4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
2L8RA 5K8PA 5DUSA 5K8OA 4ETKA 2OOTA 4FWUA 2RB7A 4OIWA 1VHUA 3IIBA 1GYTA 1LANA 2O4HA 4YU9A 4KSIA 3V7ZA 2ZEDA 4Q7AA 4JLLA 1Z5RA 2J9AA 1AYEA 5K8MA 4UMLA 4A38A 1BPNA 4A39A 1BAVA 2PJ1A 3FX6A 3H8FA 5ELYA 1XBUA 1HDQA 2BFQA 3SIIA 2FXKA 3HUVA 1IY7A 3GPQA 3IIFA 1ZG9A 2C1CA 2PJAA 2BCOA 4H2KA 4TU0A 2XEIA 4G1PA 3EWPA 3EWQA 3DLJA 4FAIA 2HC9A 3EWOA 3FJUA 4YWYA 4J5SA 4WWVA 1FT7A 1KWMA 4NGSA 4P4FA 3D7HA 5JGFA 4IHMA 1M4LA 4OC4A 3EJGA 4K0CA 3Q71A 4R7MA 2ZEGA 3RAMA 5FSXA 2DEAA 2GLJA 1Y7EA 1Y0YA 4FBEA 2QYVA 4NJQA 2CTBA 4MCSA 4GUAA 3H8EA 2EK8A 3FVLA 1Z2LA 4PXEA 4OC5A 4NGQA 3N5FA 4JYWA 2V77A 1TXRA 3GB0A 3WC5A 3EWRA 3IO1A 3WC6A 3SJXA 1PCAA 4O23A 2HB6A 3LWUA 3S9NA 1HEEA 3NH5A 3TC8A 2FAVA 4JZ0A 2JBJA 2EWBA 4PPZA 1ZG7A 2PJ0A 4ZY1A 2PJ3A 5HVFA 1F57A 3B7IA 4NGTA 4ETJA 5LYIA 3PB4X 5HOLA 4MHZA 3SI2A 2EK9A 5CB3A 1QQ9A 3KI9A 1ARMA 3LMSA 4ZX8A 2ABZA 4R6TA 2GREA 3KR4A 3Q6ZA 3NH4A 3FECA 3T8WA 4GVWA 3SI0A 2V8DA 5THWA 1LFWA 1Y0RA 3SI1A 3PEIA 3PB8X 4Z65A 1VGYA 3ETIA 2JEWA 4OP4A 1ZLIA 4ZY2A 2AFOA 1RTQA 5I4MA 4J5RA 5CB5A 3VARA 1BLLE 3V45A 2C6GA 2PVVA 3IWWA 5JM6A 2O53A 4DYOA 5LYDA 4OC0A 1Q7LA 1VIXA 3VH9A 1IGBA 1XJOA 4KYBA 3GUXA 3CDXA 3FMCA 2PJ9A 4NGNA 4EMEA 4MXUA 5LRKA 3ISXA 3PB6X 3KQZA 2X47A 1ZG8A 1R3NA 2ZEPA 1NSAA 4ZY0A 4A37A 4F9VA 4FUUA 4PXCA 2Q51A 5CBMA 3SIHA 4P10A 4OC2A 2CIJA 1CX8A 1H8LA 2PCUA 2QJ8A 4P4BA 1ZR5A 3IEHA 5J1QA 4OIDA 2BOAA 4ZX9A 3MRUA 4MHNA 3IJ3A 3BXMA 4P4JA 3VATA 1FNOA 3IIDA 3SIJA 1DE4C 4TWEA 4IQYA 8CPAA 3JZTA 3KR5A 3ISZA 1BPMA 4JVVA 3NH8A 1HJZA 2ACFA 2POKA 2VL1A 4OC3A 3PB7X 3DGVA 2FVGA 2ZEOA 4W9YA 4MHYA 4OKOA 3KGQA 1NJRA 5IB9A 3BHXA 1ZLHA 4ABLA 1LAMA 3FEDA 2PVWA 2ZEEA 3PB9X 2CF4A 2GU2A 3D7DA 3CPAA 3GPGA 2C6CA 3FH4A 3KL9A 2AFUA 4P4EA 4NFRA 4UIAA 3NA6A 1LCPA 3VFQA 2RFHA 1YLOA 5HVGA 3PBEA 1XFOA 3GPOA 4TNUA 4EWTA 2PIZA 3RZAA 4K3NA 3D7GA 1YW6A 3PBBA 2IQ6A 2NYQA 1QMUA 3GLJA 3B3SA 3B3CA 3JRUA 4GM5A 3CPXA 3B3TA 3I1UA 4P44A 3BI1A 2ZOFA 5HIHA 6CPAA 2ZENA 1CG2A 5AILA 1CBXA 4MCPA 2XD7A 3B2YA 4NGRA 3KASA 2CTCA 4IAVA 2EEEA 4MCRA 4UIBA 4ONWA 5FSYA 3HLPA 2NSMA 2PIYA 2PJBA 4ZYQA 4X8IA 1R43A 4PXBA 3SJEA 4X3RA 2LGRA 1CP6A 5JH9A 1CPXA 3WABA 2Q43A 3D66A 4MCQA 3NFZA 5LYLA 2F8HA 3D68A 4WJBA 2AFZA 4UEEA 2ZEHA 3V38A 4R8FA 2BO9A 2AFWA 2ZEMA 3PFEA 1YMEA 3GQOA 4P4DA 1SPVA 2PJCA 1ZR3A 4BD9A 3IC1A 2IMOA 5E3BA 3PRTA 2DX6A 1TKFA 2PJ4A 4P4IA 2C6PA 4ABKA 1YD9A 1Z8LA 3KHXA 2G9DA 2AFSA 3B3VA 4IK2A 4RUHA 4OMEA 3WC7A 5CPAA 2PJ2A 4LQGA 2PRQA 4DJLA 1ARLA 4MRIA 2IJZA 2PE3A 3FF3A 3SJFA 1YSJA 2FG1A 4R76A 4A94A 2PJ8A 2XEFA 3BI0A 3K2KA 3S9MA 3PFOA 3B3WA 5CMSA 4MHPA 4P45A 2QVPA 4ESSA 3SIGA 2WZNA 2XEGA 5FSUA 4X2TA 1XRYA 2AFCA 2ZELA 2Q4ZA 2WYRA 4DUKA 5FSVA 4J4ZA 4EFDA 4MMOA 1CP7A 5D29A 4F8ZA 3L2NA 4OC1A 1TXZA 5HVHA 1XMBA 1VHEA 3KHZA 4D86A 3KQXA 1PYTB 4UF4A 2ZEFA 4CPAA 4JGKA 2ZOGA 1TY8A 3S9LA 3V2BA 3RBUA 2I3CA 3MN8A 1VHOA 5LRGA 1JQGA 4ZI6A 1AMPA 3IFEA 3CT9A 1TF8A 3D67A 3EW5A 2F7VA 5LYFA 4AXVA 2PJ6A 3FEEA 3D4UA 3QNVA 1LOKA 5DS0A 3B35A 4NGPA 5F09A 2VRIA 4PXDA 2V8VA 3GQEA 5K8NA 4GVVA 4UEZA 1CPSA 5LRJA 5HXDA 2OR4A 1LAPA 2AFMA 1YW4A 2GLFA 4JCAA 3EJFA 2BFRA 2V8GA 4NGMA 1TF9A 4P6YA 1DTDA 1F2PA 2XEJA 2PJ5A 1ELLP 2PJ7A 3K9TA 5D8NA 1OBRA 3KZWA 3TX8A 4F9UA 5FSZA 1F2OA 4B6ZA 3SJGA 1TKJA 3WT4A 4J5QA 4NJRA 3H8GA 7CPAA 3EKEA 1ELMP 3D7FA 2V8HA 4PQAA 2AFXA 2ANPA 1HDUA 1UWYA 1TKHA 2JBKA 4UEFA 1EE3P
chains in the Genus database with same CATH superfamily
4JLYA 3FYNA 5IB0A 2L8RA 4CGPA 3GKRA 5IX3A 5K8PA 5DUSA 3FNCA 3TO7A 5K8OA 4MY3A 4ETKA 2OOTA 2JZEA 4FWUA 2RB7A 4OIWA 1VHUA 1IYLA 3IIBA 1GYTA 1LANA 2O4HA 5JPHA 2EVNA 2GFQA 4YU9A 4KSIA 3V7ZA 4X5KA 4UWIA 2VZYA 5KTAA 2VEZA 2ZEDA 2ZXVA 4Q7AA 4JLLA 1Z5RA 2J9AA 4B5PB 1AYEA 2G3TA 5K8MA 4UMLA 4E2AA 4A38A 2BL1A 1BPNA 5EMIA 4A39A 4ZGYB 1BAVA 2PJ1A 3FX6A 3H8FA 5ELYA 3K9UA 1XBUA 3RO0A 1HDQA 4BMHA 4UFXA 4A32A 1BOBA 2BFQA 3SIIA 4IUSA 2ZW6A 5A27A 2FXKA 3HUVA 1IY7A 4KSFA 3I9SA 3GPQA 4MFZA 2IL4A 3IIFA 1ZG9A 2C1CA 2PJAA 2BCOA 4H2KA 4TU0A 4XPDC 4ZBGA 2XEIA 4G1PA 3OWCA 4M6IA 3EWPA 2WCTA 2EO8A 3EWQA 1M4IA 4AVCA 3DLJA 4FAIA 2HC9A 3EWOA 1Z4EA 3FJUA 4PK2A 4YWYA 2B3VA 4QUSA 2VQYA 4J5SA 5G21A 4WWVA 2C27A 2Q4YA 1FT7A 1KWMA 5HMNA 4NGSA 4U9ZA 4P4FA 3D7HA 1KUXA 5JGFA 2WUUA 1M4LA 4IHMA 4OC4A 3EJGA 4K0CA 2P6GA 2JZDA 3Q71A 4PV6A 5CNPA 3C26A 