;  4PPZ A;  2AFX A;  1Y7E A;  1YW6 A;  2G9D A;  5LYL A;  4P4B A;  5K8P A;  3SJG A;  4NGR A;  2ZEN A;  2PJ1 A;  4F9U A;  1Z8L A;  5LRK A;  2ZEE A;  1XMB A;  1EE3 P;  4G1P A;  6CPA A;  2IMO A;  2WYR A;  2AFZ A;  5IB9 A;  2GU2 A;  3FF3 A;  4IHM A;  3HLP A;  4JVV A;  3DGV A;  2RFH A;  5FSU A;  5HVG A;  2PJ8 A;  4P10 A;  3GPG A;  4R8F A;  3FED A;  1VHO A;  4H2K A;  4OC4 A;  4PXB A;  1YW4 A;  4UEE A;  5JGF A;  4P6Y A;  1GYT A;  3B3T A;  3D66 A;  4NGP A;  2PJ5 A;  3GLJ A;  1ELM P;  3KI9 A;  1AMP A;  3V38 A;  1HEE A;  3KQX A;  2PJ4 A;  1VHE A;  4JZ0 A;  4A37 A;  2AFO A;  4MCS A;  5HVH A;  4IQY A;  4J5Q A;  4MHN A;  1VHU A;  5K8M A;  3V45 A;  1TXZ A;  2PJ9 A;  4Q7A A;  4ZYQ A;  3EWQ A;  2AFU A;  3RZA A;  3EW5 A;  3H8F A;  4ZY1 A;  2CIJ A;  3ETI A;  4YWY A;  2ABZ A;  2CF4 A;  2QVP A;  3WC7 A;  2Q43 A;  4MRI A;  4B6Z A;  5HXD A;  5FSY A;  4WWV A;  3PRT A;  3S9N A;  3HUV A;  2JEW A;  5DS0 A;  5D8N A;  3TX8 A;  4JCA A;  1TKF A;  2BOA A;  2QJ8 A;  4GVW A;  5HIH A;  2GLJ A;  4NGM A;  4F9V A;  1KWM A;  1ZG9 A;  4OP4 A;  2XD7 A;  4OC3 A;  3BI1 A;  1Z2L A;  5CMS A;  3SI2 A;  3KHZ A;  2PJ2 A;  3JRU A;  3TC8 A;  1TF9 A;  2PJ0 A;  2POK A;  4P4D A;  1Z5R A;  4PXC A;  4MCQ A;  2Q4Z A;  4Z65 A;  1SPV A;  3FJU A;  4MHP A;  4GUA A;  1ZLI A;  4PQA A;  4FUU A;  2PIY A;  2IQ6 A;  1DE4 C;  1UWY A;  1F2O A;  4P45 A;  3EWO A;  3PEI A;  2PJ6 A;  3WC5 A;  4EME A;  2LGR A;  4ETK A;  1TXR A;  1XFO A;  3WC6 A;  3FEC A;  4K3N A;  1YME A;  1YD9 A;  2EK8 A;  4UEF A;  4DJL A;  1ARL A;  1ZR5 A;  4AXV A;  2VL1 A;  5K8N A;  1Y0Y A;  2PJ7 A;  3WAB A;  1LFW A;  3D7G A;  2FVG A;  4UF4 A;  4UIA A;  4J4Z A;  2V8H A;  3NH5 A;  4NJQ A;  2BCO A;  2ZED A;  5HOL A;  4P4I A;  3IID A;  5AIL A;  1BLL E;  2C6P A; 
#chains in the Genus database with same CATH topology
 4XPK A;  4B10 A;  4QB9 A;  3IWG A;  3DNS A;  3NH4 A;  4U5Y A;  3FVL A;  2XEF A;  4AG9 A;  4X8I A;  1AUG A;  1CG2 A;  2CNM A;  2HV2 A;  1F57 A;  3SIH A;  3SII A;  4UA3 A;  4DUK A;  2BSW A;  2OR4 A;  2WPW A;  4TWE A;  3TT2 A;  1CJW A;  2CTB A;  4MHZ A;  3EFA A;  1CPS A;  4Y49 B;  4X2T A;  1LOK A;  2PDO A;  4OC5 A;  4J3G A;  