4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
3V45A 4ZI6A 2BFQA 4MHYA 4P10A 3D7GA 2J9AA 4JVVA 4X2TA 4R8FA 4UEZA 2XEIA 5LRKA 4MMOA 3SIHA 2Q51A 3RBUA 8CPAA 3FX6A 7CPAA 3SJEA 1QQ9A 4P4JA 3KQZA 3EJFA 2HB6A 5THWA 3JRUA 4OC2A 2GREA 5LYFA 2V77A 3FJUA 2I3CA 4OIDA 1LOKA 3PB9X 3PB8X 5K8MA 1Y0YA 4IK2A 3SI2A 3LWUA 3KI9A 5LRJA 3KR5A 4UEEA 2PJ8A 4KYBA 3NA6A 2Q4ZA 2PVVA 3D7HA 5LRGA 5E3BA 4ZY0A 3D4UA 4F9VA 1FNOA 1XJOA 1UWYA 3FEEA 3PBEA 4ONWA 4NGTA 3IO1A 3WC7A 4OC4A 1LCPA 2ZEHA 3KQXA 2QJ8A 3HLPA 4JLLA 2AFMA 1CBXA 4PXBA 4OC1A 3VH9A 5CBMA 2XEJA 1F2PA 3NH4A 4UMLA 2IJZA 1ZG9A 2C6CA 4ABLA 3B2YA 5K8PA 2QVPA 4R7MA 3KHXA 1DE4C 3PB6X 1ARMA 3TC8A 4J4ZA 2Q43A 4MXUA 3EW5A 4EWTA 5K8OA 2WZNA 2GLJA 4J5RA 1KWMA 4GM5A 2CTCA 3VFQA 5CMSA 3PB7X 1XMBA 3KL9A 1PCAA 2PJCA 1AMPA 2GU2A 5JGFA 1SPVA 2XD7A 3PEIA 4IQYA 3BXMA 2AFWA 1H8LA 1NSAA 3BI1A 4P44A 5AILA 2ACFA 3B3CA 2JEWA 2VL1A 1ZR5A 1M4LA 2C6PA 4NGQA 4F9UA 1LAMA 4P4IA 3S9MA 3QNVA 3DLJA 4OIWA 5FSYA 2ZEFA 1R43A 3D67A 4X8IA 2PJ6A 4JYWA 3FF3A 1TXZA 3VATA 3SJXA 5HVHA 3KZWA 4PXEA 3B35A 3BHXA 4UF4A 2FG1A 4YWYA 5ELYA 2V8DA 2ZEMA 4NFRA 5CB5A 3B7IA 2CIJA 2OR4A 1TF8A 3S9LA 3ISZA 2ZEOA 2IQ6A 3IIDA 1YW6A 1OBRA 2NYQA 3ISXA 5JH9A 2O4HA 4P4EA 1F57A 1IGBA 5D8NA 3SJFA 1F2OA 3IWWA 2PJ3A 3SIJA 4YU9A 2AFSA 2L8RA 5HXDA 2ZELA 4NGSA 3ETIA 4P4FA 1CX8A 4NGRA 3FEDA 3H8GA 3D7DA 1CP6A 1TKJA 3RAMA 3WT4A 5IB9A 4R6TA 5HOLA 4O23A 4P4BA 1CP7A 4MHPA 4DUKA 4FWUA 2AFUA 5LYDA 4NJRA 3B3VA 4P4DA 1YLOA 2PCUA 1TF9A 4GVVA 2PJ0A 4JGKA 5HVGA 3EWRA 2X47A 5HIHA 3PRTA 4OP4A 1ZG8A 4DYOA 4ZY1A 2PJ2A 4OMEA 3S9NA 1BLLE 1BAVA 1HJZA 3GPGA 1Z8LA 2PJBA 4UIBA 3SJGA 2C1CA 3FECA 2WYRA 1LFWA 2XEGA 2V8VA 4AXVA 4J5QA 4F8ZA 2FAVA 4PQAA 2ZOFA 4WWVA 1BPNA 1LANA 1TKHA 4GUAA 5FSXA 2F7VA 2O53A 4NGNA 4TWEA 2V8GA 5LYIA 4NGPA 1VHUA 1YW4A 1GYTA 3WABA 1ZR3A 3IIFA 1ELMP 3Q6ZA 1FT7A 1Y0RA 2PJ5A 2BFRA 1IY7A 2ANPA 4IHMA 3WC6A 4NJQA 2BO9A 1EE3P 4NGMA 4TNUA 3WC5A 3EKEA 3MN8A 1TXRA 4R76A 3GPQA 3NH8A 3I1UA 3CDXA 2ZEEA 1CPSA 2EK8A 3HUVA 2LGRA 3KR4A 5CB3A 4JZ0A 2PIYA 3IIBA 2EEEA 3PFEA 3KASA 3CPAA 2FVGA 3FH4A 2ZEGA 4ZX8A 4JCAA 1XBUA 3K9TA 4OC3A 4IAVA 4G1PA 1LAPA 4ETKA 2AFOA 2ZEPA 5DUSA 4KSIA 1XRYA 3KHZA 3SI0A 5F09A 4UEFA 5I4MA 3DGVA 4MHZA 5K8NA 4W9YA 2AFXA 4DJLA 1YSJA 1VGYA 1VHOA 4MCPA 1TY8A 1VHEA 1AYEA 4PXCA 2ZOGA 4A38A 2V8HA 3EJGA 4MCSA 4Q7AA 4ESSA 5HVFA 5LYLA 2DX6A 3V38A 2PIZA 3NH5A 5JM6A 3PB4X 3IJ3A 2QYVA 3MRUA 1Z2LA 2PVWA 4B6ZA 2EWBA 5J1QA 4UIAA 4FUUA 1ARLA 3SIGA 3GQEA 2FXKA 1XFOA 1CPXA 4CPAA 4OKOA 3EWQA 2XEFA 4PXDA 4WJBA 4A37A 1BPMA 4K0CA 3IC1A 3EWOA 3IEHA 3L2NA 3IFEA 4K3NA 4MHNA 1HDQA 4GVWA 3CT9A 4OC5A 3D66A 4H2KA 4EMEA 4RUHA 1ZG7A 3V7ZA 3KGQA 3EWPA 2C6GA 3GB0A 3H8FA 3V2BA 1VIXA 3GPOA 5FSVA 1PYTB 4MCQA 4J5SA 2DEAA 3B3WA 1R3NA 2IMOA 1QMUA 2PE3A 3FVLA 3PFOA 1JQGA 3D68A 2JBKA 2RFHA 4OC0A 2F8HA 4A94A 2EK9A 4ETJA 2PRQA 3T8WA 1RTQA 1ELLP 1NJRA 3BI0A 5DS0A 2BOAA 1ZLIA 3PBBA 3GLJA 1TKFA 3B3SA 4LQGA 4EFDA 3B3TA 1HDUA 4ZX9A 3FMCA 3N5FA 2POKA 2VRIA 3RZAA 2RB7A 1ZLHA 4Z65A 3SIIA 4FAIA 4FBEA 4A39A 4ZYQA 4ZY2A 2PJ1A 1DTDA 2PJ4A 2HC9A 3VARA 1CG2A 3JZTA 3SI1A 4MCRA 4ABKA 2ABZA 5D29A 5CPAA 2OOTA 3GQOA 5FSUA 2PJ9A 2CTBA 3D7FA 4P45A 1Q7LA 2AFCA 4D86A 1YD9A 2PJAA 1YMEA 6CPAA 4BD9A 3K2KA 2BCOA 1Y7EA 3TX8A 3H8EA 3Q71A 4TU0A 3CPXA 3LMSA 2AFZA 4PPZA 4X3RA 2PJ7A 4MRIA 2ZEDA 1Z5RA 4P6YA 2ZENA 2G9DA 2GLFA 2NSMA 2CF4A 3NFZA 2JBJA 1HEEA 5FSZA 3GUXA
chains in the Genus database with same CATH superfamily
2GIVA 1X10A 3TTHA 3V45A 4ZI6A 2BFQA 4MHYA 4NSQA 4P10A 3D7GA 1NMTA 4BMHA 4IF5A 2J9AA 4JVVA 4X2TA 3D3SA 5IV0A 2JZEA 3DR6A 4R8FA 4UEZA 5AG7A 2XEIA 5LRKA 4MMOA 3SIHA 2Q51A 3RBUA 3DNSA 8CPAA 3FX6A 4UCNA 7CPAA 4I49A 2Q7BA 1QQ9A 4P4JA 3SJEA 2FXFA 3KQZA 3EJFA 2YNCA 2Q4YA 2B5GB 2HB6A 3JRUA 5THWA 4OC2A 2GREA 3FRMA 4CRZB 5LYFA 2J8NA 4QVTA 2V77A 3FJUA 2I3CA 4OIDA 1LOKA 3PB9X 1XOVA 3PB8X 1Y0YA 5K8MA 2G3TA 1Y9KA 4GXHA 4IK2A 3SI2A 5KTAA 3S6FA 3LWUA 4H6UA 3KI9A 4JWPA 4MI4A 4OAEA 5LRJA 4CAVA 3KR5A 4UEEA 2PJ8A 2PSWA 3FYNA 5BWAB 4KYBA 3NA6A 3RYOA 2Q4ZA 2PVVA 3D7HA 5LRGA 5E3BA 4ZY0A 2Y0MA 1XEBA 1I21A 2ZW4A 4M6IA 3D4UA 4F9VA 4C2YA 1FNOA 3LD2A 2G3AA 1XJOA 1UWYA 4XPDB 3CXQA 4F0YA 3FEEA 3PBEA 4ONWA 4C7IA 2P6FA 4NGTA 1LRZA 1S7NA 3IO1A 3WC7A 4OC4A 4CRYB 1Y9WA 1LCPA 2ZEHA 3S6HA 3KQXA 2QJ8A 3HLPA 4JLLA 3TCVA 5IB0A 2AFMA 1CBXA 4PXBA 