4R7MA 4CRYB 2CNMA 2ZEGA 5DWNA 1S7FA 3RAMA 5A28A 3E0KA 5FSXA 4CYOA 2DEAA 2GLJA 1Y7EA 4KOYA 1Y0YA 4XNHC 4FBEA 2ZW7A 2QECA 2QYVA 1IOIA 4NJQA 1Z8WA 2CTBA 4MCSA 3RYOA 4GUAA 3S6KA 1S5KA 3H8EA 5EC4A 2QMLA 2EK8A 3IU1A 3FVLA 3JVNA 1Z2LA 4PXEA 4CGOA 4L89A 2ZPAA 4MY0A 2JDDA 2QIRA 2Q44A 3EFAA 1QSOA 4K30A 2FE7A 4NGQA 3N5FA 4OC5A 4AG9A 4JYWA 4R9MA 1NSLA 2V77A 3G3SA 4QVTA 5FVJA 2F5IA 3TO6A 4M6HA 3LODA 1TXRA 2PRBA 1ON0A 3GB0A 4CGMA 3WC5A 4MFKA 3FXTA 3EWRA 3IO1A 4CAFA 2B3UA 3A9LA 3WC6A 4A30A 3FIXA 3SJXA 1PCAA 2ZW5A 3ZJ0A 4C68A 2Z3MA 4O23A 4E8OA 3R95A 4XPDB 1YLEA 2HB6A 4B5PA 3LWUA 4UCPA 3S9NA 1BO4A 3MGDA 1HEEA 1YVOA 3NH5A 3TC8A 2FAVA 4JZ0A 2JBJA 2PR1A 2EWBA 1MK4A 1QSTA 4PPZA 1ZG7A 4JXRA 1I21A 2PJ0A 4ZY1A 2G3AA 2PJ3A 4YGOA 1F57A 1OZPA 1YR0A 3B7IA 4KUBA 5HVFA 4NGTA 3TOAA 4ETJA 4H6UA 5LYIA 4HNXB 3PB4X 5HOLA 4MHDA 4MHZA 2Q7BA 2Z3PA 3SI2A 1P4NA 2WPXA 4HNYB 2EK9A 5CB3A 2OZHA 4XPKA 1QQ9A 3KI9A 3RNZA 1ARMA 3LMSA 4ZX8A 1R57A 2ABZA 4R6TA 2Z11A 3N7ZA 2GREA 3KR4A 5AG5A 3Q6ZA 4RN7A 3VWDA 2FCKA 3NH4A 4XNHB 3FECA 3T8WA 4GVWA 2B5GB 3SI0A 2V8DA 5G1ZA 5THWA 4RI1A 3EY5A 1LFWA 1Y0RA 3SI1A 3PEIA 3PB8X 4RS2A 4Z65A 1VGYA 3ETIA 2JEWA 2DF5A 4PSWA 4OP4A 1ZLIA 4ZY2A 4GXHA 2AFOA 1RTQA 1RO5A 4B12A 4R57A 5I4MA 4J5RA 5CB5A 2ARHA 3VARA 3F0AA 5AGEA 5AG7A 1BLLE 4II9A 3V45A 2C6GA 3F8KA 2PVVA 3KKWA 3IWWA 5JM6A 4NSQA 2O53A 4CAXA 1I1DA 4DYOA 2B4DB 5LYDA 2J8RA 4OC0A 1Q7LA 2KCWA 3SXNA 3H4QA 2BSWA 1VIXA 5DWMA 3VH9A 1S7LA 1IGBA 2B4BA 1K4JA 1XJOA 4MFLA 5AG4A 4KYBA 3GUXA 3CDXA 1S60A 3WR7A 3FMCA 4KLVA 2PJ9A 4NGNA 2R7HA 4MXUA 4EMEA 4KLWA 1CM0A 1A2ZA 1SQHA 3ISXA 5LRKA 3PB6X 4FD5A 3F5BA 4FD6A 3KQZA 1YX0A 2VBQA 4C2ZA 4ONUA 3W6XA 2X47A 3DSBA 3NE7A 4E0AA 1ZG8A 3V8IA 5JQ4A 1R3NA 2PSWA 1XF8A 2ZEPA 4UCMA 1NSAA 4ZY0A 4A37A 4F9VA 2VI7A 4UFWA 4KVOE 4FUUA 2Y0MA 4PXCA 1S7NA 2P6FA 2B5GA 2Q51A 4OADA 1IICA 5CBMA 3SIHA 4M6GA 4P10A 1KZFA 4OC2A 4CAWA 2CIJA 1CX8A 1H8LA 1YQEA 2PCUA 2QJ8A 4P4BA 1ZR5A 1J4JA 4GS4A 4JD6A 3IEHA 5J1QA 4OIDA 2BOAA 2JEVA 4ZX9A 2OH1A 3CXQA 3IJ3A 3BXMA 2HV2A 3MRUA 1FNOA 2PC1A 4MHNA 3IIDA 3SIJA 1DE4C 4IF5A 4IQYA 4J3GA 4TWEA 8CPAA 2YGWA 3JZTA 3UY5A 3GYAA 3KR5A 3TO9A 1X10A 4B5OA 4PSXA 4CGLA 4DNCA 4C2XA 3ISZA 1BPMA 4JVVA 2G0BA 1XOVA 4Y49C 1IIDA 1QSMA 3D3SA 4EVYA 4QBJA 3NH8A 1HJZA 3SHPA 3QAHA 2FT0A 2ACFA 2POKA 4AVBA 2VL1A 4OC3A 3PB7X 3DGVA 2FVGA 2ZEOA 1VHSA 4LX9A 4MHYA 2ODFA 4W9YA 4OKOA 5G20A 3KGQA 1NJRA 5IB9A 2RC4A 1AUGA 1V0CA 2I79A 2VXKA 3BHXA 1ZLHA 2W2GA 4ABLA 5BWAB 5C88A 1S3ZA 1LAMA 1M44A 3FEDA 5H84A 2PVWA 2ZEEA 4KORA 3PB9X 4L8AA 2CF4A 4NCZA 2GU2A 3D7DA 3CPAA 3GPGA 2C6CA 2I00A 3DNSA 3FH4A 2BEIA 1KUVA 1RXTA 3KL9A 2DPTA 1UFHA 2AFUA 3FB3A 4P4EA 1B87A 3DR6A 1IOFA 4A31A 4B14A 4NFRA 1M1DA 4HKFA 2BUEA 3IWEA 4UIAA 4C7IA 3NA6A 1I12A 4MJ8A 1LCPA 3VFQA 4UA3A 2RFHA 2YNDA 1WWZA 1YLOA 4KOUA 5HVGA 3ZZIA 3PBEA 1XFOA 3GPOA 3P2FA 4MI4A 4TNUA 3PGPA 4EWTA 2PIZA 4YFJA 5KTDA 3RZAA 4K3NA 3D7GA 1YW6A 3NE8A 3PBBA 2IQ6A 2NYQA 4JJXA 4UCNA 4UFVA 4M3SA 1U6MA 1QMUA 2FXFA 3EO4A 3GLJA 4A33A 2HQYA 4A95A 2DPSA 3B3SA 4CYQA 1YVKA 2CXAA 2Z10A 3B3CA 3JRUA 3SXOA 5J8CA 5IV0A 4Y49B 2Q4VA 4GM5A 3GIUA 4HNWB 4CAEA 3CPXA 3B3TA 3I1UA 4P44A 3D8PA 1PU9A 4ORFA 3BI1A 2ZOFA 5HIHA 5GCNA 3FRMA 4P4JA 1Y9WA 6CPAA 2ZENA 3B8GA 1CG2A 5AILA 1QSNA 1CBXA 4KVXA 4QB9A 4MCPA 2XD7A 3B2YA 4NGRA 3T90A 3KASA 4CRZB 1YK3A 2Q04A 3R96A 2CTCA 4R87A 4LUAA 4IAVA 2EEEA 2Q0YA 3IWGA 4MCRA 1NMTA 4UIBA 4ONWA 3S6HA 5FSYA 2A4NA 3HLPA 2EBJA 2NSMA 2PIYA 3BLNA 1IYKA 3S6GA 1MJ9A 2K5TA 2PJBA 4F0XA 4ZYQA 4B10A 4X8IA 4JWPA 1R43A 4PXBA 3SJEA 4F6AA 2X7BA 4X3RA 2LGRA 1CP6A 3R9FA 5F49A 5JH9A 3D2MA 4CAVA 5HH1A 1Q2YA 2AE6A 1CPXA 3LACA 2Q43A 4H89A 3WABA 1Y7RA 3D66A 2Z0ZA 3NFZA 4MCQA 5LYLA 2F8HA 3D68A 4U9YA 2GIVA 2YNEA 2AFZA 4Q36A 4UEEA 4WJBA 2ZEHA 3V38A 4R8FA 2PQ8A 4YRHA 2BO9A 2AFWA 2ZEMA 1GHEA 3BJ8A 4HPSA 5E96A 3PFEA 3TT2A 1YMEA 5F46A 3GQOA 2R1IA 3QAYA 4P4DA 1SPVA 3S6FA 2PJCA 1ZR3A 4M85A 4BD9A 3IC1A 2IMOA 5E3BA 3PRTA 2R98A 2DX6A 1TKFA 2PJ4A 3P2HA 4P4IA 2C6PA 4ABKA 1YD9A 1Z8LA 3I3GA 3KHXA 2G9DA 4H6ZA 3TTHA 2AFSA 4KOWA 4B13A 1YGHA 3B3VA 4IK2A 4AB7A 4RUHA 4KVME 4OMEA 4UWJA 3WC7A 5CPAA 2PJ2A 4LQGA 1XEBA 1ZO0A 3R9EA 5KTCA 2PRQA 2REEA 2DXQA 2YNCC 3BJ7A 4DJLA 1ARLA 4MRIA 2IJZA 2PE3A 1S7KA 4NXYA 2Z3NA 3FF3A 2RNKA 1PUAA 3SJFA 1YSJA 3LD2A 2FG1A 4R76A 2J8MA 4A94A 3JUWA 2PJ8A 2XEFA 3EC4A 