4ZX8 A;  3KHX A;  4B5P B;  2EVN A;  4RI1 A;  2BFR A;  3PBE A;  1Z4R A;  5CBM A;  2I00 A;  1F2P A;  1JQG A;  3D67 A;  3L2N A;  4IUS A;  1LAM A;  2DX6 A;  4PXE A;  4MCP A;  4JLL A;  1XEB A;  3EO4 A;  4ZX9 A;  4OAE A;  4OC0 A;  4OME A;  5H86 A;  4W9Y A;  4RUH A;  2ATR A;  1N71 A;  2C6C A;  4R3L A;  2ACF A;  1PCA A;  4X5K A;  5ELY A;  3R9G A;  5A28 A;  3GQO A;  1IIC A;  2ZOG A;  4ORF A;  4CYQ A;  5HMN A;  2Z11 A;  3V8I A;  1AYE A;  3EKE A;  3D68 A;  4KOY A;  2GRE A;  2B5G B;  2JLM A;  3OWC A;  4M6G A;  4MFQ A;  1XMT A;  1ZG7 A;  4UFV A;  4AVA A;  2IJZ A;  3R96 A;  2FAV A;  1KUX A;  4Q36 A;  2NYQ A;  3SJE A;  4E8O A;  3QB8 A;  4JD6 A;  1ON0 A;  4A95 A;  2Z0Z A;  4ETJ A;  2J9A A;  4R76 A;  1M4L A;  2PJA A;  3D7D A;  2ZEL A;  4IK2 A;  2O53 A;  2RC4 A;  3S9L A;  5LYI A;  1KUV A;  2BFQ A;  4ABK A;  3CXQ A;  4NF1 A;  2ZEH A;  2HB6 A;  3H5Z A;  2WCT A;  1CX8 A;  4FBE A;  1QSO A;  1ZR3 A;  4UCM A;  3EJG A;  3MGD A;  4EWT A;  3W91 A;  2DPS A;  4A94 A;  4CAW A;  1NMT A;  1YX0 A;  7CPA A;  5JH9 A;  3DLJ A;  2R8V A;  1MJB A;  2Q4V A;  2HC9 A;  3B7I A;  4UWJ A;  4A32 A;  4CPA A;  4KUA A;  5F48 A;  3IWE A;  4M6I A;  4MHY A;  3IWW A;  2PE3 A;  1CP7 A;  3VH9 A;  2Z3L A;  3CPX A;  2O4H A;  1VGY A;  2AFC A;  5A27 A;  4ONU A;  2ZXV A;  5G22 A;  4ZBG A;  1IOF A;  3IC1 A;  1NSA A;  3V2B A;  3IIF A;  2V77 A;  4YGO A;  3SI0 A;  4BIN A;  3FRM A;  3FH4 A;  2KCW A;  3E0K A;  4FWU A;  4XNH C;  4CYO A;  3EWR A;  5F47 A;  1ARM A;  4PSW A;  1BAV A;  4JXQ A;  4OKO A;  2B4D B;  2JDD A;  4MXU A;  1J4J A;  4PV6 A;  4UEZ A;  5J1Q A;  2PRB A;  2ARH A;  3TCV A;  3ISZ A;  4MFJ A;  4DNC A;  3NE7 A;  2I3C A;  2QYV A;  2J8R A;  4GM5 A;  1YSJ A;  3GPQ A;  3JZT A;  3IO1 A;  4L8A A;  1MJA A;  3W6X A;  1XE4 A;  2YNC A;  5LRG A;  1HDQ A;  2ZW6 A;  3EC4 A;  4MY3 A;  2AFS A;  3PB9 X;  3C26 A;  4UFW A;  4NFR A;  1CP6 A;  4BD9 A;  2AFW A;  3KR4 A;  1YGH A;  5F09 A;  3N5F A;  4GVV A;  2PIZ A;  5AGE A;  2D4P A;  3B3C A;  3GQE A;  4E0A A;  1VIX A;  3LWU A;  5LYD A;  3TO6 A;  4CGN A;  1TKH A;  2FSR A;  3G8W A;  4KZT A;  4R6T A;  3VFQ A;  2REE A;  3CXS A;  3NFZ A;  4C7I A;  4CS0 B;  1M1D A;  