4OC1A 2G0BA 2J8MA 3VH9A 4RI1A 2GE3A 2Z11A 5CBMA 4Y49B 2XEJA 4CYOA 2Q04A 3SHPA 1F2PA 3NH4A 4UMLA 2IJZA 1ZG9A 2C6CA 3S6GA 4EVYA 4ABLA 3B2YA 5K8PA 4CYNA 3EXNA 4XNHC 1NE9A 2QVPA 4R7MA 2YNDA 3KHXA 4C7HA 1PU9A 2VXKA 2BUEA 5G1ZA 1S5KA 3S6KA 1DE4C 1QSMA 4RS2A 4A30A 1X12A 2VZZA 3PB6X 1ARMA 1Q2CA 3K9UA 2D4OA 3P2FA 3TC8A 4J4ZA 2Q43A 4MXUA 3EW5A 4EWTA 4JD6A 4LX9A 1Z8TA 5K8OA 2FIWA 4ZGYB 2WZNA 2ODFA 4HNYB 2GLJA 4J5RA 1KWMA 2AJ6A 1PUAA 2JLMA 4GM5A 1IU8A 4MFJA 2JZFA 2CTCA 3VFQA 5CMSA 3PB7X 1XMBA 3KL9A 1PCAA 2D4PA 2PJCA 2Z3MA 1AMPA 2PR1A 2GU2A 5JGFA 1SPVA 2XD7A 5J8FA 3PEIA 4IQYA 3BXMA 1BO4A 2AFWA 1QSRA 1H8LA 1NSAA 2Q44A 2H5MA 3BI1A 2VBQA 4P44A 5AILA 4QBJA 1KUVA 2ACFA 1S7FA 1ZR5A 1M4LA 1CJWA 2A4NA 2JEWA 2R1IA 2VL1A 2C6PA 2B3VA 4HPSA 4NGQA 4QC6A 2BSWA 4CGNA 4PV6A 4F9UA 2CNTA 2JEVA 1LAMA 4UWIA 4P4IA 4UCPA 4AVBA 4A2ZA 4JJXA 3S9MA 3QNVA 3PZJA 3LACA 3DLJA 4HKFA 4OIWA 5FSYA 2ZEFA 3VWEA 1R43A 3D67A 4MHDA 4X8IA 2PJ6A 5GCNA 1Z4EA 4OADA 4JYWA 3FF3A 2EVNA 1TXZA 3VATA 2ZXVA 3SJXA 5HVHA 1A2ZA 3EC4A 3TO6A 3KZWA 4KOUA 4PXEA 3B35A 3BHXA 2EO8A 2I00A 2Z0ZA 4UF4A 2B4DB 1BOBA 2FG1A 3G3SA 4MY3A 5ELYA 1M4DA 4YWYA 2V8DA 4KOVA 4C2XA 2YGWA 2Z3OA 2ZEMA 4NFRA 2FL4A 1S3ZA 4XPDC 5CB5A 4CS0B 4AB7A 2X7BA 3B7IA 4KVXA 4MFQA 5DWNA 2CIJA 2OR4A 3CXSA 2B5GA 1TF8A 3S9LA 2FIAA 2ZEOA 3ISZA 1SQHA 2IQ6A 3IIDA 1YW6A 2PC1A 4M6HA 2Z3LA 1OBRA 2QIRA 2CNSA 2NYQA 3D2MA 3ISXA 4R3KA 1YX0A 3TO7A 3OWCA 3TE4A 1S60A 1FY7A 3B8GA 4UA3A 2O4HA 4P4EA 5I0CA 1F57A 4A32A 1IGBA 4Y49C 5JH9A 5EC4A 5D8NA 3SJFA 1F2OA 4F6AA 4KSFA 3IWWA 2PDOA 2PJ3A 4MY0A 3SIJA 4YU9A 2AFSA 2L8RA 5HXDA 2ZELA 4NGSA 3ETIA 4CAFA 4P4FA 2EUIA 1CX8A 3GYAA 3FEDA 4NGRA 3CZXA 3H8GA 3D7DA 4KOSA 4QUSA 3IU1A 1CP6A 1TKJA 1YGHA 5HH1A 3RAMA 3WT4A 3H4QA 5IB9A 4KVOE 4R6TA 5HOLA 4O23A 4P4BA 1CP7A 3TOAA 4MHPA 4DUKA 4B13A 1M4GA 4FWUA 1XMTA 2AFUA 2VI7A 4J3GA 4KS9A 4NJRA 5LYDA 4C2ZA 3D2PA 3B3VA 4P4DA 1YLOA 3R95A 2PCUA 3IU2A 1IOIA 1XE4A 3VWDA 1TF9A 4GVVA 4MFZA 2OH1A 2PJ0A 4JGKA 1U6MA 5HVGA 3EWRA 1IYLA 2Q7SA 1R57A 2X47A 5HIHA 2KQVA 2VEZA 3H5ZA 2JDCA 4OLLA 3PRTA 4KOTA 4KOXA 4OP4A 3NE7A 3T9YA 4GS4A 1B87A 3DR8A 1ZG8A 3TFYA 4DYOA 4C68A 4ZY1A 2PJ2A 5A27A 4OMEA 3S9NA 1BLLE 4B14A 3EO4A 1MJBA 1B6BA 2ATRA 3EFAA 1BAVA 3F0AA 1HJZA 5C82A 2RC4A 3IWEA 3GPGA 1Z8LA 2FE7A 1YK3A 2PJBA 4M3SA 4ORFA 4UIBA 4NCZA 3SJGA 2C1CA 3FECA 2WYRA 2BEIA 2IL4A 1LFWA 2XEGA 2CY2A 2DF5A 2V8VA 1AUGA 1YREA 4KVME 4YRHA 1XIXA 4AXVA 4J5QA 2ZW7A 2NMTA 4F8ZA 2FAVA 4UBRA 4Q36A 4PQAA 3RNZA 4KLWA 3ZZIA 2ZOFA 1I12A 2JZDA 4WWVA 4MFKA 3PP9A 1WWZA 4R9MA 1BPNA 4L8AA 4UFXA 1P0HA 1LANA 1TKHA 1Y7RA 4KLVA 1IIDA 4GUAA 2PRBA 5FSXA 4QB9A 2F7VA 4UFVA 4KZTA 2O53A 4NGNA 2J8RA 2WPXA 3I3GA 1RO5A 2V8GA 3GY9A 4FD6A 4TWEA 4NGPA 5LYIA 4F0XA 1VHUA 1GHEA 1YW4A 3FBUA 4CAWA 1GYTA 5F48A 1ZR3A 3WABA 4CYQA 4DNCA 3IIFA 4A33A 1ELMP 3Q6ZA 1FT7A 1Y0RA 2B4DA 2K5TA 2PJ5A 2BFRA 5EBVA 4B5PB 4CGMA 1K4JA 1IY7A 2ANPA 4KUAA 3R9GA 1XF8A 4IHMA 4R57A 1MJ9A 3WC6A 4NJQA 2BO9A 1EE3P 1IICA 4NGMA 2ZW5A 4TNUA 3WC5A 3EKEA 2JDDA 2OU2A 3C26A 3JVNA 3MN8A 1TXRA 4R76A 3E0KA 3GPQA 3NH8A 3I1UA 5DWMA 3CDXA 2ZEEA 3R9EA 1MJAA 1YVOA 3A9LA 2VQYA 1CPSA 2EK8A 1I1DA 4CYPA 3W91A 3HUVA 2LGRA 3KR4A 2CXAA 5F47A 4B5OA 5CB3A 5G20A 5E96A 4JZ0A 2PIYA 3IIBA 2EEEA 2FCKA 3I9SA 5ISVA 3PFEA 5F49A 3KASA 3CPAA 3W6XA 2FVGA 3FH4A 2ZEGA 4ZX8A 4UWJA 4JCAA 4BINA 3KKWA 4MFPA 3DDDA 1XBUA 3K9TA 4OC3A 4MJ8A 1M44A 3SXNA 1Q2YA 4IAVA 3QB8A 2AE6A 4G1PA 4PSWA 1LAPA 3JUWA 4FD4A 1QSNA 4RN7A 5G22A 4ETKA 2P0WA 3LODA 2AFOA 2PR8A 2ZEPA 3V8IA 5DUSA 2BL1A 4AVAA 4KSIA 1XRYA 3KHZA 2Q0YA 4AG7A 4CAXA 1M1DA 1P4NA 5H84A 3SI0A 5F46A 4UEFA 5F09A 5I4MA 4U5YA 4MFLA 5IX3A 3DGVA 2F5IA 3SXOA 2Z10A 4MHZA 4R3LA 5K8NA 2WCTA 4W9YA 2AFXA 4DJLA 2REEA 1J4JA 4FD7A 1YSJA 2Z3PA 4R87A 1VGYA 1VHOA 1Z4RA 4CGPA 4MCPA 5AG6A 3G8WA 2P6EA 5G21A 1Z8XA 4LQ6A 3GIUA 1TY8A 4YFJA 1YVKA 1YR0A 1VHEA 1AYEA 2HV2A 2O28A 2ZOGA 4PXCA 1S7KA 4A38A 2V8HA 3EJGA 4ONUA 4MCSA 2FSRA 3N7ZA 4MBUA 4Q7AA 4ESSA 5HVFA 2R98A 2DX6A 5LYLA 1QSOA 3V38A 2PIZA 3NH5A 5JM6A 3PB4X 3IJ3A 2QYVA 3MRUA 4K30A 1Z2LA 2VZYA 2PVWA 4CGOA 4ZBGA 3FIXA 4B6ZA 2EWBA 2R7HA 4H89A 2WPWA 3W6SA 5J1QA 4UIAA 4FUUA 1ARLA 3SIGA 2GFQA 4CAEA 3GQEA 5JPHA 2FXKA 1XFOA 1Z8WA 1CPXA 2OZGA 3R1KA 4CPAA 4M85A 4OKOA 4E0AA 2GANA 3EWQA 2XEFA 1QSTA 4KOYA 1S7LA 4PXDA 4KSAA 3P2HA 3FXTA 4WJBA 4A37A 1BPMA 