3BI0A 3FBUA 1XMTA 3K2KA 3S9MA 3PFOA 3B3WA 5F47A 5CMSA 4MHPA 4P45A 3JTKA 4BBHA 1Z8TA 2QVPA 4ESSA 2B4DA 3EXNA 1L0CA 3SIGA 2WZNA 2REFA 2XEGA 5FSUA 4X2TA 1XRYA 2AFCA 1Y9KA 2CY2A 2Q4ZA 2WSAA 2ZELA 4KUAA 5G22A 3VWEA 1Z8XA 2CNSA 2WYRA 4KOVA 4DUKA 1M4GA 2FSRA 5FSVA 4J4ZA 1B6BA 2EUIA 2JLMA 4B11A 4EFDA 1Q2DA 2Q7SA 1CP7A 2WPWA 4MMOA 4R3KA 5D29A 3D2PA 3R1KA 4F8ZA 1Z9UA 4KOSA 1TIQA 2AJ6A 4AG7A 1VKCA 3L2NA 5H86A 4F0YA 1JWQA 3W6SA 2ATRA 2JZFA 1TXZA 4OC1A 5HVHA 1Q2CA 3TCVA 3W91A 1XMBA 5J8FA 1QSRA 1VHEA 3KHZA 4D86A 4KOTA 4KSAA 3KQXA 1KUYA 4UBRA 3IGRA 1PYTB 1IB1E 2ZW4A 4UF4A 2ZEFA 4CPAA 4PK3A 4JGKA 2Z3OA 2ZOGA 4CGNA 1TY8A 2CNTA 4CYNA 2Z3KA 3TOBA 3S9LA 5EBVA 4CYPA 2GE3A 4JXQA 3V2BA 4AVAA 1M4DA 2PR8A 3RBUA 4KS9A 2I3CA 2P6EA 3DR8A 1YREA 4LQ6A 3MN8A 4FD7A 4CS0B 1VHOA 4Q38A 1P0HA 3T9YA 2O28A 3IU2A 5LRGA 2B58A 1XE4A 4KOXA 4MFQA 1JQGA 1FY7A 5C82A 4ZI6A 1AMPA 3IFEA 4I49A 3CT9A 4NF1A 1TF8A 3D67A 3EW5A 1IU8A 2F7VA 2H5MA 4MFPA 2D4PA 2P0WA 2OB0A 2OZUA 3CZXA 4AXVA 4BINA 5LYFA 2PJ6A 3FEEA 2J8NA 3D4UA 4R3LA 2OU2A 3H5ZA 3QNVA 2JDCA 2GANA 1LOKA 4QC6A 2FS5A 5DS0A 5I0CA 3QB8A 3B35A 4KZTA 4NGPA 1Z4RA 5F09A 2VRIA 3PZJA 4PXDA 2V8VA 3GQEA 4C2YA 1NE9A 4C7HA 1LRZA 5K8NA 4GVVA 1XIXA 4UEZA 1CPSA 5LRJA 2PDOA 5HXDA 2OR4A 1N71A 1LAPA 2AFMA 1X12A 1YW4A 2D4OA 2GLFA 3R9GA 2FIAA 4JCAA 1MJAA 4XPLA 3EJFA 2VZZA 2BFRA 2V8GA 2Z3LA 4MBUA 3GY9A 4NGMA 1TF9A 4P6YA 1DTDA 3PP9A 1F2PA 2XEJA 1WK4A 3TE4A 2PJ5A 2NMTA 2FIWA 4NEXA 1ELLP 2PJ7A 3K9TA 4FD4A 5F48A 2R8VA 3G8WA 5D8NA 1OBRA 4OLLA 3KZWA 3TX8A 3VATA 4F9UA 5FSZA 1F2OA 4B6ZA 3SJGA 1TKJA 3WT4A 4J5QA 4A2ZA 5ISVA 2KQVA 1CJWA 4NJRA 3H8GA 3CXSA 4OAEA 7CPAA 3EKEA 1ELMP 3D7FA 2V8HA 2FL4A 2HUZA 4PQAA 4MFJA 5AG6A 2AFXA 3TFYA 2ANPA 4U5YA 1MJBA 1HDUA 1UWYA 1TKHA 2JBKA 2OZGA 2YNCA 3DDDA 3CXPA 4UEFA 1EE3P
chains in the Genus database with same CATH topology
2L8RA 5K8PA 5DUSA 5K8OA 4ETKA 2OOTA 4FWUA 2RB7A 4OIWA 1VHUA 3IIBA 1GYTA 1LANA 2O4HA 4YU9A 4KSIA 3V7ZA 2ZEDA 4Q7AA 4JLLA 1Z5RA 2J9AA 1AYEA 5K8MA 4UMLA 4A38A 1BPNA 4A39A 1BAVA 2PJ1A 3FX6A 3H8FA 5ELYA 1XBUA 1HDQA 2BFQA 3SIIA 2FXKA 3HUVA 1IY7A 3GPQA 3IIFA 1ZG9A 2C1CA 2PJAA 2BCOA 4H2KA 4TU0A 2XEIA 4G1PA 3EWPA 3EWQA 3DLJA 4FAIA 2HC9A 3EWOA 3FJUA 4YWYA 4J5SA 4WWVA 1FT7A 1KWMA 4NGSA 4P4FA 3D7HA 5JGFA 4IHMA 1M4LA 4OC4A 3EJGA 4K0CA 3Q71A 4R7MA 2ZEGA 3RAMA 5FSXA 2DEAA 2GLJA 1Y7EA 1Y0YA 4FBEA 2QYVA 4NJQA 2CTBA 4MCSA 4GUAA 3H8EA 2EK8A 3FVLA 1Z2LA 4PXEA 4OC5A 4NGQA 3N5FA 4JYWA 2V77A 1TXRA 3GB0A 3WC5A 3EWRA 3IO1A 3WC6A 3SJXA 1PCAA 4O23A 2HB6A 3LWUA 3S9NA 1HEEA 3NH5A 3TC8A 2FAVA 4JZ0A 2JBJA 2EWBA 4PPZA 1ZG7A 2PJ0A 4ZY1A 2PJ3A 5HVFA 1F57A 3B7IA 4NGTA 4ETJA 5LYIA 3PB4X 5HOLA 4MHZA 3SI2A 2EK9A 5CB3A 1QQ9A 3KI9A 1ARMA 3LMSA 4ZX8A 2ABZA 4R6TA 2GREA 3KR4A 3Q6ZA 3NH4A 3FECA 3T8WA 4GVWA 3SI0A 2V8DA 5THWA 1LFWA 1Y0RA 3SI1A 3PEIA 3PB8X 4Z65A 1VGYA 3ETIA 2JEWA 4OP4A 1ZLIA 4ZY2A 2AFOA 1RTQA 5I4MA 4J5RA 5CB5A 3VARA 1BLLE 3V45A 2C6GA 2PVVA 3IWWA 5JM6A 2O53A 4DYOA 5LYDA 4OC0A 1Q7LA 1VIXA 3VH9A 1IGBA 1XJOA 4KYBA 3GUXA 3CDXA 3FMCA 2PJ9A 4NGNA 4EMEA 4MXUA 5LRKA 3ISXA 3PB6X 3KQZA 2X47A 1ZG8A 1R3NA 2ZEPA 1NSAA 4ZY0A 4A37A 4F9VA 4FUUA 4PXCA 2Q51A 5CBMA 3SIHA 4P10A 4OC2A 2CIJA 1CX8A 1H8LA 2PCUA 2QJ8A 4P4BA 1ZR5A 3IEHA 5J1QA 4OIDA 2BOAA 4ZX9A 3MRUA 4MHNA 3IJ3A 3BXMA 4P4JA 3VATA 1FNOA 3IIDA 3SIJA 1DE4C 4TWEA 4IQYA 8CPAA 3JZTA 3KR5A 3ISZA 1BPMA 4JVVA 3NH8A 1HJZA 2ACFA 2POKA 2VL1A 4OC3A 3PB7X 3DGVA 2FVGA 2ZEOA 4W9YA 4MHYA 4OKOA 3KGQA 1NJRA 5IB9A 3BHXA 1ZLHA 4ABLA 1LAMA 3FEDA 2PVWA 2ZEEA 3PB9X 2CF4A 2GU2A 3D7DA 3CPAA 3GPGA 2C6CA 3FH4A 3KL9A 2AFUA 4P4EA 4NFRA 4UIAA 3NA6A 1LCPA 3VFQA 2RFHA 1YLOA 5HVGA 3PBEA 1XFOA 3GPOA 4TNUA 4EWTA 2PIZA 3RZAA 4K3NA 3D7GA 1YW6A 3PBBA 2IQ6A 2NYQA 1QMUA 3GLJA 3B3SA 3B3CA 3JRUA 4GM5A 3CPXA 3B3TA 3I1UA 4P44A 3BI1A 2ZOFA 5HIHA 6CPAA 2ZENA 1CG2A 5AILA 1CBXA 4MCPA 2XD7A 3B2YA 4NGRA 3KASA 2CTCA 4IAVA 2EEEA 4MCRA 4UIBA 4ONWA 5FSYA 3HLPA 2NSMA 2PIYA 2PJBA 4ZYQA 4X8IA 1R43A 4PXBA 3SJEA 4X3RA 2LGRA 1CP6A 5JH9A 1CPXA 3WABA 2Q43A 3D66A 4MCQA 3NFZA 5LYLA 2F8HA 3D68A 4WJBA 2AFZA 4UEEA 2ZEHA 3V38A 4R8FA 2BO9A 2AFWA 2ZEMA 3PFEA 1YMEA 3GQOA 4P4DA 1SPVA 2PJCA 1ZR3A 4BD9A 3IC1A 2IMOA 5E3BA 3PRTA 2DX6A 1TKFA 2PJ4A 4P4IA 2C6PA 4ABKA 1YD9A 1Z8LA 3KHXA 2G9DA 2AFSA 3B3VA 4IK2A 4RUHA 4OMEA 3WC7A 5CPAA 2PJ2A 4LQGA 2PRQA 4DJLA 1ARLA 