5EC4 A;  2JBJ A;  2R1I A;  2CXA A;  3B35 A;  3LMS A;  3K2K A;  3K9U A;  5AG4 A;  3IJ3 A;  3KQZ A;  2AJ6 A;  1M44 A;  2JZE A;  2FIA A;  1XIX A;  5I4M A;  4CRZ B;  4KOT A;  3RAM A;  4BMH A;  2YNC C;  2Z3P A;  2JZF A;  4UML A;  3CXP A;  2QEC A;  3IFE A;  2F5I A;  4J5S A;  2D4O A;  3GYA A;  4MMO A;  4XNH B;  3EJF A;  1H8L A;  3PFO A;  1QQ9 A;  1Y7R A;  1YLO A;  3RO0 A;  3PB6 X;  4J5R A;  3CPA A;  2V8D A;  2VI7 A;  1WWZ A;  1TKJ A;  2I79 A;  1S5K A;  3D2P A;  3QNV A;  3CZX A;  3D8P A;  1QSR A;  3LOD A;  2BL1 A;  3BI0 A;  1LCP A;  4KSI A;  1TY8 A;  5HH1 A;  3IEH A;  3SIG A;  2Q51 A;  3D2M A;  3IIB A;  5D29 A;  2FG1 A;  3D7F A;  2XEJ A;  4MJ8 A;  2PCU A;  3FBU A;  4WJB A;  4OID A;  4U9Y A;  2YND A;  4PXD A;  1Y9W A;  2IL4 A;  3TE4 A;  4P4E A;  1QMU A;  2ZEP A;  3GPO A;  3JTK A;  4UCN A;  2FXK A;  3IU1 A;  3D4U A;  4OC1 A;  1P0H A;  5I0C A;  3ISX A;  5E3B A;  4ZY0 A;  2F8H A;  2G3T A;  4KUB A;  5JPH A;  1QSN A;  2Q04 A;  1IGB A;  2Q0Y A;  2WZN A;  4KVO E;  4C7H A;  3BLN A;  1Q2C A;  3IU2 A;  2CTC A;  5KTD A;  3SIJ A;  1SQH A;  2OZH A;  2OZU A;  5LRJ A;  1S60 A;  2R98 A;  2DXQ A;  3D7H A;  3K9T A;  4XPD C;  2V8G A;  3B3V A;  3CT9 A;  1HJZ A;  3I1U A;  2EEE A;  4HKF A;  4YU9 A;  3A9L A;  1M4G A;  4AB7 A;  2VQY A;  1R43 A;  2B3U A;  5IX3 A;  4KOW A;  1FNO A;  4D86 A;  4PSX A;  4X3R A;  2XEG A;  3S9M A;  4CGO A;  4R87 A;  4F0Y A;  3BHX A;  3VWE A;  4Q38 A;  1CPX A;  5DWN A;  2RNK A;  2ZEO A;  4KOU A;  1Q2Y A;  3G3S A;  4KYB A;  2PJ3 A;  1KUY A;  3EWP A;  3P2H A;  4A31 A;  1CBX A;  5LYF A;  4LUA A;  5ISV A;  3MN8 A;  2PVW A;  2OOT A;  2DEA A;  4LQ6 A;  4A39 A;  5DUS A;  1ELL P;  4LX9 A;  2ZEG A;  5EMI A;  1Y0R A;  3T90 A;  4O23 A;  4NJR A;  5JQ4 A;  4P4F A;  4R3K A;  1ZLH A;  2Z3O A;  3EXN A;  4ABL A;  4RN7 A;  4EFD A;  2P0W A;  3H8E A;  4FAI A;  2VRI A;  2BO9 A;  4M85 A;  1XRY A;  4JYW A;  2L8R A;  3KGQ A;  4OAD A;  4B14 A;  2JBK A;  1XJO A;  1LAP A;  2F7V A;  3RNZ A;  1S7F A;  2JDC A;  4KSA A;  3ZZI A;  1OZP A;  2G0B A;  2GE3 A;  3GUX A;  3WT4 A;  2EK9 A;  4AVC A;  4AVB A;  3FNC A;  4JJX A;  1DTD A;  1OBR A;  1Z8X A;  2X47 A;  3FMC A;  1R3N