4K0CA 4U9YA 1MK4A 3IC1A 3EWOA 3IEHA 3L2NA 4XPLA 3IFEA 3TT2A 4K3NA 3PGPA 2WUUA 2Z3NA 3NE8A 4B11A 3BLNA 1HDQA 4MHNA 4GVWA 3CT9A 2DPTA 4OC5A 3D66A 4H2KA 4A31A 4EMEA 2B3UA 4RUHA 1ZG7A 2R8VA 3F8KA 3ZJ0A 3V7ZA 4BBHA 3KGQA 3EWPA 2C6GA 3GB0A 1YLEA 5HMNA 2FS5A 3H8FA 3V2BA 1VIXA 1IOFA 3GPOA 1L0CA 2B58A 5FSVA 1PYTB 4MCQA 3UY5A 4Q38A 4B5PA 4J5SA 1VKCA 4B12A 3RO0A 1JWQA 2DEAA 3B3WA 1R3NA 5CNPA 3T90A 1M4IA 4M6GA 2IMOA 1QMUA 2PE3A 3FVLA 2RNKA 3PFOA 5EMIA 1Z9UA 5KTDA 1JQGA 3DSBA 2I79A 3D68A 2JBKA 2KCWA 2RFHA 1IYKA 4OC0A 2F8HA 2REFA 4A94A 4NXYA 4KUBA 2CNMA 3F5BA 2EK9A 4ETJA 4L89A 5A28A 2PRQA 5FVJA 3T8WA 1RTQA 2FT0A 4JXQA 1ELLP 1NJRA 4LUAA 4NEXA 4NF1A 3BI0A 1KUYA 2EBJA 3IGRA 5DS0A 2BOAA 1ZLIA 3PBBA 3GLJA 1TKFA 3B3SA 1N71A 2HUZA 1OZPA 4HNWB 4LQGA 3B3TA 4X5KA 4EFDA 3B3CA 1HDUA 1RXTA 5AGEA 4ZX9A 3FMCA 3N5FA 2POKA 4JLYA 4KOWA 2VRIA 3RZAA 2RB7A 1ZLHA 4Z65A 3SIIA 4PSXA 1KZFA 4AG9A 4FAIA 4PK2A 4FBEA 4UCMA 4A39A 4ZYQA 4ZY2A 2PJ1A 1DTDA 2PJ4A 4A95A 2HC9A 3VARA 1ON0A 1CG2A 2WSAA 2Z3KA 4XPKA 4H6ZA 4E8OA 2OZUA 3TO9A 5C88A 2Q4VA 5KTCA 3JZTA 2P6GA 2ARHA 4JXRA 1NSLA 3SI1A 4MCRA 1VHSA 3FNCA 4ABKA 2ABZA 3BJ7A 5D29A 1YQEA 3EY5A 3JTKA 5CPAA 2OOTA 3GQOA 4UFWA 5FSUA 2PJ9A 4II9A 2CTBA 4U9ZA 1IB1E 3GKRA 3R96A 4XNHB 4CGLA 3D7FA 2B4BA 3D8PA 3WR7A 1WK4A 3FB3A 2OZHA 4P45A 1Q7LA 2AFCA 2YNEA 4YGOA 4D86A 2OB0A 3R9FA 1YD9A 2PJAA 5AG5A 4IUSA 3MGDA 3QAYA 3BJ8A 5H86A 1YMEA 6CPAA 5J8CA 1CM0A 4BD9A 3K2KA 2BCOA 4AVCA 1Y7EA 3TX8A 1KUXA 2QMLA 3H8EA 1UFHA 4KORA 3CXPA 1Q2DA 1V0CA 2DXQA 4FD5A 3Q71A 4TU0A 2HQYA 2YNCC 2AFZA 3CPXA 3IWGA 3LMSA 4PPZA 4X3RA 3TOBA 2QECA 2PJ7A 5AG4A 2DPSA 4HNXB 2W2GA 4MRIA 2ZEDA 1Z5RA 1ZO0A 4P6YA 4B10A 2ZENA 4PK3A 2G9DA 2GLFA 2C27A 2NSMA 2ZPAA 1TIQA 2ZW6A 2CF4A 2PQ8A 4E2AA 5JQ4A 3NFZA 2JBJA 1HEEA 3QAHA 5FSZA 3GUXA
chains in the Genus database with same CATH topology
3V45A 4ZI6A 2BFQA 4MHYA 4P10A 3D7GA 2J9AA 4JVVA 4X2TA 4R8FA 4UEZA 2XEIA 5LRKA 4MMOA 3SIHA 2Q51A 3RBUA 8CPAA 3FX6A 7CPAA 3SJEA 1QQ9A 4P4JA 3KQZA 3EJFA 2HB6A 5THWA 3JRUA 4OC2A 2GREA 5LYFA 2V77A 3FJUA 2I3CA 4OIDA 1LOKA 3PB9X 3PB8X 5K8MA 1Y0YA 4IK2A 3SI2A 3LWUA 3KI9A 5LRJA 3KR5A 4UEEA 2PJ8A 4KYBA 3NA6A 2Q4ZA 2PVVA 3D7HA 5LRGA 5E3BA 4ZY0A 3D4UA 4F9VA 1FNOA 1XJOA 1UWYA 3FEEA 3PBEA 4ONWA 4NGTA 3IO1A 3WC7A 4OC4A 1LCPA 2ZEHA 3KQXA 2QJ8A 3HLPA 4JLLA 2AFMA 1CBXA 4PXBA 4OC1A 3VH9A 5CBMA 2XEJA 1F2PA 3NH4A 4UMLA 2IJZA 1ZG9A 2C6CA 4ABLA 3B2YA 5K8PA 2QVPA 4R7MA 3KHXA 1DE4C 3PB6X 1ARMA 3TC8A 4J4ZA 2Q43A 4MXUA 3EW5A 4EWTA 5K8OA 2WZNA 2GLJA 4J5RA 1KWMA 4GM5A 2CTCA 3VFQA 5CMSA 3PB7X 1XMBA 3KL9A 1PCAA 2PJCA 1AMPA 2GU2A 5JGFA 1SPVA 2XD7A 3PEIA 4IQYA 3BXMA 2AFWA 1H8LA 1NSAA 3BI1A 4P44A 5AILA 2ACFA 3B3CA 2JEWA 2VL1A 1ZR5A 1M4LA 2C6PA 4NGQA 4F9UA 1LAMA 4P4IA 3S9MA 3QNVA 3DLJA 4OIWA 5FSYA 2ZEFA 1R43A 3D67A 4X8IA 2PJ6A 4JYWA 3FF3A 1TXZA 3VATA 3SJXA 5HVHA 3KZWA 4PXEA 3B35A 3BHXA 4UF4A 2FG1A 4YWYA 5ELYA 2V8DA 2ZEMA 4NFRA 5CB5A 3B7IA 2CIJA 2OR4A 1TF8A 3S9LA 3ISZA 2ZEOA 2IQ6A 3IIDA 1YW6A 1OBRA 2NYQA 3ISXA 5JH9A 2O4HA 4P4EA 1F57A 1IGBA 5D8NA 3SJFA 1F2OA 3IWWA 2PJ3A 3SIJA 4YU9A 2AFSA 2L8RA 5HXDA 2ZELA 4NGSA 3ETIA 4P4FA 1CX8A 4NGRA 3FEDA 3H8GA 3D7DA 1CP6A 1TKJA 3RAMA 3WT4A 5IB9A 4R6TA 5HOLA 4O23A 4P4BA 1CP7A 4MHPA 4DUKA 4FWUA 2AFUA 5LYDA 4NJRA 3B3VA 4P4DA 1YLOA 2PCUA 1TF9A 4GVVA 2PJ0A 4JGKA 5HVGA 3EWRA 2X47A 5HIHA 3PRTA 4OP4A 1ZG8A 4DYOA 4ZY1A 2PJ2A 4OMEA 3S9NA 1BLLE 1BAVA 1HJZA 3GPGA 1Z8LA 2PJBA 4UIBA 3SJGA 2C1CA 3FECA 2WYRA 1LFWA 2XEGA 2V8VA 4AXVA 4J5QA 4F8ZA 2FAVA 4PQAA 2ZOFA 4WWVA 1BPNA 1LANA 1TKHA 4GUAA 5FSXA 2F7VA 2O53A 4NGNA 4TWEA 2V8GA 5LYIA 4NGPA 1VHUA 1YW4A 1GYTA 3WABA 1ZR3A 3IIFA 1ELMP 3Q6ZA 1FT7A 1Y0RA 2PJ5A 2BFRA 1IY7A 2ANPA 4IHMA 3WC6A 4NJQA 2BO9A 1EE3P 4NGMA 4TNUA 3WC5A 3EKEA 3MN8A 1TXRA 4R76A 3GPQA 3NH8A 3I1UA 3CDXA 2ZEEA 1CPSA 2EK8A 3HUVA 2LGRA 3KR4A 5CB3A 4JZ0A 2PIYA 3IIBA 2EEEA 3PFEA 3KASA 3CPAA 2FVGA 3FH4A 2ZEGA 4ZX8A 4JCAA 1XBUA 3K9TA 4OC3A 4IAVA 4G1PA 1LAPA 4ETKA 2AFOA 2ZEPA 5DUSA 4KSIA 1XRYA 3KHZA 3SI0A 5F09A 4UEFA 5I4MA 3DGVA 4MHZA 5K8NA 4W9YA 2AFXA 4DJLA 1YSJA 1VGYA 1VHOA 4MCPA 1TY8A 1VHEA 1AYEA 4PXCA 2ZOGA 4A38A 2V8HA 3EJGA 4MCSA 4Q7AA 4ESSA 5HVFA 5LYLA 2DX6A 3V38A 2PIZA 3NH5A 5JM6A 3PB4X 3IJ3A 2QYVA 3MRUA 1Z2LA 2PVWA 4B6ZA 2EWBA 5J1QA 4UIAA 4FUUA 1ARLA 3SIGA 3GQEA 2FXKA 1XFOA 1CPXA 4CPAA 4OKOA 3EWQA 