4MRIA 2IJZA 2PE3A 3FF3A 3SJFA 1YSJA 2FG1A 4R76A 4A94A 2PJ8A 2XEFA 3BI0A 3K2KA 3S9MA 3PFOA 3B3WA 5CMSA 4MHPA 4P45A 2QVPA 4ESSA 3SIGA 2WZNA 2XEGA 5FSUA 4X2TA 1XRYA 2AFCA 2ZELA 2Q4ZA 2WYRA 4DUKA 5FSVA 4J4ZA 4EFDA 4MMOA 1CP7A 5D29A 4F8ZA 3L2NA 4OC1A 1TXZA 5HVHA 1XMBA 1VHEA 3KHZA 4D86A 3KQXA 1PYTB 4UF4A 2ZEFA 4CPAA 4JGKA 2ZOGA 1TY8A 3S9LA 3V2BA 3RBUA 2I3CA 3MN8A 1VHOA 5LRGA 1JQGA 4ZI6A 1AMPA 3IFEA 3CT9A 1TF8A 3D67A 3EW5A 2F7VA 5LYFA 4AXVA 2PJ6A 3FEEA 3D4UA 3QNVA 1LOKA 5DS0A 3B35A 4NGPA 5F09A 2VRIA 4PXDA 2V8VA 3GQEA 5K8NA 4GVVA 4UEZA 1CPSA 5LRJA 5HXDA 2OR4A 1LAPA 2AFMA 1YW4A 2GLFA 4JCAA 3EJFA 2BFRA 2V8GA 4NGMA 1TF9A 4P6YA 1DTDA 1F2PA 2XEJA 2PJ5A 1ELLP 2PJ7A 3K9TA 5D8NA 1OBRA 3KZWA 3TX8A 4F9UA 5FSZA 1F2OA 4B6ZA 3SJGA 1TKJA 3WT4A 4J5QA 4NJRA 3H8GA 7CPAA 3EKEA 1ELMP 3D7FA 2V8HA 4PQAA 2AFXA 2ANPA 1HDUA 1UWYA 1TKHA 2JBKA 4UEFA 1EE3P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8R A;  5K8P A;  5DUS A;  5K8O A;  4ETK A;  2OOT A;  4FWU A;  2RB7 A;  4OIW A;  1VHU A;  3IIB A;  1GYT A;  1LAN A;  2O4H A;  4YU9 A;  4KSI A;  3V7Z A;  2ZED A;  4Q7A A;  4JLL A;  1Z5R A;  2J9A A;  1AYE A;  5K8M A;  4UML A;  4A38 A;  1BPN A;  4A39 A;  1BAV A;  2PJ1 A;  3FX6 A;  3H8F A;  5ELY A;  1XBU A;  1HDQ A;  2BFQ A;  3SII A;  2FXK A;  3HUV A;  1IY7 A;  3GPQ A;  3IIF A;  1ZG9 A;  2C1C A;  2PJA A;  2BCO A;  4H2K A;  4TU0 A;  2XEI A;  4G1P A;  3EWP A;  3EWQ A;  3DLJ A;  4FAI A;  2HC9 A;  3EWO A;  3FJU A;  4YWY A;  4J5S A;  4WWV A;  1FT7 A;  1KWM A;  4NGS A;  4P4F A;  3D7H A;  5JGF A;  4IHM A;  1M4L A;  4OC4 A;  3EJG A;  4K0C A;  3Q71 A;  4R7M A;  2ZEG A;  3RAM A;  5FSX A;  2DEA A;  2GLJ A;  1Y7E A;  1Y0Y A;  4FBE A;  2QYV A;  4NJQ A;  2CTB A;  4MCS A;  4GUA A;  3H8E A;  2EK8 A;  3FVL A;  1Z2L A;  4PXE A;  4OC5 A;  4NGQ A;  3N5F A;  4JYW A;  2V77 A;  1TXR A;  3GB0 A;  3WC5 A;  3EWR A;  3IO1 A;  3WC6 A;  3SJX A;  1PCA A;  4O23 A;  2HB6 A;  3LWU A;  3S9N A;  1HEE A;  3NH5 A;  3TC8 A;  2FAV A;  4JZ0 A;  2JBJ A;  2EWB A;  4PPZ A;  1ZG7 A;  2PJ0 A;  4ZY1 A;  2PJ3 A;  5HVF A;  1F57 A;  3B7I A;  4NGT A;  4ETJ A;  5LYI A;  3PB4 X;  5HOL A;  4MHZ A;  3SI2 A;  2EK9 A;  5CB3 A;  1QQ9 A;  3KI9 A;  1ARM A;  3LMS A;  4ZX8 A;  2ABZ A;  4R6T A;  2GRE A;  3KR4 A;  3Q6Z A;  3NH4 A;  3FEC A;  3T8W A;  4GVW A;  3SI0 A;  2V8D A;  5THW A;  1LFW A;  1Y0R A;  3SI1 A;  3PEI A;  3PB8 X;  4Z65 A;  1VGY A;  3ETI A;  2JEW A;  4OP4 A;  1ZLI A;  4ZY2 A;  2AFO A;  1RTQ A;  5I4M A;  4J5R A;  5CB5 A;  3VAR A;  1BLL E;  3V45 A;  2C6G A;  2PVV A;  3IWW A;  5JM6 A;  2O53 A;  4DYO A;  5LYD A;  4OC0 A;  1Q7L A;  1VIX A;  3VH9 A;  1IGB A;  1XJO A;  4KYB A;  3GUX A;  3CDX A;  3FMC A;  2PJ9 A;  4NGN A;  4EME A;  4MXU A;  5LRK A;  3ISX A;  3PB6 X;  3KQZ A;  2X47 A;  1ZG8 A;  1R3N A;  2ZEP A;  1NSA A;  4ZY0 A;  4A37 A;  4F9V A;  4FUU A;  4PXC A;  2Q51 A;  5CBM A;  3SIH A;  4P10 A;  4OC2 A;  2CIJ A;  1CX8 A;  1H8L A;  2PCU A;  2QJ8 A;  4P4B A;  1ZR5 A;  3IEH A;  5J1Q A;  4OID A;  2BOA A;  4ZX9 A;  3MRU A;  4MHN A;  3IJ3 A;  3BXM A;  4P4J A;  3VAT A;  1FNO A;  3IID A;  3SIJ A;  1DE4 C;  4TWE A;  4IQY A;  8CPA A;  3JZT A;  3KR5 A;  3ISZ A;  1BPM A;  4JVV A;  3NH8 A;  1HJZ A;  2ACF A;  2POK A;  2VL1 A;  4OC3 A;  3PB7 X;  3DGV A;  2FVG A;  2ZEO A;  4W9Y A;  4MHY A;  4OKO A;  3KGQ A;  1NJR A;  5IB9 A;  3BHX A;  1ZLH A;  4ABL A;  1LAM A;  3FED A;  2PVW A;  2ZEE A;  3PB9 X;  2CF4 A;  2GU2 A;  3D7D A;  3CPA A;  3GPG A;  2C6C A;  3FH4 A;  3KL9 A;  2AFU A;  4P4E A;  4NFR A;  4UIA A;  3NA6 A;  1LCP A;  3VFQ A;  2RFH A;  1YLO A;  5HVG A;  3PBE A;  1XFO A;  3GPO A;  4TNU A;  4EWT A;  2PIZ A;  3RZA A;  4K3N A;  3D7G A;  1YW6 A;  3PBB A;  2IQ6 A;  2NYQ A;  1QMU A;  3GLJ A;  3B3S A;  3B3C A;  3JRU A;  4GM5 A;  3CPX A;  3B3T A;  3I1U A;  4P44 A;  3BI1 A;  2ZOF A;  5HIH A;  6CPA A;  2ZEN A;  1CG2 A;  5AIL A;  1CBX A;  4MCP A;  2XD7 A;  3B2Y A;  4NGR A;  3KAS A;  2CTC A;  4IAV A;  2EEE A;  4MCR A;  4UIB A;  4ONW A;  5FSY A;  3HLP A;  2NSM A;  2PIY A;  2PJB A;  4ZYQ A;  4X8I A;  1R43 A;  4PXB A;  3SJE A;  4X3R A;  2LGR A;  1CP6 A;  5JH9 A;  1CPX A;  3WAB A;  2Q43 A;  3D66 A;  4MCQ A;  3NFZ A;  5LYL A;  2F8H A;  3D68 A;  4WJB A;  2AFZ A;  4UEE A;  2ZEH A;  3V38 A;  4R8F A;  2BO9 A;  2AFW A;  2ZEM A;  3PFE A;  1YME A;  