4ZY0A

X-ray crystal structure of pfa-m17 in complex with hydroxamic acid-based inhibitor 10q
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable M17 family aminopeptidase
publication title Potent dual inhibitors of Plasmodium falciparum M1 and M17 aminopeptidases through optimization of S1 pocket interactions.
pubmed doi rcsb
source organism Plasmodium falciparum fcb1/columbia
molecule tags Hydrolase/hydrolase inhibitor
total genus 176
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4zy0A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4zy0A02
4A38A 3FVLA 3EWQA 4IK2A 3EJFA 3EJGA 4TWEA 2Q43A 4YU9A 2XD7A 1PYTB 4NFRA 4DUKA 1ELMP 1F2PA 4UEFA 3VATA 2PJ5A 1ZR3A 4Q7AA 3KGQA 1VIXA 3FMCA 1ELLP 2O53A 2PVVA 2ANPA 1TF9A 5HIHA 2Q4ZA 3IIDA 1DTDA 5JGFA 2CTCA 2PVWA 3RZAA 3EWPA 5FSVA 1TF8A 4P4BA 4X3RA 4R76A 4PXDA 3FF3A 4ZY2A 4UEZA 4J5SA 3BI0A 2PJ7A 4WJBA 1LOKA 3WC6A 3B3WA 3CPXA 3QNVA 5HOLA 4WWVA 4K3NA 3PB4X 4G1PA 1R43A 4B6ZA 7CPAA 2BOAA 2BCOA 2AFXA 3FX6A 4FBEA 2I3CA 4MRIA 4PXEA 5LRKA 3Q71A 4FWUA 3S9NA 2PJCA 3RBUA 5F09A 2PJ4A 2PJAA 3SIIA 5D29A 2CF4A 3VH9A 2AFCA 2L8RA 1BPMA 1Z8LA 4H2KA 2C1CA 5FSXA 2AFSA 1FNOA 2V8HA 1Q7LA 3EW5A 3FEDA 3B3TA 2ZEPA 3KHXA 3GPQA 4J5RA 2ZEGA 4OC2A 5CPAA 3GQEA 5LYLA 4MCPA 4OIWA 3MN8A 4J4ZA 2VL1A 1Y0YA 1TY8A 3TC8A 4NGMA 1BAVA 1VGYA 4PPZA 3IEHA 2V77A 1HJZA 2ZENA 3L2NA 1HDQA 4MHYA 4MMOA 3NH5A 4PQAA 2OR4A 1YW6A 3V7ZA 3N5FA 1XMBA 3PB7X 8CPAA 1GYTA 2C6GA 3B2YA 3KR4A 3GPGA 4RUHA 3K2KA 3K9TA 2ZOGA 3CDXA 3I1UA 4P10A 5DUSA 1UWYA 5E3BA 4JZ0A 1ARMA 3KQXA 4R8FA 4P45A 3PRTA 3BI1A 1HDUA 3D66A 4F9VA 4IAVA 5LYFA 1TKHA 1LCPA 4IHMA 3DLJA 2V8DA 3JRUA 1AYEA 3V45A 3IC1A 2EWBA 4J5QA 1TXZA 2XEGA 4F8ZA 3FECA 2CIJA 3EKEA 3BXMA 4GUAA 2OOTA 5FSZA 3B3SA 2XEFA 3SJFA 1YW4A 4NGQA 4UIBA 5D8NA 2ABZA 5CB5A 3B3VA 4OIDA 1QQ9A 2GU2A 1VHEA 4ZX9A 1IGBA 3PB9X 4ZY1A 3KASA 4ZX8A 2PJ6A 4MCQA 1Y0RA 2O4HA 3CT9A 3KQZA 3ISXA 3B7IA 2IMOA 2EEEA 3VARA 3WT4A 1ZG7A 1FT7A 