2XEFA 4PXDA 4WJBA 4A37A 1BPMA 4K0CA 3IC1A 3EWOA 3IEHA 3L2NA 3IFEA 4K3NA 4MHNA 1HDQA 4GVWA 3CT9A 4OC5A 3D66A 4H2KA 4EMEA 4RUHA 1ZG7A 3V7ZA 3KGQA 3EWPA 2C6GA 3GB0A 3H8FA 3V2BA 1VIXA 3GPOA 5FSVA 1PYTB 4MCQA 4J5SA 2DEAA 3B3WA 1R3NA 2IMOA 1QMUA 2PE3A 3FVLA 3PFOA 1JQGA 3D68A 2JBKA 2RFHA 4OC0A 2F8HA 4A94A 2EK9A 4ETJA 2PRQA 3T8WA 1RTQA 1ELLP 1NJRA 3BI0A 5DS0A 2BOAA 1ZLIA 3PBBA 3GLJA 1TKFA 3B3SA 4LQGA 4EFDA 3B3TA 1HDUA 4ZX9A 3FMCA 3N5FA 2POKA 2VRIA 3RZAA 2RB7A 1ZLHA 4Z65A 3SIIA 4FAIA 4FBEA 4A39A 4ZYQA 4ZY2A 2PJ1A 1DTDA 2PJ4A 2HC9A 3VARA 1CG2A 3JZTA 3SI1A 4MCRA 4ABKA 2ABZA 5D29A 5CPAA 2OOTA 3GQOA 5FSUA 2PJ9A 2CTBA 3D7FA 4P45A 1Q7LA 2AFCA 4D86A 1YD9A 2PJAA 1YMEA 6CPAA 4BD9A 3K2KA 2BCOA 1Y7EA 3TX8A 3H8EA 3Q71A 4TU0A 3CPXA 3LMSA 2AFZA 4PPZA 4X3RA 2PJ7A 4MRIA 2ZEDA 1Z5RA 4P6YA 2ZENA 2G9DA 2GLFA 2NSMA 2CF4A 3NFZA 2JBJA 1HEEA 5FSZA 3GUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V45 A;  4ZI6 A;  2BFQ A;  4MHY A;  4P10 A;  3D7G A;  2J9A A;  4JVV A;  4X2T A;  4R8F A;  4UEZ A;  2XEI A;  5LRK A;  4MMO A;  3SIH A;  2Q51 A;  3RBU A;  8CPA A;  3FX6 A;  7CPA A;  3SJE A;  1QQ9 A;  4P4J A;  3KQZ A;  3EJF A;  2HB6 A;  5THW A;  3JRU A;  4OC2 A;  2GRE A;  5LYF A;  2V77 A;  3FJU A;  2I3C A;  4OID A;  1LOK A;  3PB9 X;  3PB8 X;  5K8M A;  1Y0Y A;  4IK2 A;  3SI2 A;  3LWU A;  3KI9 A;  5LRJ A;  3KR5 A;  4UEE A;  2PJ8 A;  4KYB A;  3NA6 A;  2Q4Z A;  2PVV A;  3D7H A;  5LRG A;  5E3B A;  4ZY0 A;  3D4U A;  4F9V A;  1FNO A;  1XJO A;  1UWY A;  3FEE A;  3PBE A;  4ONW A;  4NGT A;  3IO1 A;  3WC7 A;  4OC4 A;  1LCP A;  2ZEH A;  3KQX A;  2QJ8 A;  3HLP A;  4JLL A;  2AFM A;  1CBX A;  4PXB A;  4OC1 A;  3VH9 A;  5CBM A;  2XEJ A;  1F2P A;  3NH4 A;  4UML A;  2IJZ A;  1ZG9 A;  2C6C A;  4ABL A;  3B2Y A;  5K8P A;  2QVP A;  4R7M A;  3KHX A;  1DE4 C;  3PB6 X;  1ARM A;  3TC8 A;  4J4Z A;  2Q43 A;  4MXU A;  3EW5 A;  4EWT A;  5K8O A;  2WZN A;  2GLJ A;  4J5R A;  1KWM A;  4GM5 A;  2CTC A;  3VFQ A;  5CMS A;  3PB7 X;  1XMB A;  3KL9 A;  1PCA A;  2PJC A;  1AMP A;  2GU2 A;  5JGF A;  1SPV A;  2XD7 A;  3PEI A;  4IQY A;  3BXM A;  2AFW A;  1H8L A;  1NSA A;  3BI1 A;  4P44 A;  5AIL A;  2ACF A;  3B3C A;  2JEW A;  2VL1 A;  1ZR5 A;  1M4L A;  2C6P A;  4NGQ A;  4F9U A;  1LAM A;  4P4I A;  3S9M A;  3QNV A;  3DLJ A;  4OIW A;  5FSY A;  2ZEF A;  1R43 A;  3D67 A;  4X8I A;  2PJ6 A;  4JYW A;  3FF3 A;  1TXZ A;  3VAT A;  3SJX A;  5HVH A;  3KZW A;  4PXE A;  3B35 A;  3BHX A;  4UF4 A;  2FG1 A;  4YWY A;  5ELY A;  2V8D A;  2ZEM A;  4NFR A;  5CB5 A;  3B7I A;  2CIJ A;  2OR4 A;  1TF8 A;  3S9L A;  3ISZ A;  2ZEO A;  2IQ6 A;  3IID A;  1YW6 A;  1OBR A;  2NYQ A;  3ISX A;  5JH9 A;  2O4H A;  4P4E A;  1F57 A;  1IGB A;  5D8N A;  3SJF A;  1F2O A;  3IWW A;  2PJ3 A;  3SIJ A;  4YU9 A;  2AFS A;  2L8R A;  5HXD A;  2ZEL A;  4NGS A;  3ETI A;  4P4F A;  1CX8 A;  4NGR A;  3FED A;  3H8G A;  3D7D A;  1CP6 A;  1TKJ A;  3RAM A;  3WT4 A;  5IB9 A;  4R6T A;  5HOL A;  4O23 A;  4P4B A;  1CP7 A;  4MHP A;  4DUK A;  4FWU A;  2AFU A;  5LYD A;  4NJR A;  3B3V A;  4P4D A;  1YLO A;  2PCU A;  1TF9 A;  4GVV A;  2PJ0 A;  4JGK A;  5HVG A;  3EWR A;  2X47 A;  5HIH A;  3PRT A;  4OP4 A;  1ZG8 A;  4DYO A;  4ZY1 A;  2PJ2 A;  4OME A;  3S9N A;  1BLL E;  1BAV A;  1HJZ A;  3GPG A;  1Z8L A;  2PJB A;  4UIB A;  3SJG A;  2C1C A;  3FEC A;  2WYR A;  1LFW A;  2XEG A;  2V8V A;  4AXV A;  4J5Q A;  4F8Z A;  2FAV A;  4PQA A;  2ZOF A;  4WWV A;  1BPN A;  1LAN A;  1TKH A;  4GUA A;  5FSX A;  2F7V A;  2O53 A;  4NGN A;  4TWE A;  2V8G A;  5LYI A;  4NGP A;  1VHU A;  1YW4 A;  1GYT A;  3WAB A;  1ZR3 A;  3IIF A;  1ELM P;  3Q6Z A;  1FT7 A;  1Y0R A;  2PJ5 A;  2BFR A;  1IY7 A;  2ANP A;  4IHM A;  3WC6 A;  4NJQ A;  2BO9 A;  1EE3 P;  4NGM A;  4TNU A;  3WC5 A;  3EKE A;  3MN8 A;  1TXR A;  4R76 A;  3GPQ A;  3NH8 A;  3I1U A;  3CDX A;  2ZEE A;  1CPS A;  2EK8 A;  3HUV A;  2LGR A;  3KR4 A;  5CB3 A;  4JZ0 A;  2PIY A;  3IIB A;  2EEE A;  3PFE A;  3KAS A;  3CPA A;  2FVG A;  3FH4 A;  2ZEG A;  4ZX8 A;  4JCA A;  1XBU A;  3K9T A;  4OC3 A;  4IAV A;  4G1P A;  1LAP A;  4ETK A;  2AFO A;  2ZEP A;  5DUS A;  4KSI A;  1XRY A;  3KHZ A;  3SI0 A;  5F09 A;  4UEF A;  5I4M A;  3DGV A;  4MHZ A;  5K8N A;  4W9Y A;  2AFX A;  4DJL A;  1YSJ A;  1VGY A;  1VHO A;  4MCP A;  1TY8 A;  1VHE A;  1AYE A;  4PXC A;  2ZOG A;  4A38 A;  