3GQO A;  4P4D A;  1SPV A;  2PJC A;  1ZR3 A;  4BD9 A;  3IC1 A;  2IMO A;  5E3B A;  3PRT A;  2DX6 A;  1TKF A;  2PJ4 A;  4P4I A;  2C6P A;  4ABK A;  1YD9 A;  1Z8L A;  3KHX A;  2G9D A;  2AFS A;  3B3V A;  4IK2 A;  4RUH A;  4OME A;  3WC7 A;  5CPA A;  2PJ2 A;  4LQG A;  2PRQ A;  4DJL A;  1ARL A;  4MRI A;  2IJZ A;  2PE3 A;  3FF3 A;  3SJF A;  1YSJ A;  2FG1 A;  4R76 A;  4A94 A;  2PJ8 A;  2XEF A;  3BI0 A;  3K2K A;  3S9M A;  3PFO A;  3B3W A;  5CMS A;  4MHP A;  4P45 A;  2QVP A;  4ESS A;  3SIG A;  2WZN A;  2XEG A;  5FSU A;  4X2T A;  1XRY A;  2AFC A;  2ZEL A;  2Q4Z A;  2WYR A;  4DUK A;  5FSV A;  4J4Z A;  4EFD A;  4MMO A;  1CP7 A;  5D29 A;  4F8Z A;  3L2N A;  4OC1 A;  1TXZ A;  5HVH A;  1XMB A;  1VHE A;  3KHZ A;  4D86 A;  3KQX A;  1PYT B;  4UF4 A;  2ZEF A;  4CPA A;  4JGK A;  2ZOG A;  1TY8 A;  3S9L A;  3V2B A;  3RBU A;  2I3C A;  3MN8 A;  1VHO A;  5LRG A;  1JQG A;  4ZI6 A;  1AMP A;  3IFE A;  3CT9 A;  1TF8 A;  3D67 A;  3EW5 A;  2F7V A;  5LYF A;  4AXV A;  2PJ6 A;  3FEE A;  3D4U A;  3QNV A;  1LOK A;  5DS0 A;  3B35 A;  4NGP A;  5F09 A;  2VRI A;  4PXD A;  2V8V A;  3GQE A;  5K8N A;  4GVV A;  4UEZ A;  1CPS A;  5LRJ A;  5HXD A;  2OR4 A;  1LAP A;  2AFM A;  1YW4 A;  2GLF A;  4JCA A;  3EJF A;  2BFR A;  2V8G A;  4NGM A;  1TF9 A;  4P6Y A;  1DTD A;  1F2P A;  2XEJ A;  2PJ5 A;  1ELL P;  2PJ7 A;  3K9T A;  5D8N A;  1OBR A;  3KZW A;  3TX8 A;  4F9U A;  5FSZ A;  1F2O A;  4B6Z A;  3SJG A;  1TKJ A;  3WT4 A;  4J5Q A;  4NJR A;  3H8G A;  7CPA A;  3EKE A;  1ELM P;  3D7F A;  2V8H A;  4PQA A;  2AFX A;  2ANP A;  1HDU A;  1UWY A;  1TKH A;  2JBK A;  4UEF A;  1EE3 P; 
#chains in the Genus database with same CATH topology
 4JLY A;  3FYN A;  5IB0 A;  2L8R A;  4CGP A;  3GKR A;  5IX3 A;  5K8P A;  5DUS A;  3FNC A;  3TO7 A;  5K8O A;  4MY3 A;  4ETK A;  2OOT A;  2JZE A;  4FWU A;  2RB7 A;  4OIW A;  1VHU A;  1IYL A;  3IIB A;  1GYT A;  1LAN A;  2O4H A;  5JPH A;  2EVN A;  2GFQ A;  4YU9 A;  4KSI A;  3V7Z A;  4X5K A;  4UWI A;  2VZY A;  5KTA A;  2VEZ A;  2ZED A;  2ZXV A;  4Q7A A;  4JLL A;  1Z5R A;  2J9A A;  4B5P B;  1AYE A;  2G3T A;  5K8M A;  4UML A;  4E2A A;  4A38 A;  2BL1 A;  1BPN A;  5EMI A;  4A39 A;  4ZGY B;  1BAV A;  2PJ1 A;  3FX6 A;  3H8F A;  5ELY A;  3K9U A;  1XBU A;  3RO0 A;  1HDQ A;  4BMH A;  4UFX A;  4A32 A;  1BOB A;  2BFQ A;  3SII A;  4IUS A;  2ZW6 A;  5A27 A;  2FXK A;  3HUV A;  1IY7 A;  4KSF A;  3I9S A;  3GPQ A;  4MFZ A;  2IL4 A;  3IIF A;  1ZG9 A;  2C1C A;  2PJA A;  2BCO A;  4H2K A;  4TU0 A;  4XPD C;  4ZBG A;  2XEI A;  4G1P A;  3OWC A;  4M6I A;  3EWP A;  2WCT A;  2EO8 A;  3EWQ A;  1M4I A;  4AVC A;  3DLJ A;  4FAI A;  2HC9 A;  3EWO A;  1Z4E A;  3FJU A;  4PK2 A;  4YWY A;  2B3V A;  4QUS A;  2VQY A;  4J5S A;  5G21 A;  4WWV A;  2C27 A;  2Q4Y A;  1FT7 A;  1KWM A;  5HMN A;  4NGS A;  4U9Z A;  4P4F A;  3D7H A;  1KUX A;  5JGF A;  2WUU A;  1M4L A;  4IHM A;  4OC4 A;  3EJG A;  4K0C A;  2P6G A;  2JZD A;  3Q71 A;  4PV6 A;  5CNP A;  3C26 A;  4R7M A;  4CRY B;  2CNM A;  2ZEG A;  5DWN A;  1S7F A;  3RAM A;  5A28 A;  3E0K A;  5FSX A;  4CYO A;  2DEA A;  2GLJ A;  1Y7E A;  4KOY A;  1Y0Y A;  4XNH C;  4FBE A;  2ZW7 A;  2QEC A;  2QYV A;  1IOI A;  4NJQ A;  1Z8W A;  2CTB A;  4MCS A;  3RYO A;  4GUA A;  3S6K A;  1S5K A;  3H8E A;  5EC4 A;  2QML A;  2EK8 A;  3IU1 A;  3FVL A;  3JVN A;  1Z2L A;  4PXE A;  4CGO A;  4L89 A;  2ZPA A;  4MY0 A;  2JDD A;  2QIR A;  2Q44 A;  3EFA A;  1QSO A;  4K30 A;  2FE7 A;  4NGQ A;  3N5F A;  4OC5 A;  4AG9 A;  4JYW A;  4R9M A;  1NSL A;  2V77 A;  3G3S A;  4QVT A;  5FVJ A;  2F5I A;  3TO6 A;  4M6H A;  3LOD A;  1TXR A;  2PRB A;  1ON0 A;  3GB0 A;  4CGM A;  3WC5 A;  4MFK A;  3FXT A;  3EWR A;  3IO1 A;  4CAF A;  2B3U A;  3A9L A;  3WC6 A;  4A30 A;  3FIX A;  3SJX A;  1PCA A;  2ZW5 A;  3ZJ0 A;  4C68 A;  2Z3M A;  4O23 A;  4E8O A;  3R95 A;  4XPD B;  1YLE A;  2HB6 A;  4B5P A;  3LWU A;  4UCP A;  3S9N A;  1BO4 A;  3MGD A;  1HEE A;  1YVO A;  3NH5 A;  3TC8 A;  2FAV A;  4JZ0 A;  2JBJ A;  2PR1 A;  2EWB A;  1MK4 A;  1QST A;  4PPZ A;  1ZG7 A;  4JXR A;  1I21 A;  2PJ0 A;  4ZY1 A;  2G3A A;  2PJ3 A;  4YGO A;  1F57 A;  1OZP A;  1YR0 A;  3B7I A;  4KUB A;  5HVF A;  4NGT A;  3TOA A;  4ETJ A;  4H6U A;  5LYI A;  4HNX B;  3PB4 X;  5HOL A;  4MHD A;  4MHZ A;  2Q7B A;  2Z3P A;  3SI2 A;  1P4N A;  2WPX A;  4HNY B;  2EK9 A;  