4OC3A 2QVPA 3GUXA 1ZLIA 4ZYQA 1QMUA 5CBMA 1TKJA 4OMEA 3T8WA 1HEEA 4P44A 1CX8A 3SI1A 6CPAA 4ONWA 4P4DA 4OC5A 2HC9A 3KI9A 4NJQA 1LFWA 4FAIA 4A94A 1LAMA 4LQGA 2JEWA 3PFOA 2VRIA 4O23A 4JVVA 2F8HA 5K8PA 2QJ8A 4NGPA 3WABA 1YD9A 3S9LA 2BFQA 1JQGA 4P4JA 1LAPA 4W9YA 5JM6A 3SJXA 2X47A 3PB6X 1VHUA 3VFQA 4PXBA 4DJLA 3DGVA 5HXDA 5IB9A 4R7MA 1Y7EA 5I4MA 4A39A 3SIHA 1CPSA 3WC5A 5LRJA 5THWA 4TU0A 3D68A 3S9MA 1AMPA 2PRQA 1YMEA 2PIYA 2FAVA 4AXVA 1RTQA 3HUVA 3GPOA 2CTBA 2WYRA 4UMLA 4GVVA 1XJOA 3D4UA 1LANA 2PJBA 1M4LA 1SPVA 5LYIA 3IIFA 1XBUA 5K8OA 3IO1A 3KZWA 4D86A 4UF4A 3KR5A 4ABKA 2PJ3A 4JYWA 3PBEA 5K8NA 2BO9A 3EWOA 1H8LA 3SIGA 2PJ8A 4JLLA 1ZLHA 5K8MA 2IJZA 1XRYA 1ZG9A 2Q51A 3GB0A 3Q6ZA 2PJ1A 3KHZA 4P6YA 4CPAA 4GM5A 1ZG8A 4NGTA 3SI0A 5FSYA 4KSIA 4P4FA 4OKOA 3SJGA 2IQ6A 5DS0A 4MHZA 3ETIA 5J1QA 4NGSA 2ZOFA 1PCAA 3TX8A 4Z65A 2AFMA 3IFEA 4OP4A 3SJEA 3WC7A 2XEJA 3D7DA 4NJRA 5LRGA 2ZEHA 4ZY0A 1ARLA 4TNUA 1OBRA 3B35A 2ZELA 1NSAA 2F7VA 5LYDA 1TXRA 2V8VA 3IWWA 4P4IA 4MHNA 2EK8A 4MCRA 4EWTA 4GVWA 2BFRA 2RFHA 2AFOA 4ZI6A 4ESSA 4P4EA 3V2BA 2JBKA 1VHOA 1BLLE 2PJ2A 3SIJA 4MHPA 2FVGA 3PBBA 1TKFA 3GQOA 2QYVA 4DYOA 1CP7A 4UEEA 3FEEA 4KYBA 3D7HA 2GREA 2C6CA 2PJ9A 2AFWA 2C6PA 4K0CA 3H8FA 2WZNA 4BD9A 3ISZA 5ELYA 4OC0A 2DEAA 1CBXA 2ZEOA 1F2OA 2ZEDA 3PFEA 2PJ0A 1R3NA 1YSJA 3IIBA 5CMSA 2HB6A 4X2TA 4FUUA 3NH8A 4ETKA 3D67A 1NJRA 4NGRA 1Z5RA 4EFDA 3EWRA 2GLFA 3LMSA 5FSUA 4X8IA 4A37A 1CP6A 1F57A 3KL9A 4MXUA 3RAMA 4OC1A 2J9AA 5HVFA 1XFOA 4ABLA 2EK9A 3HLPA 2ZEEA 2NYQA 3SI2A 3NH4A 3H8EA 5CB3A 4EMEA 1EE3P 3FJUA 3BHXA 4YWYA 1Z2LA 3GLJA 5HVGA 2AFZA 4NGNA 1CG2A 3B3CA 3H8GA 2GLJA 3PEIA 2ZEFA 2FXKA 3D7FA 2FG1A 3FH4A 2RB7A 1YLOA 3NFZA 2PE3A 4IQYA 1KWMA 5JH9A 3NA6A 4OC4A 3IJ3A 3V38A 4MCSA 3PB8X 2XEIA 1IY7A 2LGRA 3LWUA 4JCAA 4ETJA 2G9DA 2V8GA 2ZEMA 1ZR5A 2PIZA 5HVHA 4UIAA 2PCUA 2POKA 1DE4C 2NSMA 1CPXA 5AILA 2JBJA 1BPNA 3MRUA 2ACFA 2DX6A 3D7GA 3JZTA 4PXCA 4F9UA 3CPAA 4R6TA 2AFUA 4JGKA