2V8H A;  3EJG A;  4MCS A;  4Q7A A;  4ESS A;  5HVF A;  5LYL A;  2DX6 A;  3V38 A;  2PIZ A;  3NH5 A;  5JM6 A;  3PB4 X;  3IJ3 A;  2QYV A;  3MRU A;  1Z2L A;  2PVW A;  4B6Z A;  2EWB A;  5J1Q A;  4UIA A;  4FUU A;  1ARL A;  3SIG A;  3GQE A;  2FXK A;  1XFO A;  1CPX A;  4CPA A;  4OKO A;  3EWQ A;  2XEF A;  4PXD A;  4WJB A;  4A37 A;  1BPM A;  4K0C A;  3IC1 A;  3EWO A;  3IEH A;  3L2N A;  3IFE A;  4K3N A;  4MHN A;  1HDQ A;  4GVW A;  3CT9 A;  4OC5 A;  3D66 A;  4H2K A;  4EME A;  4RUH A;  1ZG7 A;  3V7Z A;  3KGQ A;  3EWP A;  2C6G A;  3GB0 A;  3H8F A;  3V2B A;  1VIX A;  3GPO A;  5FSV A;  1PYT B;  4MCQ A;  4J5S A;  2DEA A;  3B3W A;  1R3N A;  2IMO A;  1QMU A;  2PE3 A;  3FVL A;  3PFO A;  1JQG A;  3D68 A;  2JBK A;  2RFH A;  4OC0 A;  2F8H A;  4A94 A;  2EK9 A;  4ETJ A;  2PRQ A;  3T8W A;  1RTQ A;  1ELL P;  1NJR A;  3BI0 A;  5DS0 A;  2BOA A;  1ZLI A;  3PBB A;  3GLJ A;  1TKF A;  3B3S A;  4LQG A;  4EFD A;  3B3T A;  1HDU A;  4ZX9 A;  3FMC A;  3N5F A;  2POK A;  2VRI A;  3RZA A;  2RB7 A;  1ZLH A;  4Z65 A;  3SII A;  4FAI A;  4FBE A;  4A39 A;  4ZYQ A;  4ZY2 A;  2PJ1 A;  1DTD A;  2PJ4 A;  2HC9 A;  3VAR A;  1CG2 A;  3JZT A;  3SI1 A;  4MCR A;  4ABK A;  2ABZ A;  5D29 A;  5CPA A;  2OOT A;  3GQO A;  5FSU A;  2PJ9 A;  2CTB A;  3D7F A;  4P45 A;  1Q7L A;  2AFC A;  4D86 A;  1YD9 A;  2PJA A;  1YME A;  6CPA A;  4BD9 A;  3K2K A;  2BCO A;  1Y7E A;  3TX8 A;  3H8E A;  3Q71 A;  4TU0 A;  3CPX A;  3LMS A;  2AFZ A;  4PPZ A;  4X3R A;  2PJ7 A;  4MRI A;  2ZED A;  1Z5R A;  4P6Y A;  2ZEN A;  2G9D A;  2GLF A;  2NSM A;  2CF4 A;  3NFZ A;  2JBJ A;  1HEE A;  5FSZ A;  3GUX A; 
#chains in the Genus database with same CATH topology
 2GIV A;  1X10 A;  3TTH A;  3V45 A;  4ZI6 A;  2BFQ A;  4MHY A;  4NSQ A;  4P10 A;  3D7G A;  1NMT A;  4BMH A;  4IF5 A;  2J9A A;  4JVV A;  4X2T A;  3D3S A;  5IV0 A;  2JZE A;  3DR6 A;  4R8F A;  4UEZ A;  5AG7 A;  2XEI A;  5LRK A;  4MMO A;  3SIH A;  2Q51 A;  3RBU A;  3DNS A;  8CPA A;  3FX6 A;  4UCN A;  7CPA A;  4I49 A;  2Q7B A;  1QQ9 A;  4P4J A;  3SJE A;  2FXF A;  3KQZ A;  3EJF A;  2YNC A;  2Q4Y A;  2B5G B;  2HB6 A;  3JRU A;  5THW A;  4OC2 A;  2GRE A;  3FRM A;  4CRZ B;  5LYF A;  2J8N A;  4QVT A;  2V77 A;  3FJU A;  2I3C A;  4OID A;  1LOK A;  3PB9 X;  1XOV A;  3PB8 X;  1Y0Y A;  5K8M A;  2G3T A;  1Y9K A;  4GXH A;  4IK2 A;  3SI2 A;  5KTA A;  3S6F A;  3LWU A;  4H6U A;  3KI9 A;  4JWP A;  4MI4 A;  4OAE A;  5LRJ A;  4CAV A;  3KR5 A;  4UEE A;  2PJ8 A;  2PSW A;  3FYN A;  5BWA B;  4KYB A;  3NA6 A;  3RYO A;  2Q4Z A;  2PVV A;  3D7H A;  5LRG A;  5E3B A;  4ZY0 A;  2Y0M A;  1XEB A;  1I21 A;  2ZW4 A;  4M6I A;  3D4U A;  4F9V A;  4C2Y A;  1FNO A;  3LD2 A;  2G3A A;  1XJO A;  1UWY A;  4XPD B;  3CXQ A;  4F0Y A;  3FEE A;  3PBE A;  4ONW A;  4C7I A;  2P6F A;  4NGT A;  1LRZ A;  1S7N A;  3IO1 A;  3WC7 A;  4OC4 A;  4CRY B;  1Y9W A;  1LCP A;  2ZEH A;  3S6H A;  3KQX A;  2QJ8 A;  3HLP A;  4JLL A;  3TCV A;  5IB0 A;  2AFM A;  1CBX A;  4PXB A;  4OC1 A;  2G0B A;  2J8M A;  3VH9 A;  4RI1 A;  2GE3 A;  2Z11 A;  5CBM A;  4Y49 B;  2XEJ A;  4CYO A;  2Q04 A;  3SHP A;  1F2P A;  3NH4 A;  4UML A;  2IJZ A;  1ZG9 A;  2C6C A;  3S6G A;  4EVY A;  4ABL A;  3B2Y A;  5K8P A;  4CYN A;  3EXN A;  4XNH C;  1NE9 A;  2QVP A;  4R7M A;  2YND A;  3KHX A;  4C7H A;  1PU9 A;  2VXK A;  2BUE A;  5G1Z A;  1S5K A;  3S6K A;  1DE4 C;  1QSM A;  4RS2 A;  4A30 A;  1X12 A;  2VZZ A;  3PB6 X;  1ARM A;  1Q2C A;  3K9U A;  2D4O A;  3P2F A;  3TC8 A;  4J4Z A;  2Q43 A;  4MXU A;  3EW5 A;  4EWT A;  4JD6 A;  4LX9 A;  1Z8T A;  5K8O A;  2FIW A;  4ZGY B;  2WZN A;  2ODF A;  4HNY B;  2GLJ A;  4J5R A;  1KWM A;  2AJ6 A;  1PUA A;  2JLM A;  4GM5 A;  1IU8 A;  4MFJ A;  2JZF A;  2CTC A;  3VFQ A;  5CMS A;  3PB7 X;  1XMB A;  3KL9 A;  1PCA A;  2D4P A;  2PJC A;  2Z3M A;  1AMP A;  2PR1 A;  2GU2 A;  5JGF A;  1SPV A;  2XD7 A;  5J8F A;  3PEI A;  4IQY A;  3BXM A;  1BO4 A;  2AFW A;  1QSR A;  1H8L A;  1NSA A;  2Q44 A;  2H5M A;  3BI1 A;  2VBQ A;  4P44 A;  5AIL A;  4QBJ A;  1KUV A;  2ACF A;  1S7F A;  1ZR5 A;  1M4L A;  1CJW A;  2A4N A;  2JEW A;  2R1I A;  2VL1 A;  2C6P A;  2B3V A;  4HPS A;  4NGQ A;  4QC6 A;  2BSW A;  4CGN A;  4PV6 A;  4F9U A;  2CNT A;  2JEV A;  1LAM A;  4UWI A;  4P4I A;  4UCP A;  4AVB A;  4A2Z A;  4JJX A;  3S9M A;  3QNV A;  3PZJ A;  3LAC A;  3DLJ A;  4HKF A;  