5CB3 A;  2OZH A;  4XPK A;  1QQ9 A;  3KI9 A;  3RNZ A;  1ARM A;  3LMS A;  4ZX8 A;  1R57 A;  2ABZ A;  4R6T A;  2Z11 A;  3N7Z A;  2GRE A;  3KR4 A;  5AG5 A;  3Q6Z A;  4RN7 A;  3VWD A;  2FCK A;  3NH4 A;  4XNH B;  3FEC A;  3T8W A;  4GVW A;  2B5G B;  3SI0 A;  2V8D A;  5G1Z A;  5THW A;  4RI1 A;  3EY5 A;  1LFW A;  1Y0R A;  3SI1 A;  3PEI A;  3PB8 X;  4RS2 A;  4Z65 A;  1VGY A;  3ETI A;  2JEW A;  2DF5 A;  4PSW A;  4OP4 A;  1ZLI A;  4ZY2 A;  4GXH A;  2AFO A;  1RTQ A;  1RO5 A;  4B12 A;  4R57 A;  5I4M A;  4J5R A;  5CB5 A;  2ARH A;  3VAR A;  3F0A A;  5AGE A;  5AG7 A;  1BLL E;  4II9 A;  3V45 A;  2C6G A;  3F8K A;  2PVV A;  3KKW A;  3IWW A;  5JM6 A;  4NSQ A;  2O53 A;  4CAX A;  1I1D A;  4DYO A;  2B4D B;  5LYD A;  2J8R A;  4OC0 A;  1Q7L A;  2KCW A;  3SXN A;  3H4Q A;  2BSW A;  1VIX A;  5DWM A;  3VH9 A;  1S7L A;  1IGB A;  2B4B A;  1K4J A;  1XJO A;  4MFL A;  5AG4 A;  4KYB A;  3GUX A;  3CDX A;  1S60 A;  3WR7 A;  3FMC A;  4KLV A;  2PJ9 A;  4NGN A;  2R7H A;  4MXU A;  4EME A;  4KLW A;  1CM0 A;  1A2Z A;  1SQH A;  3ISX A;  5LRK A;  3PB6 X;  4FD5 A;  3F5B A;  4FD6 A;  3KQZ A;  1YX0 A;  2VBQ A;  4C2Z A;  4ONU A;  3W6X A;  2X47 A;  3DSB A;  3NE7 A;  4E0A A;  1ZG8 A;  3V8I A;  5JQ4 A;  1R3N A;  2PSW A;  1XF8 A;  2ZEP A;  4UCM A;  1NSA A;  4ZY0 A;  4A37 A;  4F9V A;  2VI7 A;  4UFW A;  4KVO E;  4FUU A;  2Y0M A;  4PXC A;  1S7N A;  2P6F A;  2B5G A;  2Q51 A;  4OAD A;  1IIC A;  5CBM A;  3SIH A;  4M6G A;  4P10 A;  1KZF A;  4OC2 A;  4CAW A;  2CIJ A;  1CX8 A;  1H8L A;  1YQE A;  2PCU A;  2QJ8 A;  4P4B A;  1ZR5 A;  1J4J A;  4GS4 A;  4JD6 A;  3IEH A;  5J1Q A;  4OID A;  2BOA A;  2JEV A;  4ZX9 A;  2OH1 A;  3CXQ A;  3IJ3 A;  3BXM A;  2HV2 A;  3MRU A;  1FNO A;  2PC1 A;  4MHN A;  3IID A;  3SIJ A;  1DE4 C;  4IF5 A;  4IQY A;  4J3G A;  4TWE A;  8CPA A;  2YGW A;  3JZT A;  3UY5 A;  3GYA A;  3KR5 A;  3TO9 A;  1X10 A;  4B5O A;  4PSX A;  4CGL A;  4DNC A;  4C2X A;  3ISZ A;  1BPM A;  4JVV A;  2G0B A;  1XOV A;  4Y49 C;  1IID A;  1QSM A;  3D3S A;  4EVY A;  4QBJ A;  3NH8 A;  1HJZ A;  3SHP A;  3QAH A;  2FT0 A;  2ACF A;  2POK A;  4AVB A;  2VL1 A;  4OC3 A;  3PB7 X;  3DGV A;  2FVG A;  2ZEO A;  1VHS A;  4LX9 A;  4MHY A;  2ODF A;  4W9Y A;  4OKO A;  5G20 A;  3KGQ A;  1NJR A;  5IB9 A;  2RC4 A;  1AUG A;  1V0C A;  2I79 A;  2VXK A;  3BHX A;  1ZLH A;  2W2G A;  4ABL A;  5BWA B;  5C88 A;  1S3Z A;  1LAM A;  1M44 A;  3FED A;  5H84 A;  2PVW A;  2ZEE A;  4KOR A;  3PB9 X;  4L8A A;  2CF4 A;  4NCZ A;  2GU2 A;  3D7D A;  3CPA A;  3GPG A;  2C6C A;  2I00 A;  3DNS A;  3FH4 A;  2BEI A;  1KUV A;  1RXT A;  3KL9 A;  2DPT A;  1UFH A;  2AFU A;  3FB3 A;  4P4E A;  1B87 A;  3DR6 A;  1IOF A;  4A31 A;  4B14 A;  4NFR A;  1M1D A;  4HKF A;  2BUE A;  3IWE A;  4UIA A;  4C7I A;  3NA6 A;  1I12 A;  4MJ8 A;  1LCP A;  3VFQ A;  4UA3 A;  2RFH A;  2YND A;  1WWZ A;  1YLO A;  4KOU A;  5HVG A;  3ZZI A;  3PBE A;  1XFO A;  3GPO A;  3P2F A;  4MI4 A;  4TNU A;  3PGP A;  4EWT A;  2PIZ A;  4YFJ A;  5KTD A;  3RZA A;  4K3N A;  3D7G A;  1YW6 A;  3NE8 A;  3PBB A;  2IQ6 A;  2NYQ A;  4JJX A;  4UCN A;  4UFV A;  4M3S A;  1U6M A;  1QMU A;  2FXF A;  3EO4 A;  3GLJ A;  4A33 A;  2HQY A;  4A95 A;  2DPS A;  3B3S A;  4CYQ A;  1YVK A;  2CXA A;  2Z10 A;  3B3C A;  3JRU A;  3SXO A;  5J8C A;  5IV0 A;  4Y49 B;  2Q4V A;  4GM5 A;  3GIU A;  4HNW B;  4CAE A;  3CPX A;  3B3T A;  3I1U A;  4P44 A;  3D8P A;  1PU9 A;  4ORF A;  3BI1 A;  2ZOF A;  5HIH A;  5GCN A;  3FRM A;  4P4J A;  1Y9W A;  6CPA A;  2ZEN A;  3B8G A;  1CG2 A;  5AIL A;  1QSN A;  1CBX A;  4KVX A;  4QB9 A;  4MCP A;  2XD7 A;  3B2Y A;  4NGR A;  3T90 A;  3KAS A;  4CRZ B;  1YK3 A;  2Q04 A;  3R96 A;  2CTC A;  4R87 A;  4LUA A;  4IAV A;  2EEE A;  2Q0Y A;  3IWG A;  4MCR A;  1NMT A;  4UIB A;  4ONW A;  3S6H A;  5FSY A;  2A4N A;  3HLP A;  2EBJ A;  2NSM A;  2PIY A;  3BLN A;  1IYK A;  3S6G A;  1MJ9 A;  2K5T A;  2PJB A;  4F0X A;  4ZYQ A;  4B10 A;  4X8I A;  4JWP A;  1R43 A;  4PXB A;  3SJE A;  4F6A A;  2X7B A;  4X3R A;  2LGR A;  1CP6 A;  3R9F A;  5F49 A;  5JH9 A;  3D2M A;  4CAV A;  5HH1 A;  1Q2Y A;  2AE6 A;  1CPX A;  3LAC A;  2Q43 A;  4H89 A;  3WAB A;  1Y7R A;  3D66 A;  2Z0Z A;  3NFZ A;  4MCQ A;  5LYL A;  2F8H A;  3D68 A;  4U9Y A;  2GIV A;  2YNE A;  2AFZ A;  4Q36 A;  4UEE A;  4WJB A;  2ZEH A;  3V38 A;  4R8F A;  2PQ8 A;  4YRH A;  2BO9 