A;  1XOV A;  2Q4Y A;  4M3S A;  1YQE A;  4NGQ A;  3PBB A;  4OC2 A;  1M4D A;  1X10 A;  3B2Y A;  3PB8 X;  4OIW A;  1PYT B;  2BUE A;  2Q44 A;  4CAF A;  3VAT A;  4B13 A;  4XPD B;  1Q7L A;  2NSM A;  4C2Z A;  4ESS A;  2B3V A;  3KAS A;  3KZW A;  3T8W A;  4JXR A;  3SI1 A;  2C6G A;  2WSA A;  3FX6 A;  3PB4 X;  3F5B A;  2EWB A;  5THW A;  4E2A A;  3BXM A;  3V7Z A;  5C88 A;  1U6M A;  4ZI6 A;  3GKR A;  3TTH A;  4F6A A;  1FT7 A;  4LQG A;  5CPA A;  4BBH A;  2ANP A;  1YLE A;  3KL9 A;  4OLL A;  2Q7B A;  5BWA B;  3DR8 A;  1HDU A;  4JGK A;  3LAC A;  5AG6 A;  5HVF A;  2A4N A;  3SHP A;  4CRY B;  4MHD A;  2CNT A;  2Z3M A;  3FYN A;  5FSX A;  3RBU A;  1RO5 A;  2KQV A;  4FD7 A;  2Y0M A;  3TO7 A;  3VAR A;  1XBU A;  2XEI A;  2ZOF A;  1IYL A;  1S7K A;  4FD4 A;  4NGN A;  3SJX A;  4ONW A;  1RTQ A;  3KR5 A;  4F8Z A;  3Q71 A;  1LAN A;  2B4B A;  3JUW A;  4C2X A;  2DF5 A;  4K0C A;  4CAE A;  4CYP A;  5J8C A;  1YVK A;  3QAY A;  3R1K A;  2AFM A;  3GB0 A;  5AG5 A;  1KZF A;  3NA6 A;  3Q6Z A;  3VWD A;  4B5P A;  1Z8T A;  2NMT A;  1BPM A;  1IB1 E;  2PJB A;  3FEE A;  4KOR A;  4P44 A;  4UFX A;  4UIB A;  3R95 A;  5CB5 A;  4NGS A;  4NGT A;  2PVV A;  3NH8 A;  4DYO A;  3GIU A;  2ZEM A;  4NEX A;  3CDX A;  2CY2 A;  3EY5 A;  5JM6 A;  4I49 A;  1BPN A;  5CB3 A;  1NE9 A;  4MCR A;  3MRU A;  4IAV A;  5DWM A;  3PB7 X;  2OZG A;  1CM0 A;  1NJR A;  1S3Z A;  4GS4 A;  1TF8 A;  5GCN A;  3S6K A;  2Z3K A;  2P6G A;  3PFE A;  1IOI A;  1IID A;  4TU0 A;  5FSV A;  2ZEF A;  4ZY2 A;  4TNU A;  4A38 A;  1IY7 A;  1I12 A;  4UBR A;  4R7M A;  3F0A A;  5K8O A;  1YK3 A;  4GXH A;  2PRQ A;  3TOA A;  5KTA A;  2RB7 A;  3F8K A;  5FSZ A;  3SJF A;  4NCZ A;  2PJC A;  4MFK A;  2C1C A;  1ZG8 A;  2V8V A;  4MBU A;  2YGW A;  3B3S A;  8CPA A;  3H8G A;  4P4J A;  3B3W A;  4KOS A;  4CYN A;  2EO8 A;  2GLF A;  2FS5 A;  2Z10 A;  4MFP A;  4PPZ A;  3I9S A;  1R57 A;  2AFX A;  2FIW A;  4QVT A;  4YRH A;  1Y7E A;  1YW6 A;  2G9D A;  4KVX A;  2PR1 A;  1ZO0 A;  5LYL A;  4P4B A;  1GHE A;  4H89 A;  1FY7 A;  5K8P A;  3SJG A;  2GAN A;  2ZEN A;  3FB3 A;  4NGR A;  2PJ1 A;  4F9U A;  1Z8L A;  1A2Z A;  5LRK A;  1XMB A;  2O28 A;  2VBQ A;  1EE3 P;  