chains in the Genus database with same CATH superfamily
1M4IA 4C2XA 4A38A 3FVLA 3EWQA 4IK2A 2BUEA 1Z8TA 1IOIA 2BL1A 4KOSA 3EJFA 3EJGA 4TWEA 2Q7BA 2Q43A 4YU9A 2XD7A 1PYTB 4NFRA 4DUKA 3TCVA 1QSRA 1ELMP 1F2PA 4UEFA 3VATA 2P0WA 1N71A 2PJ5A 2PSWA 1ZR3A 4OADA 3D3SA 4Q7AA 3KGQA 2Q4VA 4BBHA 1VIXA 2P6GA 3FMCA 4KUAA 4CAWA 2EVNA 1ELLP 2O53A 1ZO0A 1P4NA 2PVVA 2ANPA 1TF9A 2Z3PA 5HIHA 2Q4ZA 3IIDA 1DTDA 2ZW7A 2R8VA 4ONUA 4Q36A 3S6FA 1TIQA 3VWDA 5JGFA 2CTCA 2PVWA 3RZAA 4QC6A 3BLNA 3VWEA 3EWPA 4B14A 5FSVA 1TF8A 5AG5A 2JDCA 4P4BA 3SXNA 4JXQA 4X3RA 4R76A 3RO0A 4CYPA 4PXDA 1B6BA 1PUAA 3FF3A 4ZY2A 4UEZA 5H84A 3H4QA 4J5SA 5G22A 1NSLA 3BI0A 2PJ7A 2WPWA 1M1DA 4WJBA 1I1DA 1M4GA 1LOKA 4YFJA 4A30A 1IB1E 3WC6A 3B3WA 3CPXA 3S6HA 4A31A 3QNVA 2OZGA 5HOLA 4WWVA 4K3NA 1X10A 4EVYA 3PB4X 4G1PA 3V8IA 4KSFA 1R43A 4IUSA 2R1IA 4B6ZA 7CPAA 1J4JA 2BOAA 2BCOA 5KTCA 3EO4A 2KCWA 2AFXA 1JWQA 3PZJA 2Z3OA 3FX6A 3WR7A 2I3CA 4MRIA 4PXEA 4B10A 4FBEA 5LRKA 3Q71A 2Q4YA 4M85A 2QIRA 4FWUA 4KUBA 2VZZA 5J8CA 3S9NA 2PJCA 4J3GA 5CNPA 3RBUA 5F09A 1IIDA 2PJ4A 4IF5A 2PJAA 3SIIA 4PSWA 5D29A 2CF4A 3EXNA 3VH9A 5IV0A 1S7LA 4H6UA 2VI7A 2AFCA 1LRZA 4CGLA 2YNCA 4ORFA 2L8RA 1BPMA 1Z8LA 4JD6A 4H2KA 1XF8A 1QSOA 2DPTA 4KOUA 2C1CA 5FSXA 2AFSA 1FNOA 2V8HA 4CRZB 1Q7LA 3EW5A 2QMLA 2RC4A 3EFAA 3FEDA 3B3TA 2ZEPA 4CGOA 3KHXA 1PU9A 3GPQA 4J5RA 2ZEGA 5EMIA 1M44A 4OC2A 2DPSA 5CPAA 5HMNA 1Z8XA 3GQEA 5LYLA 4MCPA 4HNXB 4OIWA 3MN8A 4J4ZA 3K9UA 4KSAA 2VZYA 5AGEA 2VL1A 4CYOA 1Y0YA 1YK3A 1MJBA 4KOYA 1TY8A 4UFWA 1KZFA 4R3KA 2PR1A 4B11A 4U9YA 2J8NA 3TC8A 3R96A 4NGMA 1BAVA 1VGYA 2FXFA 4PPZA 3IEHA 2V77A 4Q38A 3T9YA 2AE6A 1HJZA 2ZENA 4LX9A 2WSAA 5F49A 2ZPAA 3PGPA 3QB8A 4KOVA 3L2NA 1HDQA 2PRBA 4MHYA 4F0YA 4MMOA 4U5YA 2JLMA 3A9LA 1XEBA 1YW6A 2HUZA 2OR4A 3DNSA 2DXQA 3NH5A 4PQAA 3S6KA 4QVTA 3V7ZA 3S6GA 3N5FA 4B5OA 2B5GA 4KVXA 2Z3KA 5G1ZA 4F0XA 1XMBA 2YGWA 4HPSA 1Z9UA 1YVOA 3PB7X 3SHPA 3D8PA 4MFJA 4MY0A 8CPAA 1GYTA 2C6GA 3CXSA 4UWIA 3B2YA 3KR4A 4B5PB 4UCMA 