A;  2AFW A;  2ZEM A;  1GHE A;  3BJ8 A;  4HPS A;  5E96 A;  3PFE A;  3TT2 A;  1YME A;  5F46 A;  3GQO A;  2R1I A;  3QAY A;  4P4D A;  1SPV A;  3S6F A;  2PJC A;  1ZR3 A;  4M85 A;  4BD9 A;  3IC1 A;  2IMO A;  5E3B A;  3PRT A;  2R98 A;  2DX6 A;  1TKF A;  2PJ4 A;  3P2H A;  4P4I A;  2C6P A;  4ABK A;  1YD9 A;  1Z8L A;  3I3G A;  3KHX A;  2G9D A;  4H6Z A;  3TTH A;  2AFS A;  4KOW A;  4B13 A;  1YGH A;  3B3V A;  4IK2 A;  4AB7 A;  4RUH A;  4KVM E;  4OME A;  4UWJ A;  3WC7 A;  5CPA A;  2PJ2 A;  4LQG A;  1XEB A;  1ZO0 A;  3R9E A;  5KTC A;  2PRQ A;  2REE A;  2DXQ A;  2YNC C;  3BJ7 A;  4DJL A;  1ARL A;  4MRI A;  2IJZ A;  2PE3 A;  1S7K A;  4NXY A;  2Z3N A;  3FF3 A;  2RNK A;  1PUA A;  3SJF A;  1YSJ A;  3LD2 A;  2FG1 A;  4R76 A;  2J8M A;  4A94 A;  3JUW A;  2PJ8 A;  2XEF A;  3EC4 A;  3BI0 A;  3FBU A;  1XMT A;  3K2K A;  3S9M A;  3PFO A;  3B3W A;  5F47 A;  5CMS A;  4MHP A;  4P45 A;  3JTK A;  4BBH A;  1Z8T A;  2QVP A;  4ESS A;  2B4D A;  3EXN A;  1L0C A;  3SIG A;  2WZN A;  2REF A;  2XEG A;  5FSU A;  4X2T A;  1XRY A;  2AFC A;  1Y9K A;  2CY2 A;  2Q4Z A;  2WSA A;  2ZEL A;  4KUA A;  5G22 A;  3VWE A;  1Z8X A;  2CNS A;  2WYR A;  4KOV A;  4DUK A;  1M4G A;  2FSR A;  5FSV A;  4J4Z A;  1B6B A;  2EUI A;  2JLM A;  4B11 A;  4EFD A;  1Q2D A;  2Q7S A;  1CP7 A;  2WPW A;  4MMO A;  4R3K A;  5D29 A;  3D2P A;  3R1K A;  4F8Z A;  1Z9U A;  4KOS A;  1TIQ A;  2AJ6 A;  4AG7 A;  1VKC A;  3L2N A;  5H86 A;  4F0Y A;  1JWQ A;  3W6S A;  2ATR A;  2JZF A;  1TXZ A;  4OC1 A;  5HVH A;  1Q2C A;  3TCV A;  3W91 A;  1XMB A;  5J8F A;  1QSR A;  1VHE A;  3KHZ A;  4D86 A;  4KOT A;  4KSA A;  3KQX A;  1KUY A;  4UBR A;  3IGR A;  1PYT B;  1IB1 E;  2ZW4 A;  4UF4 A;  2ZEF A;  4CPA A;  4PK3 A;  4JGK A;  2Z3O A;  2ZOG A;  4CGN A;  1TY8 A;  2CNT A;  4CYN A;  2Z3K A;  3TOB A;  3S9L A;  5EBV A;  4CYP A;  2GE3 A;  4JXQ A;  3V2B A;  4AVA A;  1M4D A;  2PR8 A;  3RBU A;  4KS9 A;  2I3C A;  2P6E A;  3DR8 A;  1YRE A;  4LQ6 A;  3MN8 A;  4FD7 A;  4CS0 B;  1VHO A;  4Q38 A;  1P0H A;  3T9Y A;  2O28 A;  3IU2 A;  5LRG A;  2B58 A;  1XE4 A;  4KOX A;  4MFQ A;  1JQG A;  1FY7 A;  5C82 A;  4ZI6 A;  1AMP A;  3IFE A;  4I49 A;  3CT9 A;  4NF1 A;  1TF8 A;  3D67 A;  3EW5 A;  1IU8 A;  2F7V A;  2H5M A;  4MFP A;  2D4P A;  2P0W A;  2OB0 A;  2OZU A;  3CZX A;  4AXV A;  4BIN A;  5LYF A;  2PJ6 A;  3FEE A;  2J8N A;  3D4U A;  4R3L A;  2OU2 A;  3H5Z A;  3QNV A;  2JDC A;  2GAN A;  1LOK A;  4QC6 A;  2FS5 A;  5DS0 A;  5I0C A;  3QB8 A;  3B35 A;  4KZT A;  4NGP A;  1Z4R A;  5F09 A;  2VRI A;  3PZJ A;  4PXD A;  2V8V A;  3GQE A;  4C2Y A;  1NE9 A;  4C7H A;  1LRZ A;  5K8N A;  4GVV A;  1XIX A;  4UEZ A;  1CPS A;  5LRJ A;  2PDO A;  5HXD A;  2OR4 A;  1N71 A;  1LAP A;  2AFM A;  1X12 A;  1YW4 A;  2D4O A;  2GLF A;  3R9G A;  2FIA A;  4JCA A;  1MJA A;  4XPL A;  3EJF A;  2VZZ A;  2BFR A;  2V8G A;  2Z3L A;  4MBU A;  3GY9 A;  4NGM A;  1TF9 A;  4P6Y A;  1DTD A;  3PP9 A;  1F2P A;  2XEJ A;  1WK4 A;  3TE4 A;  2PJ5 A;  2NMT A;  2FIW A;  4NEX A;  1ELL P;  2PJ7 A;  3K9T A;  4FD4 A;  5F48 A;  2R8V A;  3G8W A;  5D8N A;  1OBR A;  4OLL A;  3KZW A;  3TX8 A;  3VAT A;  4F9U A;  5FSZ A;  1F2O A;  4B6Z A;  3SJG A;  1TKJ A;  3WT4 A;  4J5Q A;  4A2Z A;  5ISV A;  2KQV A;  1CJW A;  4NJR A;  3H8G A;  3CXS A;  4OAE A;  7CPA A;  3EKE A;  1ELM P;  3D7F A;  2V8H A;  2FL4 A;  2HUZ A;  4PQA A;  4MFJ A;  5AG6 A;  2AFX A;  3TFY A;  2ANP A;  4U5Y A;  1MJB A;  1HDU A;  1UWY A;  1TKH A;  2JBK A;  2OZG A;  2YNC A;  3DDD A;  3CXP A;  4UEF A;  1EE3 P; 
#chains in the Genus database with same CATH homology
 2L8R A;  5K8P A;  5DUS A;  5K8O A;  4ETK A;  2OOT A;  4FWU A;  2RB7 A;  4OIW A;  1VHU A;  3IIB A;  1GYT A;  1LAN A;  2O4H A;  4YU9 A;  4KSI A;  3V7Z A;  2ZED A;  4Q7A A;  4JLL A;  1Z5R A;  2J9A A;  1AYE A;  5K8M A;  4UML A;  4A38 A;  1BPN A;  4A39 A;  1BAV A;  2PJ1 A;  3FX6 A;  3H8F A;  5ELY A;  1XBU A;  1HDQ A;  2BFQ A;  3SII A;  2FXK A;  3HUV A;  1IY7 A;  3GPQ A;  3IIF A;  1ZG9 A;  2C1C A;  2PJA A;  2BCO A;  4H2K A;  4TU0 A;  2XEI A;  4G1P A;  3EWP A;  3EWQ A;  3DLJ A;  4FAI A;  2HC9 A;  3EWO A;  3FJU A;  4YWY A;  4J5S A;  4WWV A;  1FT7 A;  1KWM A;  4NGS A;  4P4F A;  3D7H A;  5JGF A;  4IHM A;  1M4L A;  4OC4 A;  3EJG A;  4K0C A;  3Q71 A;  4R7M A;  2ZEG A;  3RAM A;  5FSX A;  2DEA A;  2GLJ A;  1Y7E