2ZEE A;  3R9F A;  4C2Y A;  4G1P A;  2VXK A;  6CPA A;  3I3G A;  4UWI A;  3ZJ0 A;  2IMO A;  2X7B A;  2WYR A;  2AFZ A;  5IB9 A;  4NXY A;  2GU2 A;  3FF3 A;  4IHM A;  4II9 A;  1PU9 A;  4KS9 A;  3HLP A;  4JVV A;  3DGV A;  5FSU A;  2RFH A;  4QUS A;  3TO9 A;  5HVG A;  2PJ8 A;  4P10 A;  3RYO A;  3GPG A;  1VHS A;  5G20 A;  2DPT A;  4R8F A;  4B12 A;  2J8N A;  4L89 A;  3FED A;  1VHO A;  4H2K A;  4OC4 A;  4PXB A;  1VKC A;  2Z3N A;  1YW4 A;  4JLY A;  4MFL A;  4UEE A;  5JGF A;  3SXN A;  1I21 A;  2PQ8 A;  4P6Y A;  1GYT A;  3B3T A;  4KOV A;  2WPX A;  1IYK A;  3D66 A;  4H6U A;  4NGP A;  2PJ5 A;  2PC1 A;  2ZW7 A;  1UFH A;  3PZJ A;  3GLJ A;  4AG7 A;  3PGP A;  5C82 A;  4ZGY B;  1ELM P;  2EUI A;  3KI9 A;  4FD6 A;  1AMP A;  2QIR A;  3V38 A;  2PR8 A;  1HEE A;  3KQX A;  1L0C A;  2PJ4 A;  3D3S A;  5IB0 A;  1VHE A;  2K5T A;  2ODF A;  4JZ0 A;  4A37 A;  3DSB A;  2AFO A;  4MCS A;  5CNP A;  4IQY A;  1YR0 A;  5HVH A;  1I1D A;  1Z9U A;  2AE6 A;  4J5Q A;  4YFJ A;  1LRZ A;  4MHN A;  1QST A;  3UY5 A;  2FCK A;  4HNY B;  1VHU A;  5K8M A;  3V45 A;  1TXZ A;  2PJ9 A;  4Q7A A;  4ZYQ A;  3EWQ A;  2AFU A;  4H6Z A;  5EBV A;  3RZA A;  3EW5 A;  3H8F A;  4ZY1 A;  1TIQ A;  2CIJ A;  3ETI A;  4YWY A;  4M6H A;  3KKW A;  3R9E A;  2ABZ A;  2CF4 A;  2QVP A;  2B58 A;  3WC7 A;  4A33 A;  2Q43 A;  4MRI A;  4B6Z A;  4CGM A;  5HXD A;  1QSM A;  5FSY A;  4C68 A;  3NE8 A;  4WWV A;  3PRT A;  3S9N A;  3WR7 A;  1V0C A;  2JEV A;  3HUV A;  2JEW A;  5E96 A;  2ZW4 A;  3P2F A;  3W6S A;  3S6G A;  3PP9 A;  1K4J A;  5DS0 A;  4EVY A;  5D8N A;  2WUU A;  3TX8 A;  4IF5 A;  4JCA A;  1B87 A;  1BO4 A;  1TKF A;  2HUZ A;  2BOA A;  3N7Z A;  2QJ8 A;  4GVW A;  2H5M A;  2OB0 A;  4PK3 A;  4F0X A;  5HIH A;  2GLJ A;  4NGM A;  4F9V A;  1XF8 A;  5FVJ A;  1KWM A;  1MK4 A;  2GIV A;  4XPL A;  3S6H A;  3FIX A;  1ZG9 A;  4OP4 A;  2FL4 A;  4CGL A;  4PK2 A;  2XD7 A;  4OC3 A;  3DR6 A;  3BI1 A;  1Z2L A;  3BJ7 A;  1YVO A;  3H4Q A;  2JZD A;  1S7N A;  5F46 A;  2HQY A;  2Q7S A;  4MY0 A;  5CMS A;  3TFY A;  3SI2 A;  1MJ9 A;  3TOB A;  3KHZ A;  2PJ2 A;  4CAV A;  1S7L A;  3JRU A;  3TC8 A;  2ZPA A;  1TF9 A;  2VZY A;  4HPS A;  1RXT A;  2PJ0 