3GPGA 1OZPA 4RUHA 3K2KA 3K9TA 2ZOGA 3CDXA 3I1UA 3NE8A 3F8KA 4P10A 4CAEA 2GANA 1IYLA 4FD6A 5DUSA 1UWYA 5E3BA 2FIAA 1ARMA 4JZ0A 3KQXA 1BOBA 4C2YA 4R8FA 1FY7A 4P45A 3PRTA 3BI1A 1HDUA 3D66A 3P2FA 4F9VA 1A2ZA 4IAVA 1XOVA 3N7ZA 5LYFA 1YREA 3R95A 5KTAA 4Y49C 1TKHA 1LCPA 4IHMA 3DLJA 3TO7A 2CNMA 3JRUA 1AYEA 1AUGA 2F5IA 2V8DA 3V45A 3IC1A 2EWBA 2KQVA 4J5QA 4UA3A 5AG7A 1TXZA 5AG4A 2XEGA 2Z0ZA 1YR0A 5C82A 4AVAA 4F8ZA 3FECA 4KZTA 2CIJA 4DNCA 3EKEA 3BXMA 4GUAA 2OOTA 1KUYA 3W6XA 2B4DA 5FSZA 1YLEA 3B3SA 4MHDA 2XEFA 4R9MA 4A37A 4JWPA 3SJFA 2R7HA 1YW4A 3H5ZA 4NGQA 4UIBA 5D8NA 1Y9KA 2ABZA 5CB5A 1YX0A 3B3VA 4OIDA 3ZZIA 1QQ9A 2GU2A 1VHEA 4ZX9A 1IGBA 3PB9X 3W91A 4ZY1A 3TTHA 3KASA 4ZX8A 2PJ6A 4MCQA 2B5GB 5AG6A 1Y0RA 2O4HA 3CT9A 1S7NA 1Q2YA 3KQZA 2AJ6A 3I9SA 3ISXA 4CYNA 3B7IA 1VKCA 2EEEA 1ON0A 2IMOA 2W2GA 3LODA 4KS9A 4KVME 1ZG7A 1FT7A 3TT2A 3VARA 3WT4A 2WCTA 4OC3A 3IU1A 2QVPA 1NMTA 1ZLIA 3GUXA 1Z4RA 4R87A 4ZYQA 1QMUA 5CBMA 1TKJA 4NSQA 4E2AA 1BO4A 3C26A 2ZW5A 3IU2A 5E96A 4OMEA 4AB7A 4A32A 3T8WA 1HEEA 2HV2A 3BJ8A 1XIXA 4P44A 1CX8A 3SI1A 5IX3A 6CPAA 1QSNA 1RXTA 4NCZA 4ONWA 4OC5A 4P4DA 1V0CA 2WUUA 2HC9A 3R9FA 3KI9A 4CAFA 3DR6A 4NJQA 1LFWA 5EBVA 4A94A 4FAIA 4A33A 1IICA 1LAMA 4MBUA 4LQGA 2JEWA 3GKRA 4QUSA 4MFKA 3B8GA 2YNEA 3PFOA 5GCNA 2VRIA 4O23A 4JVVA 1VHSA 2F8HA 3R9EA 4L89A 1GHEA 5K8PA 2J8MA 2EUIA 2QJ8A 4NGPA 3FYNA 3WABA 1YD9A 2FL4A 4FD4A 3S9LA 2BFQA 1JQGA 4P4JA 1YVKA 1LAPA 4W9YA 5JM6A 3CZXA 2B4DB 3ZJ0A 1Z8WA 3SJXA 3IGRA 2X47A 3PB6X 1VHUA 2Z10A 2D4OA 2HQYA 3VFQA 4PXBA 4DJLA 3DGVA 5HXDA 5IB9A 1IYKA 4XPDB 4R7MA 1Y7EA 5I0CA 4A39A 5I4MA 1I12A 4XNHC 3G8WA 3SIHA 1CPSA 2C27A 2VEZA 1Q2CA 3WC5A 4AVCA 5H86A 3FBUA 5LRJA 5THWA 4TU0A 3D68A 2PQ8A 1WWZA 1X12A 2Q7SA 5G21A 3S9MA 1AMPA 2PRQA 1YMEA 2CXAA 2PIYA 3T90A 2FAVA 4AXVA 2FE7A 3DR8A 1RTQA 2ARHA 3GPOA 3HUVA 2CTBA 5FVJA 3I3GA 4MI4A 4YGOA 2WYRA 4UMLA 2B3VA 3LACA 4GVVA 1S7FA 4NXYA 1XJOA 3D4UA 3FXTA 1LANA 5EC4A 4UWJA 2PJBA 3E0KA 1M4LA 