A;  1Y0Y A;  4FBE A;  2QYV A;  4NJQ A;  2CTB A;  4MCS A;  4GUA A;  3H8E A;  2EK8 A;  3FVL A;  1Z2L A;  4PXE A;  4OC5 A;  4NGQ A;  3N5F A;  4JYW A;  2V77 A;  1TXR A;  3GB0 A;  3WC5 A;  3EWR A;  3IO1 A;  3WC6 A;  3SJX A;  1PCA A;  4O23 A;  2HB6 A;  3LWU A;  3S9N A;  1HEE A;  3NH5 A;  3TC8 A;  2FAV A;  4JZ0 A;  2JBJ A;  2EWB A;  4PPZ A;  1ZG7 A;  2PJ0 A;  4ZY1 A;  2PJ3 A;  5HVF A;  1F57 A;  3B7I A;  4NGT A;  4ETJ A;  5LYI A;  3PB4 X;  5HOL A;  4MHZ A;  3SI2 A;  2EK9 A;  5CB3 A;  1QQ9 A;  3KI9 A;  1ARM A;  3LMS A;  4ZX8 A;  2ABZ A;  4R6T A;  2GRE A;  3KR4 A;  3Q6Z A;  3NH4 A;  3FEC A;  3T8W A;  4GVW A;  3SI0 A;  2V8D A;  5THW A;  1LFW A;  1Y0R A;  3SI1 A;  3PEI A;  3PB8 X;  4Z65 A;  1VGY A;  3ETI A;  2JEW A;  4OP4 A;  1ZLI A;  4ZY2 A;  2AFO A;  1RTQ A;  5I4M A;  4J5R A;  5CB5 A;  3VAR A;  1BLL E;  3V45 A;  2C6G A;  2PVV A;  3IWW A;  5JM6 A;  2O53 A;  4DYO A;  5LYD A;  4OC0 A;  1Q7L A;  1VIX A;  3VH9 A;  1IGB A;  1XJO A;  4KYB A;  3GUX A;  3CDX A;  3FMC A;  2PJ9 A;  4NGN A;  4EME A;  4MXU A;  5LRK A;  3ISX A;  3PB6 X;  3KQZ A;  2X47 A;  1ZG8 A;  1R3N A;  2ZEP A;  1NSA A;  4ZY0 A;  4A37 A;  4F9V A;  4FUU A;  4PXC A;  2Q51 A;  5CBM A;  3SIH A;  4P10 A;  4OC2 A;  2CIJ A;  1CX8 A;  1H8L A;  2PCU A;  2QJ8 A;  4P4B A;  1ZR5 A;  3IEH A;  5J1Q A;  4OID A;  2BOA A;  4ZX9 A;  3MRU A;  4MHN A;  3IJ3 A;  3BXM A;  4P4J A;  3VAT A;  1FNO A;  3IID A;  3SIJ A;  1DE4 C;  4TWE A;  4IQY A;  8CPA A;  3JZT A;  3KR5 A;  3ISZ A;  1BPM A;  4JVV A;  3NH8 A;  1HJZ A;  2ACF A;  2POK A;  2VL1 A;  4OC3 A;  3PB7 X;  3DGV A;  2FVG A;  2ZEO A;  4W9Y A;  4MHY A;  4OKO A;  3KGQ A;  1NJR A;  5IB9 A;  3BHX A;  1ZLH A;  4ABL A;  1LAM A;  3FED A;  2PVW A;  2ZEE A;  3PB9 X;  2CF4 A;  2GU2 A;  3D7D A;  3CPA A;  3GPG A;  2C6C A;  3FH4 A;  3KL9 A;  2AFU A;  4P4E A;  4NFR A;  4UIA A;  3NA6 A;  1LCP A;  3VFQ A;  2RFH A;  1YLO A;  5HVG A;  3PBE A;  1XFO A;  3GPO A;  4TNU A;  4EWT A;  2PIZ A;  3RZA A;  4K3N A;  3D7G A;  1YW6 A;  3PBB A;  2IQ6 A;  2NYQ A;  1QMU A;  3GLJ A;  3B3S A;  3B3C A;  3JRU A;  4GM5 A;  3CPX A;  3B3T A;  3I1U A;  4P44 A;  3BI1 A;  2ZOF A;  5HIH A;  6CPA A;  2ZEN A;  1CG2 A;  5AIL A;  1CBX A;  4MCP A;  2XD7 A;  3B2Y A;  4NGR A;  3KAS A;  2CTC A;  4IAV A;  2EEE A;  4MCR A;  4UIB A;  4ONW A;  5FSY A;  3HLP A;  2NSM A;  2PIY A;  2PJB A;  4ZYQ A;  4X8I A;  1R43 A;  4PXB A;  3SJE A;  4X3R A;  2LGR A;  1CP6 A;  5JH9 A;  1CPX A;  3WAB A;  2Q43 A;  3D66 A;  4MCQ A;  3NFZ A;  5LYL A;  2F8H A;  3D68 A;  4WJB A;  2AFZ A;  4UEE A;  2ZEH A;  3V38 A;  4R8F A;  2BO9 A;  2AFW A;  2ZEM A;  3PFE A;  1YME A;  3GQO A;  4P4D A;  1SPV A;  2PJC A;  1ZR3 A;  4BD9 A;  3IC1 A;  2IMO A;  5E3B A;  3PRT A;  2DX6 A;  1TKF A;  2PJ4 A;  4P4I A;  2C6P A;  4ABK A;  1YD9 A;  1Z8L A;  3KHX A;  2G9D A;  2AFS A;  3B3V A;  4IK2 A;  4RUH A;  4OME A;  3WC7 A;  5CPA A;  2PJ2 A;  4LQG A;  2PRQ A;  4DJL A;  1ARL A;  4MRI A;  2IJZ A;  2PE3 A;  3FF3 A;  3SJF A;  1YSJ A;  2FG1 A;  4R76 A;  4A94 A;  2PJ8 A;  2XEF A;  3BI0 A;  3K2K A;  3S9M A;  3PFO A;  3B3W A;  5CMS A;  4MHP A;  4P45 A;  2QVP A;  4ESS A;  3SIG A;  2WZN A;  2XEG A;  5FSU A;  4X2T A;  1XRY A;  2AFC A;  2ZEL A;  2Q4Z A;  2WYR A;  4DUK A;  5FSV A;  4J4Z A;  4EFD A;  4MMO A;  1CP7 A;  5D29 A;  4F8Z A;  3L2N A;  4OC1 A;  1TXZ A;  5HVH A;  1XMB A;  1VHE A;  3KHZ A;  4D86 A;  3KQX A;  1PYT B;  4UF4 A;  2ZEF A;  4CPA A;  4JGK A;  2ZOG A;  1TY8 A;  3S9L A;  3V2B A;  3RBU A;  2I3C A;  3MN8 A;  1VHO A;  5LRG A;  1JQG A;  4ZI6 A;  1AMP A;  3IFE A;  3CT9 A;  1TF8 A;  3D67 A;  3EW5 A;  2F7V A;  5LYF A;  4AXV A;  2PJ6 A;  3FEE A;  3D4U A;  3QNV A;  1LOK A;  5DS0 A;  3B35 A;  4NGP A;  5F09 A;  2VRI A;  4PXD A;  2V8V A;  3GQE A;  5K8N A;  4GVV A;  4UEZ A;  1CPS A;  5LRJ A;  5HXD A;  2OR4 A;  1LAP A;  2AFM A;  1YW4 A;  2GLF A;  4JCA A;  3EJF A;  2BFR A;  2V8G A;  4NGM A;  1TF9 A;  4P6Y A;  1DTD A;  1F2P A;  2XEJ A;  2PJ5 A;  1ELL P;  2PJ7 A;  3K9T A;  5D8N A;  1OBR A;  3KZW A;  3TX8 A;  4F9U A;  5FSZ A;  1F2O A;  4B6Z A;  3SJG A;  1TKJ A;  3WT4 A;  4J5Q A;  4NJR A;  3H8G A;  7CPA A;  3EKE A;  1ELM P;  3D7F A;  2V8H A;  4PQA A;  2AFX A;  2ANP A;  1HDU A;  1UWY A;  1TKH A;  2JBK A;  4UEF A;  1EE3 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...