A;  2FT0 A;  2YNE A;  2FXF A;  4FD5 A;  2POK A;  5H84 A;  4P4D A;  2BEI A;  4HNW B;  5IV0 A;  4KLV A;  4U9Z A;  1Z5R A;  4PXC A;  4RS2 A;  4MCQ A;  4JWP A;  1Z4E A;  2CNS A;  2Q4Z A;  2B5G A;  4Z65 A;  1SPV A;  1WK4 A;  3FJU A;  4MHP A;  5F49 A;  4GUA A;  1ZLI A;  2VEZ A;  4PQA A;  4QC6 A;  3BJ8 A;  4FUU A;  2PIY A;  2IQ6 A;  1DE4 C;  1UWY A;  2EBJ A;  1F2O A;  4Y49 C;  1JWQ A;  3JVN A;  4MI4 A;  4P45 A;  3EWO A;  1X12 A;  1PUA A;  2C27 A;  3T9Y A;  3PEI A;  2PJ6 A;  3WC5 A;  4EME A;  4B11 A;  2LGR A;  4ETK A;  1TXR A;  1XFO A;  3FXT A;  4K30 A;  3FEC A;  3WC6 A;  4K3N A;  1Q2D A;  2GFQ A;  2P6E A;  1YME A;  1YD9 A;  3IGR A;  3DDD A;  4R57 A;  3SXO A;  2EK8 A;  2FE7 A;  2P6F A;  4UEF A;  4DJL A;  4CAX A;  4QBJ A;  1ARL A;  1ZR5 A;  4B5O A;  2J8M A;  5G21 A;  4AXV A;  2VL1 A;  2ZW5 A;  2W2G A;  1Y0Y A;  3GY9 A;  5K8N A;  3QAH A;  1YRE A;  2PJ7 A;  1LFW A;  3D7G A;  4R9M A;  3WAB A;  2FVG A;  4CGP A;  5KTC A;  1IU8 A;  2OH1 A;  3S6F A;  4HNX B;  1P4N A;  4KLW A;  4MFZ A;  4UCP A;  4UF4 A;  4A30 A;  4KOX A;  4J4Z A;  1BOB A;  2V8H A;  4KVM E;  4UIA A;  3LD2 A;  3NH5 A;  4NJQ A;  1NSL A;  2BCO A;  5J8F A;  2ZED A;  2VZZ A;  1Z8W A;  5HOL A;  4KSF A;  4P4I A;  3IID A;  2R7H A;  5AIL A;  1BLL E;  4NSQ A;  5G1Z A;  1M4I A;  4A2Z A;  2C6P A;  2PSW A;  2QML A;  2REF A;  2OU2 A;  2B4D A;  5AG7 A;  3B8G A;  1Y9K A;  1B6B A;  2G3A A; 
#chains in the Genus database with same CATH homology
 3NH4 A;  3FVL A;  2XEF A;  4X8I A;  1CG2 A;  1F57 A;  3SIH A;  3SII A;  4DUK A;  2OR4 A;  4TWE A;  2CTB A;  4MHZ A;  1CPS A;  4X2T A;  1LOK A;  4OC5 A;  4ZX8 A;  3KHX A;  2BFR A;  3PBE A;  5CBM A;  1F2P A;  1JQG A;  3D67 A;  3L2N A;  4PXE A;  1LAM A;  2DX6 A;  4MCP A;  4JLL A;  4OME A;  4ZX9 A;  4OC0 A;  4W9Y A;  4RUH A;  2C6C A;  2ACF A;  1PCA A;  5ELY A;  3GQO A;  2ZOG A;  1AYE A;  3EKE A;  3D68 A;  2GRE A;  1ZG7 A;  2IJZ A;  2FAV A;  3SJE A;  2NYQ A;  4ETJ A;  2J9A A;  4R76 A;  1M4L A;  2PJA A;  3D7D A;  2ZEL A;  4IK2 A;  2O53 A;  3S9L A;  5LYI A;  2BFQ A;  4ABK A;  2ZEH A;  2HB6 A;  1CX8 A;  4FBE A;  1ZR3 A;  4EWT A;  3EJG A;  4A94 A;  7CPA A;  5JH9 A;  