4OIW A;  5FSY A;  2ZEF A;  3VWE A;  1R43 A;  3D67 A;  4MHD A;  4X8I A;  2PJ6 A;  5GCN A;  1Z4E A;  4OAD A;  4JYW A;  3FF3 A;  2EVN A;  1TXZ A;  3VAT A;  2ZXV A;  3SJX A;  5HVH A;  1A2Z A;  3EC4 A;  3TO6 A;  3KZW A;  4KOU A;  4PXE A;  3B35 A;  3BHX A;  2EO8 A;  2I00 A;  2Z0Z A;  4UF4 A;  2B4D B;  1BOB A;  2FG1 A;  3G3S A;  4MY3 A;  5ELY A;  1M4D A;  4YWY A;  2V8D A;  4KOV A;  4C2X A;  2YGW A;  2Z3O A;  2ZEM A;  4NFR A;  2FL4 A;  1S3Z A;  4XPD C;  5CB5 A;  4CS0 B;  4AB7 A;  2X7B A;  3B7I A;  4KVX A;  4MFQ A;  5DWN A;  2CIJ A;  2OR4 A;  3CXS A;  2B5G A;  1TF8 A;  3S9L A;  2FIA A;  2ZEO A;  3ISZ A;  1SQH A;  2IQ6 A;  3IID A;  1YW6 A;  2PC1 A;  4M6H A;  2Z3L A;  1OBR A;  2QIR A;  2CNS A;  2NYQ A;  3D2M A;  3ISX A;  4R3K A;  1YX0 A;  3TO7 A;  3OWC A;  3TE4 A;  1S60 A;  1FY7 A;  3B8G A;  4UA3 A;  2O4H A;  4P4E A;  5I0C A;  1F57 A;  4A32 A;  1IGB A;  4Y49 C;  5JH9 A;  5EC4 A;  5D8N A;  3SJF A;  1F2O A;  4F6A A;  4KSF A;  3IWW A;  2PDO A;  2PJ3 A;  4MY0 A;  3SIJ A;  4YU9 A;  2AFS A;  2L8R A;  5HXD A;  2ZEL A;  4NGS A;  3ETI A;  4CAF A;  4P4F A;  2EUI A;  1CX8 A;  3GYA A;  3FED A;  4NGR A;  3CZX A;  3H8G A;  3D7D A;  4KOS A;  4QUS A;  3IU1 A;  1CP6 A;  1TKJ A;  1YGH A;  5HH1 A;  3RAM A;  3WT4 A;  3H4Q A;  5IB9 A;  4KVO E;  4R6T A;  5HOL A;  4O23 A;  4P4B A;  1CP7 A;  3TOA A;  4MHP A;  4DUK A;  4B13 A;  1M4G A;  4FWU A;  1XMT A;  2AFU A;  2VI7 A;  4J3G A;  4KS9 A;  4NJR A;  5LYD A;  4C2Z A;  3D2P A;  3B3V A;  4P4D A;  1YLO A;  3R95 A;  2PCU A;  3IU2 A;  1IOI A;  1XE4 A;  3VWD A;  1TF9 A;  4GVV A;  4MFZ A;  2OH1 A;  2PJ0 A;  4JGK A;  1U6M A;  5HVG A;  3EWR A;  1IYL A;  2Q7S A;  1R57 A;  2X47 A;  5HIH A;  2KQV A;  2VEZ A;  3H5Z A;  2JDC A;  4OLL A;  3PRT A;  4KOT A;  4KOX A;  4OP4 A;  3NE7 A;  3T9Y A;  4GS4 A;  1B87 A;  3DR8 A;  1ZG8 A;  3TFY A;  4DYO A;  4C68 A;  4ZY1 A;  2PJ2 A;  5A27 A;  4OME A;  3S9N A;  1BLL E;  4B14 A;  3EO4 A;  1MJB A;  1B6B A;  2ATR A;  3EFA A;  1BAV A;  3F0A A;  1HJZ A;  5C82 A;  2RC4 A;  3IWE A;  3GPG A;  1Z8L A;  2FE7 A;  1YK3 A;  2PJB A;  4M3S A;  4ORF A;  4UIB A;  4NCZ A;  3SJG A;  2C1C A;  3FEC A;  2WYR A;  2BEI A;  2IL4 A;  1LFW A;  2XEG A;  2CY2 A;  2DF5 A;  2V8V A;  1AUG A;  1YRE A;  4KVM E;  4YRH A;  1XIX A;  4AXV A;  4J5Q A;  2ZW7 A;  2NMT A;  4F8Z A;  2FAV A;  4UBR A;  4Q36 A;  4PQA A;  3RNZ A;  4KLW A;  3ZZI A;  2ZOF A;  1I12 A;  2JZD A;  4WWV A;  4MFK A;  3PP9 A;  1WWZ A;  4R9M A;  1BPN A;  4L8A A;  4UFX A;  1P0H A;  1LAN A;  1TKH A;  1Y7R A;  4KLV A;  1IID A;  4GUA A;  2PRB A;  5FSX A;  4QB9 A;  2F7V A;  4UFV A;  4KZT A;  2O53 A;  4NGN A;  2J8R A;  2WPX A;  3I3G A;  1RO5 A;  2V8G A;  3GY9 A;  4FD6 A;  4TWE A;  4NGP A;  5LYI A;  4F0X A;  1VHU A;  1GHE A;  1YW4 A;  3FBU A;  4CAW A;  1GYT A;  5F48 A;  1ZR3 A;  3WAB A;  4CYQ A;  4DNC A;  3IIF A;  4A33 A;  1ELM P;  3Q6Z A;  1FT7 A;  1Y0R A;  2B4D A;  2K5T A;  2PJ5 A;  2BFR A;  5EBV A;  4B5P B;  4CGM A;  1K4J A;  1IY7 A;  2ANP A;  4KUA A;  3R9G A;  1XF8 A;  4IHM A;  4R57 A;  1MJ9 A;  3WC6 A;  4NJQ A;  2BO9 A;  1EE3 P;  1IIC A;  4NGM A;  2ZW5 A;  4TNU A;  3WC5 A;  3EKE A;  2JDD A;  2OU2 A;  3C26 A;  3JVN A;  3MN8 A;  1TXR A;  4R76 A;  3E0K A;  3GPQ A;  3NH8 A;  3I1U A;  5DWM A;  3CDX A;  2ZEE A;  3R9E A;  1MJA A;  1YVO A;  3A9L A;  2VQY A;  1CPS A;  2EK8 A;  1I1D A;  4CYP A;  3W91 A;  3HUV A;  2LGR A;  3KR4 A;  2CXA A;  5F47 A;  4B5O A;  5CB3 A;  5G20 A;  5E96 A;  4JZ0 A;  2PIY A;  3IIB A;  2EEE A;  2FCK A;  3I9S A;  5ISV A;  3PFE A;  5F49 A;  3KAS A;  3CPA A;  3W6X A;  2FVG A;  3FH4 A;  2ZEG A;  4ZX8 A;  4UWJ A;  4JCA A;  4BIN A;  3KKW A;  4MFP A;  3DDD A;  1XBU A;  3K9T A;  4OC3 A;  4MJ8 A;  1M44 A;  3SXN A;  1Q2Y A;  4IAV A;  3QB8 A;  2AE6 A;  4G1P A;  4PSW A;  1LAP A;  3JUW A;  4FD4 A;  1QSN A;  4RN7 A;  5G22 A;  4ETK A;  2P0W A;  3LOD A;  2AFO A;  2PR8 A;  2ZEP A;  3V8I A;  5DUS A;  2BL1 A;  4AVA A;  4KSI A;  1XRY A;  3KHZ A;  2Q0Y A;  4AG7 A;  4CAX A;  1M1D A;  1P4N A;  5H84 A;  3SI0 A;  5F46 A;  4UEF A;  5F09 A;  5I4M A;  4U5Y A;  4MFL A;  5IX3 A;  3DGV A;  2F5I A;  3SXO A;  2Z10 A;  4MHZ A;  4R3L A;  5K8N A;  2WCT A;  4W9Y A;  2AFX A;  4DJL A;  2REE A;  1J4J A;  4FD7 A;  1YSJ A;  2Z3P A;  4R87 A;  1VGY A;  1VHO A;  1Z4R A;  4CGP A;  4MCP A;  5AG6 