1SPVA 5HH1A 3IWGA 5LYIA 3IIFA 1XBUA 4MJ8A 5K8OA 5ISVA 1SQHA 1KUXA 3IO1A 4AG7A 3KZWA 4D86A 4UF4A 3UY5A 2REFA 4JJXA 3KR5A 3R9GA 4OAEA 4ABKA 2ODFA 2PJ3A 1UFHA 5KTDA 1XMTA 2JZDA 2FT0A 4JYWA 3PBEA 1I21A 1S7KA 2Z3LA 2REEA 5K8NA 5C88A 2QECA 2B3UA 2BO9A 3OWCA 3F5BA 1YGHA 3EWOA 1H8LA 3SIGA 1CJWA 2PJ8A 4JLLA 4R57A 1ZLHA 5K8MA 2JEVA 1QSTA 2IJZA 1XRYA 1ZG9A 4CYQA 1R57A 2OZUA 2Q51A 3GB0A 3Q6ZA 2PJ1A 3KHZA 4M6HA 4P6YA 2PDOA 4GM5A 1ZG8A 4I49A 4NGTA 4CGPA 3SI0A 5FSYA 4CAXA 4UCNA 4OLLA 4FD5A 4C2ZA 4KSIA 2B58A 1S60A 1S5KA 2OZHA 5A28A 4PK2A 4P4FA 2Q44A 4B12A 4OKOA 4H89A 3R1KA 3SJGA 3FB3A 2IQ6A 2O28A 5DS0A 4MHZA 3ETIA 5J1QA 3JUWA 4NGSA 4C68A 2ZOFA 1PCAA 2FIWA 3D2MA 3TX8A 2R98A 4Z65A 1MJ9A 2AFMA 4PV6A 3IFEA 4OP4A 3SJEA 5JQ4A 4KLVA 3WC7A 2XEJA 3D7DA 4NJRA 4CRYB 1NE9A 5LRGA 4BMHA 2PR8A 2ZEHA 4ZY0A 1ARLA 2Z3NA 4TNUA 1OBRA 3B35A 4ZGYB 4RN7A 2ZELA 1NSAA 2F7VA 3GY9A 5LYDA 5IB0A 1TXRA 5G20A 4CAVA 3TFYA 2V8VA 3IWWA 4Y49B 4NEXA 2FCKA 4P4IA 2BSWA 4MHNA 4F6AA 2EK8A 4MFQA 4MCRA 4EWTA 4GVWA 4H6ZA 3RYOA 2WPXA 4CGNA 2BFRA 2RFHA 2AFOA 4KLWA 4ZI6A 4ESSA 2JDDA 2EBJA 1M4DA 3JTKA 1IU8A 4P4EA 3QAYA 2IL4A 4KOTA 3V2BA 2JZEA 5BWAB 2JBKA 2Q0YA 1VHOA 1BLLE 2PJ2A 3SIJA 4MHPA 2FVGA 3PBBA 4QBJA 1TKFA 4A2ZA 4MY3A 3GQOA 3P2HA 2QYVA 2CY2A 1S3ZA 3LD2A 4UFVA 4DYOA 1CP7A 3RNZA 2G3TA 4UEEA 2PC1A 2Y0MA 3FEEA 4KYBA 4QB9A 3D7HA 5F46A 4GS4A 2GREA 2C6CA 2PJ9A 2AFWA 3FRMA 5F48A 2H5MA 2JZFA 2C6PA 4K0CA 3PP9A 2P6EA 4NF1A 3H8FA 2WZNA 4BD9A 3ISZA 5ELYA 4AG9A 4OC0A 1CM0A 2DEAA 1CBXA 2ZEOA 1F2OA 2P6FA 2ZEDA 3PFEA 4XPLA 2EO8A 3GYAA 2PJ0A 2ZXVA 4HNYB 2ZW4A 3KKWA 1R3NA 1YSJA 3IIBA 3W6SA 3TOAA 1Y9WA 5CMSA 2HB6A 4GXHA 2VQYA 3TE4A 4X2TA 4XPDC 2FSRA 2ATRA 4FUUA 2CNSA 3D2PA 1B87A 3NH8A 4ETKA 3D67A 1NJRA 4UBRA 5F47A 4B13A 4NGRA 1Z5RA 4M3SA 4XPKA 2BEIA 3DDDA 2K5TA 4KVOE 4MFPA 2GFQA 3EWRA 2GLFA 2NMTA 1L0CA 3LMSA 4MFLA 1P0HA 2GIVA 4EFDA 5JPHA 4B5PA 2OU2A 5FSUA 4UFXA 3JVNA 1MK4A 4X8IA 2OH1A 1CP6A 1F57A 2Z11A 3KL9A 4MXUA 