3DLJ A;  3B7I A;  2HC9 A;  4CPA A;  4MHY A;  3IWW A;  2PE3 A;  1CP7 A;  3VH9 A;  3CPX A;  2O4H A;  1VGY A;  2AFC A;  3IC1 A;  1NSA A;  3V2B A;  3IIF A;  2V77 A;  3SI0 A;  3FH4 A;  4FWU A;  3EWR A;  1ARM A;  1BAV A;  4OKO A;  4MXU A;  5J1Q A;  4UEZ A;  3ISZ A;  2I3C A;  2QYV A;  4GM5 A;  1YSJ A;  3GPQ A;  3JZT A;  3IO1 A;  5LRG A;  1HDQ A;  2AFS A;  3PB9 X;  4NFR A;  1CP6 A;  4BD9 A;  2AFW A;  3KR4 A;  5F09 A;  3N5F A;  4GVV A;  2PIZ A;  3B3C A;  3GQE A;  1VIX A;  3LWU A;  5LYD A;  1TKH A;  4R6T A;  3VFQ A;  3NFZ A;  2JBJ A;  3B35 A;  3LMS A;  3K2K A;  3IJ3 A;  3KQZ A;  5I4M A;  3RAM A;  4UML A;  3IFE A;  4J5S A;  4MMO A;  3EJF A;  1H8L A;  3PFO A;  1QQ9 A;  1YLO A;  3PB6 X;  4J5R A;  3CPA A;  2V8D A;  1TKJ A;  3QNV A;  3BI0 A;  1LCP A;  4KSI A;  1TY8 A;  3IEH A;  3SIG A;  2Q51 A;  3IIB A;  5D29 A;  2FG1 A;  3D7F A;  2XEJ A;  2PCU A;  4WJB A;  4OID A;  4PXD A;  4P4E A;  1QMU A;  2ZEP A;  3GPO A;  2FXK A;  4OC1 A;  3D4U A;  3ISX A;  5E3B A;  4ZY0 A;  2F8H A;  1IGB A;  2WZN A;  2CTC A;  3SIJ A;  5LRJ A;  3D7H A;  3K9T A;  2V8G A;  3B3V A;  3CT9 A;  1HJZ A;  3I1U A;  2EEE A;  4YU9 A;  1R43 A;  1FNO A;  4D86 A;  4X3R A;  2XEG A;  3S9M A;  3BHX A;  1CPX A;  2ZEO A;  4KYB A;  2PJ3 A;  3EWP A;  1CBX A;  5LYF A;  3MN8 A;  2PVW A;  2OOT A;  2DEA A;  4A39 A;  5DUS A;  1ELL P;  2ZEG A;  1Y0R A;  4O23 A;  4NJR A;  4P4F A;  4EFD A;  1ZLH A;  4ABL A;  4FAI A;  3H8E A;  2VRI A;  2BO9 A;  1XRY A;  4JYW A;  2L8R A;  3KGQ A;  2JBK A;  1XJO A;  1LAP A;  2F7V A;  3WT4 A;  3GUX A;  2EK9 A;  1DTD A;  1OBR A;  3FMC A;  2X47 A;  1R3N A;  4OC2 A;  4NGQ A;  3PBB A;  3B2Y A;  3PB8 X;  4OIW A;  1PYT B;  3VAT A;  1Q7L A;  2NSM A;  4ESS A;  3KAS A;  3KZW A;  3T8W A;  3SI1 A;  2C6G A;  3FX6 A;  3PB4 X;  2EWB A;  5THW A;  3BXM A;  3V7Z A;  4ZI6 A;  1FT7 A;  4LQG A;  5CPA A;  2ANP A;  3KL9 A;  1HDU A;  4JGK A;  5HVF A;  5FSX A;  3RBU A;  3VAR A;  1XBU A;  2XEI A;  2ZOF A;  4NGN A;  3SJX A;  4ONW A;  1RTQ A;  3KR5 A;  4F8Z A;  3Q71 A;  1LAN A;  4K0C A;  2AFM A;  3GB0 A;  3NA6 A;  3Q6Z A;  3FEE A;  1BPM A;  2PJB A;  4P44 A;  4UIB A;  5CB5 A;  4NGS A;  4NGT A;  2PVV A;  