A;  3G8W A;  2P6E A;  5G21 A;  1Z8X A;  4LQ6 A;  3GIU A;  1TY8 A;  4YFJ A;  1YVK A;  1YR0 A;  1VHE A;  1AYE A;  2HV2 A;  2O28 A;  2ZOG A;  4PXC A;  1S7K A;  4A38 A;  2V8H A;  3EJG A;  4ONU A;  4MCS A;  2FSR A;  3N7Z A;  4MBU A;  4Q7A A;  4ESS A;  5HVF A;  2R98 A;  2DX6 A;  5LYL A;  1QSO A;  3V38 A;  2PIZ A;  3NH5 A;  5JM6 A;  3PB4 X;  3IJ3 A;  2QYV A;  3MRU A;  4K30 A;  1Z2L A;  2VZY A;  2PVW A;  4CGO A;  4ZBG A;  3FIX A;  4B6Z A;  2EWB A;  2R7H A;  4H89 A;  2WPW A;  3W6S A;  5J1Q A;  4UIA A;  4FUU A;  1ARL A;  3SIG A;  2GFQ A;  4CAE A;  3GQE A;  5JPH A;  2FXK A;  1XFO A;  1Z8W A;  1CPX A;  2OZG A;  3R1K A;  4CPA A;  4M85 A;  4OKO A;  4E0A A;  2GAN A;  3EWQ A;  2XEF A;  1QST A;  4KOY A;  1S7L A;  4PXD A;  4KSA A;  3P2H A;  3FXT A;  4WJB A;  4A37 A;  1BPM A;  4K0C A;  4U9Y A;  1MK4 A;  3IC1 A;  3EWO A;  3IEH A;  3L2N A;  4XPL A;  3IFE A;  3TT2 A;  4K3N A;  3PGP A;  2WUU A;  2Z3N A;  3NE8 A;  4B11 A;  3BLN A;  1HDQ A;  4MHN A;  4GVW A;  3CT9 A;  2DPT A;  4OC5 A;  3D66 A;  4H2K A;  4A31 A;  4EME A;  2B3U A;  4RUH A;  1ZG7 A;  2R8V A;  3F8K A;  3ZJ0 A;  3V7Z A;  4BBH A;  3KGQ A;  3EWP A;  2C6G A;  3GB0 A;  1YLE A;  5HMN A;  2FS5 A;  3H8F A;  3V2B A;  1VIX A;  1IOF A;  3GPO A;  1L0C A;  2B58 A;  5FSV A;  1PYT B;  4MCQ A;  3UY5 A;  4Q38 A;  4B5P A;  4J5S A;  1VKC A;  4B12 A;  3RO0 A;  1JWQ A;  2DEA A;  3B3W A;  1R3N A;  5CNP A;  3T90 A;  1M4I A;  4M6G A;  2IMO A;  1QMU A;  2PE3 A;  3FVL A;  2RNK A;  3PFO A;  5EMI A;  1Z9U A;  5KTD A;  1JQG A;  3DSB A;  2I79 A;  3D68 A;  2JBK A;  2KCW A;  2RFH A;  1IYK A;  4OC0 A;  2F8H A;  2REF A;  4A94 A;  4NXY A;  4KUB A;  2CNM A;  3F5B A;  2EK9 A;  4ETJ A;  4L89 A;  5A28 A;  2PRQ A;  5FVJ A;  3T8W A;  1RTQ A;  2FT0 A;  4JXQ A;  1ELL P;  1NJR A;  4LUA A;  4NEX A;  4NF1 A;  3BI0 A;  1KUY A;  2EBJ A;  3IGR A;  5DS0 A;  2BOA A;  1ZLI A;  3PBB A;  3GLJ A;  1TKF A;  3B3S A;  1N71 A;  2HUZ A;  1OZP A;  4HNW B;  4LQG A;  3B3T A;  4X5K A;  4EFD A;  3B3C A;  1HDU A;  1RXT A;  5AGE A;  4ZX9 A;  3FMC A;  3N5F A;  2POK A;  4JLY A;  4KOW A;  2VRI A;  3RZA A;  2RB7 A;  1ZLH A;  4Z65 A;  3SII A;  4PSX A;  1KZF A;  4AG9 A;  4FAI A;  4PK2 A;  4FBE A;  4UCM A;  4A39 A;  4ZYQ A;  4ZY2 A;  2PJ1 A;  1DTD A;  2PJ4 A;  4A95 A;  2HC9 A;  3VAR A;  1ON0 A;  1CG2 A;  2WSA A;  2Z3K A;  4XPK A;  4H6Z A;  4E8O A;  2OZU A;  3TO9 A;  5C88 A;  2Q4V A;  5KTC A;  3JZT A;  2P6G A;  2ARH A;  4JXR A;  1NSL A;  3SI1 A;  4MCR A;  1VHS A;  3FNC A;  4ABK A;  2ABZ A;  3BJ7 A;  5D29 A;  1YQE A;  3EY5 A;  3JTK A;  5CPA A;  2OOT A;  3GQO A;  4UFW A;  5FSU A;  2PJ9 A;  4II9 A;  2CTB A;  4U9Z A;  1IB1 E;  3GKR A;  3R96 A;  4XNH B;  4CGL A;  3D7F A;  2B4B A;  3D8P A;  3WR7 A;  1WK4 A;  3FB3 A;  2OZH A;  4P45 A;  1Q7L A;  2AFC A;  2YNE A;  4YGO A;  4D86 A;  2OB0 A;  3R9F A;  1YD9 A;  2PJA A;  5AG5 A;  4IUS A;  3MGD A;  3QAY A;  3BJ8 A;  5H86 A;  1YME A;  6CPA A;  5J8C A;  1CM0 A;  4BD9 A;  3K2K A;  2BCO A;  4AVC A;  1Y7E A;  3TX8 A;  1KUX A;  2QML A;  3H8E A;  1UFH A;  4KOR A;  3CXP A;  1Q2D A;  1V0C A;  2DXQ A;  4FD5 A;  3Q71 A;  4TU0 A;  2HQY A;  2YNC C;  2AFZ A;  3CPX A;  3IWG A;  3LMS A;  4PPZ A;  4X3R A;  3TOB A;  2QEC A;  2PJ7 A;  5AG4 A;  2DPS A;  4HNX B;  2W2G A;  4MRI A;  2ZED A;  1Z5R A;  1ZO0 A;  4P6Y A;  4B10 A;  2ZEN A;  4PK3 A;  2G9D A;  2GLF A;  2C27 A;  2NSM A;  2ZPA A;  1TIQ A;  2ZW6 A;  2CF4 A;  2PQ8 A;  4E2A A;  5JQ4 A;  3NFZ A;  2JBJ A;  1HEE A;  3QAH A;  5FSZ A;  3GUX A; 
#chains in the Genus database with same CATH homology
 3V45 A;  4ZI6 A;  2BFQ A;  4MHY A;  4P10 A;  3D7G A;  2J9A A;  4JVV A;  4X2T A;  4R8F A;  4UEZ A;  2XEI A;  5LRK A;  4MMO A;  3SIH A;  2Q51 A;  3RBU A;  8CPA A;  3FX6 A;  7CPA A;  3SJE A;  1QQ9 A;  4P4J A;  3KQZ A;  3EJF A;  2HB6 A;  5THW A;  3JRU A;  4OC2 A;  2GRE A;  5LYF A;  2V77 A;  3FJU A;  2I3C A;  4OID A;  1LOK A;  3PB9 X;  3PB8 X;  5K8M A;  1Y0Y A;  4IK2 A;  3SI2 A;  3LWU A;  3KI9 A;  5LRJ A;  3KR5 A;  4UEE A;  2PJ8 A;  4KYB A;  3NA6 A;  2Q4Z A;  2PVV A;  3D7H A;  5LRG A;  5E3B A;  4ZY0 A;  3D4U A;  4F9V A;  1FNO A;  1XJO A;  1UWY A;  3FEE A;  3PBE A;  4ONW A;  4NGT A;  3IO1 A;  3WC7 A;  4OC4 A;  1LCP A;  2ZEH A;  3KQX A;  2QJ8 A;  3HLP A;  4JLL A;  2AFM A;  1CBX A;  4PXB A;  4OC1 A;  3VH9 