3RAMA 4OC1A 2J9AA 5HVFA 4E8OA 1XFOA 4ABLA 2G0BA 2EK9A 3FIXA 3HLPA 3SXOA 2ZEEA 2NYQA 4HNWB 3SI2A 3MGDA 2I00A 2Z3MA 3NH4A 1Z4EA 3DSBA 2CNTA 2B4BA 3CXPA 3CXQA 4KOWA 3H8EA 2J8RA 2FS5A 4L8AA 5CB3A 4KOXA 4EMEA 4CPAA 1EE3P 3FJUA 1XE4A 2I79A 3BHXA 1Z2LA 4U9ZA 4YWYA 3GLJA 4A95A 5A27A 4PK3A 4C7IA 1Y7RA 5HVGA 1RO5A 2AFZA 4NGNA 1CG2A 4YRHA 3BJ7A 2VBQA 3B3CA 4UCPA 4KORA 4JLYA 2YNCC 3TOBA 3H8GA 5DWNA 2GLJA 4XNHB 3PEIA 4MFZA 2YNDA 2ZEFA 4E0AA 2FXKA 3D7FA 2FG1A 3FH4A 3GIUA 2RB7A 4X5KA 4M6GA 2X7BA 3EY5A 1YLOA 5DWMA 2DF5A 3IWEA 3NFZA 2PE3A 4IQYA 1KWMA 4ZBGA 4BINA 5JH9A 3FNCA 2A4NA 1U6MA 3IJ3A 3NA6A 3G3SA 4MCSA 4OC4A 3V38A 3PB8X 2XEIA 4CGMA 1IY7A 2Q04A 2GE3A 2LGRA 3LWUA 4JCAA 3EC4A 4M6IA 4ETJA 2G9DA 2V8GA 2ZEMA 4K30A 2VXKA 4LUAA 3TO9A 1ZR5A 3F0AA 2PIZA 4CS0B 2G3AA 4R3LA 1IOFA 4AVBA 3QAHA 4UIAA 2PCUA 2POKA 1DE4C 5HVHA 2RNKA 1QSMA 1KUVA 2D4PA 3TO6A 2NSMA 1K4JA 2OB0A 4JXRA 3NE7A 1CPXA 4HKFA 5AILA 2JBJA 1WK4A 1YQEA 4FD7A 4RS2A 1BPNA 3MRUA 4II9A 2ACFA 2ZW6A 2DX6A 4LQ6A 3D7GA 4RI1A 3JZTA 4PSXA 1Q2DA 4PXCA 4F9UA 3CPAA 4C7HA 5J8FA 4R6TA 2AFUA 4JGKA 1MJAA
chains in the Genus database with same CATH topology
4A38A 3FVLA 3EWQA 4IK2A 3EJFA 3EJGA 4TWEA 2Q43A 4YU9A 2XD7A 1PYTB 4NFRA 4DUKA 1ELMP 1F2PA 4UEFA 3VATA 2PJ5A 1ZR3A 4Q7AA 3KGQA 1VIXA 3FMCA 1ELLP 2O53A 2PVVA 2ANPA 1TF9A 5HIHA 2Q4ZA 3IIDA 1DTDA 5JGFA 2CTCA 2PVWA 3RZAA 3EWPA 5FSVA 1TF8A 4P4BA 4X3RA 4R76A 4PXDA 3FF3A 4ZY2A 4UEZA 4J5SA 3BI0A 2PJ7A 4WJBA 1LOKA 3WC6A 3B3WA 3CPXA 3QNVA 5HOLA 4WWVA 4K3NA 3PB4X 4G1PA 1R43A 4B6ZA 7CPAA 2BOAA 2BCOA 2AFXA 3FX6A 4FBEA 2I3CA 4MRIA 4PXEA 5LRKA 3Q71A 4FWUA 3S9NA 2PJCA 3RBUA 5F09A 2PJ4A 2PJAA 3SIIA 5D29A 2CF4A 3VH9A 2AFCA 2L8RA 1BPMA 1Z8LA 4H2KA 2C1CA 5FSXA 2AFSA 1FNOA 2V8HA 1Q7LA 3EW5A 3FEDA 3B3TA 2ZEPA 3KHXA 3GPQA 4J5RA 2ZEGA 4OC2A 5CPAA 3GQEA 5LYLA 4MCPA 4OIWA 3MN8A 4J4ZA 2VL1A 1Y0YA 1TY8A 3TC8A 4NGMA 1BAVA 1VGYA 4PPZA 3IEHA 2V77A 1HJZA 2ZENA 3L2NA 1HDQA 4MHYA 4MMOA 3NH5A 4PQAA 2OR4A 