3NH8 A;  4DYO A;  2ZEM A;  3CDX A;  5JM6 A;  1BPN A;  5CB3 A;  4MCR A;  3MRU A;  4IAV A;  3PB7 X;  1NJR A;  1TF8 A;  3PFE A;  4TU0 A;  5FSV A;  2ZEF A;  4ZY2 A;  4TNU A;  4A38 A;  1IY7 A;  4R7M A;  5K8O A;  2PRQ A;  2RB7 A;  5FSZ A;  3SJF A;  2PJC A;  2C1C A;  1ZG8 A;  2V8V A;  3B3S A;  8CPA A;  3H8G A;  4P4J A;  3B3W A;  2GLF A;  4PPZ A;  2AFX A;  1Y7E A;  1YW6 A;  2G9D A;  5LYL A;  4P4B A;  5K8P A;  3SJG A;  4NGR A;  2ZEN A;  2PJ1 A;  4F9U A;  1Z8L A;  5LRK A;  2ZEE A;  1XMB A;  1EE3 P;  4G1P A;  6CPA A;  2IMO A;  2WYR A;  2AFZ A;  5IB9 A;  2GU2 A;  3FF3 A;  4IHM A;  3HLP A;  4JVV A;  3DGV A;  2RFH A;  5FSU A;  5HVG A;  2PJ8 A;  4P10 A;  3GPG A;  4R8F A;  3FED A;  1VHO A;  4H2K A;  4OC4 A;  4PXB A;  1YW4 A;  4UEE A;  5JGF A;  4P6Y A;  1GYT A;  3B3T A;  3D66 A;  4NGP A;  2PJ5 A;  3GLJ A;  1ELM P;  3KI9 A;  1AMP A;  3V38 A;  1HEE A;  3KQX A;  2PJ4 A;  1VHE A;  4JZ0 A;  4A37 A;  2AFO A;  4MCS A;  5HVH A;  4IQY A;  4J5Q A;  4MHN A;  1VHU A;  5K8M A;  3V45 A;  1TXZ A;  2PJ9 A;  4Q7A A;  4ZYQ A;  3EWQ A;  2AFU A;  3RZA A;  3EW5 A;  3H8F A;  4ZY1 A;  2CIJ A;  3ETI A;  4YWY A;  2ABZ A;  2CF4 A;  2QVP A;  3WC7 A;  2Q43 A;  4MRI A;  4B6Z A;  5HXD A;  5FSY A;  4WWV A;  3PRT A;  3S9N A;  3HUV A;  2JEW A;  5DS0 A;  5D8N A;  3TX8 A;  4JCA A;  1TKF A;  2BOA A;  2QJ8 A;  4GVW A;  5HIH A;  2GLJ A;  4NGM A;  4F9V A;  1KWM A;  1ZG9 A;  4OP4 A;  2XD7 A;  4OC3 A;  3BI1 A;  1Z2L A;  5CMS A;  3SI2 A;  3KHZ A;  2PJ2 A;  3JRU A;  3TC8 A;  1TF9 A;  2PJ0 A;  2POK A;  4P4D A;  1Z5R A;  4PXC A;  4MCQ A;  2Q4Z A;  4Z65 A;  1SPV A;  3FJU A;  4MHP A;  4GUA A;  1ZLI A;  4PQA A;  4FUU A;  2PIY A;  2IQ6 A;  1DE4 C;  1UWY A;  1F2O A;  4P45 A;  3EWO A;  3PEI A;  2PJ6 A;  3WC5 A;  4EME A;  2LGR A;  4ETK A;  1TXR A;  1XFO A;  3WC6 A;  3FEC A;  4K3N A;  1YME A;  1YD9 A;  2EK8 A;  4UEF A;  4DJL A;  1ARL A;  1ZR5 A;  4AXV A;  2VL1 A;  5K8N A;  1Y0Y A;  2PJ7 A;  3WAB A;  1LFW A;  3D7G A;  2FVG A;  4UF4 A;  4UIA A;  4J4Z A;  2V8H A;  3NH5 A;  4NJQ A;  2BCO A;  2ZED A;  5HOL A;  4P4I A;  3IID A;  5AIL A;  1BLL E;  2C6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...