A;  5CBM A;  2XEJ A;  1F2P A;  3NH4 A;  4UML A;  2IJZ A;  1ZG9 A;  2C6C A;  4ABL A;  3B2Y A;  5K8P A;  2QVP A;  4R7M A;  3KHX A;  1DE4 C;  3PB6 X;  1ARM A;  3TC8 A;  4J4Z A;  2Q43 A;  4MXU A;  3EW5 A;  4EWT A;  5K8O A;  2WZN A;  2GLJ A;  4J5R A;  1KWM A;  4GM5 A;  2CTC A;  3VFQ A;  5CMS A;  3PB7 X;  1XMB A;  3KL9 A;  1PCA A;  2PJC A;  1AMP A;  2GU2 A;  5JGF A;  1SPV A;  2XD7 A;  3PEI A;  4IQY A;  3BXM A;  2AFW A;  1H8L A;  1NSA A;  3BI1 A;  4P44 A;  5AIL A;  2ACF A;  3B3C A;  2JEW A;  2VL1 A;  1ZR5 A;  1M4L A;  2C6P A;  4NGQ A;  4F9U A;  1LAM A;  4P4I A;  3S9M A;  3QNV A;  3DLJ A;  4OIW A;  5FSY A;  2ZEF A;  1R43 A;  3D67 A;  4X8I A;  2PJ6 A;  4JYW A;  3FF3 A;  1TXZ A;  3VAT A;  3SJX A;  5HVH A;  3KZW A;  4PXE A;  3B35 A;  3BHX A;  4UF4 A;  2FG1 A;  4YWY A;  5ELY A;  2V8D A;  2ZEM A;  4NFR A;  5CB5 A;  3B7I A;  2CIJ A;  2OR4 A;  1TF8 A;  3S9L A;  3ISZ A;  2ZEO A;  2IQ6 A;  3IID A;  1YW6 A;  1OBR A;  2NYQ A;  3ISX A;  5JH9 A;  2O4H A;  4P4E A;  1F57 A;  1IGB A;  5D8N A;  3SJF A;  1F2O A;  3IWW A;  2PJ3 A;  3SIJ A;  4YU9 A;  2AFS A;  2L8R A;  5HXD A;  2ZEL A;  4NGS A;  3ETI A;  4P4F A;  1CX8 A;  4NGR A;  3FED A;  3H8G A;  3D7D A;  1CP6 A;  1TKJ A;  3RAM A;  3WT4 A;  5IB9 A;  4R6T A;  5HOL A;  4O23 A;  4P4B A;  1CP7 A;  4MHP A;  4DUK A;  4FWU A;  2AFU A;  5LYD A;  4NJR A;  3B3V A;  4P4D A;  1YLO A;  2PCU A;  1TF9 A;  4GVV A;  2PJ0 A;  4JGK A;  5HVG A;  3EWR A;  2X47 A;  5HIH A;  3PRT A;  4OP4 A;  1ZG8 A;  4DYO A;  4ZY1 A;  2PJ2 A;  4OME A;  3S9N A;  1BLL E;  1BAV A;  1HJZ A;  3GPG A;  1Z8L A;  2PJB A;  4UIB A;  3SJG A;  2C1C A;  3FEC A;  2WYR A;  1LFW A;  2XEG A;  2V8V A;  4AXV A;  4J5Q A;  4F8Z A;  2FAV A;  4PQA A;  2ZOF A;  4WWV A;  1BPN A;  1LAN A;  1TKH A;  4GUA A;  5FSX A;  2F7V A;  2O53 A;  4NGN A;  4TWE A;  2V8G A;  5LYI A;  4NGP A;  1VHU A;  1YW4 A;  1GYT A;  3WAB A;  1ZR3 A;  3IIF A;  1ELM P;  3Q6Z A;  1FT7 A;  1Y0R A;  2PJ5 A;  2BFR A;  1IY7 A;  2ANP A;  4IHM A;  3WC6 A;  4NJQ A;  2BO9 A;  1EE3 P;  4NGM A;  4TNU A;  3WC5 A;  3EKE A;  3MN8 A;  1TXR A;  4R76 A;  3GPQ A;  3NH8 A;  3I1U A;  3CDX A;  2ZEE A;  1CPS A;  2EK8 A;  3HUV A;  2LGR A;  3KR4 A;  5CB3 A;  4JZ0 A;  2PIY A;  3IIB A;  2EEE A;  3PFE A;  3KAS A;  3CPA A;  2FVG A;  3FH4 A;  2ZEG A;  4ZX8 A;  4JCA A;  1XBU A;  3K9T A;  4OC3 A;  4IAV A;  4G1P A;  1LAP A;  4ETK A;  2AFO A;  2ZEP A;  5DUS A;  4KSI A;  1XRY A;  3KHZ A;  3SI0 A;  5F09 A;  4UEF A;  5I4M A;  3DGV A;  4MHZ A;  5K8N A;  4W9Y A;  2AFX A;  4DJL A;  1YSJ A;  1VGY A;  1VHO A;  4MCP A;  1TY8 A;  1VHE A;  1AYE A;  4PXC A;  2ZOG A;  4A38 A;  2V8H A;  3EJG A;  4MCS A;  4Q7A A;  4ESS A;  5HVF A;  5LYL A;  2DX6 A;  3V38 A;  2PIZ A;  3NH5 A;  5JM6 A;  3PB4 X;  3IJ3 A;  2QYV A;  3MRU A;  1Z2L A;  2PVW A;  4B6Z A;  2EWB A;  5J1Q A;  4UIA A;  4FUU A;  1ARL A;  3SIG A;  3GQE A;  2FXK A;  1XFO A;  1CPX A;  4CPA A;  4OKO A;  3EWQ A;  2XEF A;  4PXD A;  4WJB A;  4A37 A;  1BPM A;  4K0C A;  3IC1 A;  3EWO A;  3IEH A;  3L2N A;  3IFE A;  4K3N A;  4MHN A;  1HDQ A;  4GVW A;  3CT9 A;  4OC5 A;  3D66 A;  4H2K A;  4EME A;  4RUH A;  1ZG7 A;  3V7Z A;  3KGQ A;  3EWP A;  2C6G A;  3GB0 A;  3H8F A;  3V2B A;  1VIX A;  3GPO A;  5FSV A;  1PYT B;  4MCQ A;  4J5S A;  2DEA A;  3B3W A;  1R3N A;  2IMO A;  1QMU A;  2PE3 A;  3FVL A;  3PFO A;  1JQG A;  3D68 A;  2JBK A;  2RFH A;  4OC0 A;  2F8H A;  4A94 A;  2EK9 A;  4ETJ A;  2PRQ A;  3T8W A;  1RTQ A;  1ELL P;  1NJR A;  3BI0 A;  5DS0 A;  2BOA A;  1ZLI A;  3PBB A;  3GLJ A;  1TKF A;  3B3S A;  4LQG A;  4EFD A;  3B3T A;  1HDU A;  4ZX9 A;  3FMC A;  3N5F A;  2POK A;  2VRI A;  3RZA A;  2RB7 A;  1ZLH A;  4Z65 A;  3SII A;  4FAI A;  4FBE A;  4A39 A;  4ZYQ A;  4ZY2 A;  2PJ1 A;  1DTD A;  2PJ4 A;  2HC9 A;  3VAR A;  1CG2 A;  3JZT A;  3SI1 A;  4MCR A;  4ABK A;  2ABZ A;  5D29 A;  5CPA A;  2OOT A;  3GQO A;  5FSU A;  2PJ9 A;  2CTB A;  3D7F A;  4P45 A;  1Q7L A;  2AFC A;  4D86 A;  1YD9 A;  2PJA A;  1YME A;  6CPA A;  4BD9 A;  3K2K A;  2BCO A;  1Y7E A;  3TX8 A;  3H8E A;  3Q71 A;  4TU0 A;  3CPX A;  3LMS A;  2AFZ A;  4PPZ A;  4X3R A;  2PJ7 A;  4MRI A;  2ZED A;  1Z5R A;  4P6Y A;  2ZEN A;  2G9D A;  2GLF A;  2NSM A;  2CF4 A;  3NFZ A;  2JBJ A;  1HEE A;  5FSZ A;  3GUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...