1YW6A 3V7ZA 3N5FA 1XMBA 3PB7X 8CPAA 1GYTA 2C6GA 3B2YA 3KR4A 3GPGA 4RUHA 3K2KA 3K9TA 2ZOGA 3CDXA 3I1UA 4P10A 5DUSA 1UWYA 5E3BA 4JZ0A 1ARMA 3KQXA 4R8FA 4P45A 3PRTA 3BI1A 1HDUA 3D66A 4F9VA 4IAVA 5LYFA 1TKHA 1LCPA 4IHMA 3DLJA 2V8DA 3JRUA 1AYEA 3V45A 3IC1A 2EWBA 4J5QA 1TXZA 2XEGA 4F8ZA 3FECA 2CIJA 3EKEA 3BXMA 4GUAA 2OOTA 5FSZA 3B3SA 2XEFA 3SJFA 1YW4A 4NGQA 4UIBA 5D8NA 2ABZA 5CB5A 3B3VA 4OIDA 1QQ9A 2GU2A 1VHEA 4ZX9A 1IGBA 3PB9X 4ZY1A 3KASA 4ZX8A 2PJ6A 4MCQA 1Y0RA 2O4HA 3CT9A 3KQZA 3ISXA 3B7IA 2IMOA 2EEEA 3VARA 3WT4A 1ZG7A 1FT7A 4OC3A 2QVPA 3GUXA 1ZLIA 4ZYQA 1QMUA 5CBMA 1TKJA 4OMEA 3T8WA 1HEEA 4P44A 1CX8A 3SI1A 6CPAA 4ONWA 4P4DA 4OC5A 2HC9A 3KI9A 4NJQA 1LFWA 4FAIA 4A94A 1LAMA 4LQGA 2JEWA 3PFOA 2VRIA 4O23A 4JVVA 2F8HA 5K8PA 2QJ8A 4NGPA 3WABA 1YD9A 3S9LA 2BFQA 1JQGA 4P4JA 1LAPA 4W9YA 5JM6A 3SJXA 2X47A 3PB6X 1VHUA 3VFQA 4PXBA 4DJLA 3DGVA 5HXDA 5IB9A 4R7MA 1Y7EA 5I4MA 4A39A 3SIHA 1CPSA 3WC5A 5LRJA 5THWA 4TU0A 3D68A 3S9MA 1AMPA 2PRQA 1YMEA 2PIYA 2FAVA 4AXVA 1RTQA 3HUVA 3GPOA 2CTBA 2WYRA 4UMLA 4GVVA 1XJOA 3D4UA 1LANA 2PJBA 1M4LA 1SPVA 5LYIA 3IIFA 1XBUA 5K8OA 3IO1A 3KZWA 4D86A 4UF4A 3KR5A 4ABKA 2PJ3A 4JYWA 3PBEA 5K8NA 2BO9A 3EWOA 1H8LA 3SIGA 2PJ8A 4JLLA 1ZLHA 5K8MA 2IJZA 1XRYA 1ZG9A 2Q51A 3GB0A 3Q6ZA 2PJ1A 3KHZA 4P6YA 4CPAA 4GM5A 1ZG8A 4NGTA 3SI0A 5FSYA 4KSIA 4P4FA 4OKOA 3SJGA 2IQ6A 5DS0A 4MHZA 3ETIA 5J1QA 4NGSA 2ZOFA 1PCAA 3TX8A 4Z65A 2AFMA 3IFEA 4OP4A 3SJEA 3WC7A 2XEJA 3D7DA 4NJRA 5LRGA 2ZEHA 4ZY0A 1ARLA 4TNUA 1OBRA 3B35A 2ZELA 1NSAA 2F7VA 5LYDA 1TXRA 2V8VA 3IWWA 4P4IA 4MHNA 2EK8A 4MCRA 4EWTA 4GVWA 2BFRA 2RFHA 2AFOA 4ZI6A 4ESSA 4P4EA 3V2BA 2JBKA 1VHOA 1BLLE 2PJ2A 3SIJA 4MHPA 2FVGA 3PBBA 1TKFA 3GQOA 2QYVA 4DYOA 1CP7A 4UEEA 3FEEA 4KYBA 3D7HA 2GREA 2C6CA 2PJ9A 2AFWA 2C6PA 4K0CA 3H8FA 2WZNA 4BD9A 3ISZA 5ELYA 4OC0A 2DEAA 1CBXA 2ZEOA 1F2OA 2ZEDA 3PFEA 2PJ0A 1R3NA 1YSJA 3IIBA 5CMSA 2HB6A 4X2TA 4FUUA 3NH8A 4ETKA 3D67A 1NJRA 4NGRA 1Z5RA 4EFDA 3EWRA 2GLFA 3LMSA 5FSUA 4X8IA 4A37A 1CP6A 1F57A 3KL9A 4MXUA 3RAMA 4OC1A 2J9AA 5HVFA 1XFOA 4ABLA 2EK9A 3HLPA 2ZEEA 2NYQA 3SI2A 3NH4A 3H8EA 5CB3A 4EMEA 1EE3P 3FJUA 3BHXA 4YWYA 1Z2LA 3GLJA 5HVGA 2AFZA 4NGNA 1CG2A 3B3CA 3H8GA 2GLJA 3PEIA 2ZEFA 2FXKA 3D7FA 2FG1A 3FH4A 2RB7A 1YLOA 3NFZA 2PE3A 4IQYA 1KWMA 5JH9A 3NA6A 4OC4A 3IJ3A 3V38A 4MCSA 3PB8X 2XEIA 1IY7A 2LGRA 3LWUA 4JCAA 4ETJA 2G9DA 2V8GA 2ZEMA 1ZR5A 2PIZA 5HVHA 4UIAA 2PCUA 2POKA 1DE4C 2NSMA 1CPXA 5AILA 2JBJA 1BPNA 3MRUA 2ACFA 2DX6A 3D7GA 3JZTA 4PXCA 4F9UA 3CPAA 4R6TA 2AFUA 4JGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A38 A;  3FVL A;  3EWQ A;  4IK2 A;  3EJF A;  3EJG A;  4TWE A;  2Q43 A;  4YU9 A;  2XD7 A;  1PYT B;  4NFR A;  4DUK A;  1ELM P;  1F2P A;  4UEF A;  3VAT A;  2PJ5 A;  1ZR3 A;  4Q7A A;  3KGQ A;  1VIX A;  3FMC A;  1ELL P;  2O53 A;  2PVV A;  2ANP A;  1TF9 A;  5HIH A;  2Q4Z A;  3IID A;  1DTD A;  5JGF A;  2CTC A;  2PVW A;  3RZA A;  3EWP A;  5FSV A;  1TF8 A;  4P4B A;  4X3R A;  4R76 A;  4PXD A;  3FF3 A;  4ZY2 A;  4UEZ A;  4J5S A;  3BI0 A;  2PJ7 A;  4WJB A;  1LOK A;  3WC6 A;  3B3W A;  3CPX A;  3QNV A;  5HOL A;  4WWV A;  4K3N A;  3PB4 X;  4G1P A;  1R43 A;  4B6Z A;  7CPA A;  2BOA A;  2BCO A;  2AFX A;  3FX6 A;  4FBE A;  2I3C A;  4MRI A;  4PXE A;  5LRK A;  3Q71 A;  4FWU A;  3S9N A;  2PJC A;  3RBU A;  5F09 A;  2PJ4 A;  2PJA A;  3SII A;  5D29 A;  2CF4 A;  3VH9 A;  2AFC A;  2L8R A;  1BPM A;  1Z8L A;  4H2K A;  2C1C A;  5FSX A;  2AFS A;  1FNO A;  2V8H A;  1Q7L A;  3EW5 A;  3FED A;  3B3T A;  2ZEP A;  3KHX A;  3GPQ A;  4J5R A;  2ZEG A;  4OC2 A;  5CPA A;  3GQE A;  5LYL A;  4MCP A;  4OIW A;  3MN8 A;  4J4Z A;  2VL1 A;  1Y0Y A;  1TY8 A;  3TC8 A;  4NGM A;  1BAV A;  1VGY A;  4PPZ A;  3IEH A;  2V77 A;  1HJZ A;  2ZEN A;  3L2N A;  1HDQ A;  4MHY A;  4MMO A;  3NH5 A;  4PQA A;  2OR4 A;  1YW6 A;  3V7Z A;  3N5F A;  1XMB A;  3PB7 X;  8CPA A;  1GYT A;  2C6G A;  3B2Y A;  3KR4 A;  3GPG A;  4RUH A;  3K2K A;  3K9T A;  2ZOG A;  3CDX A;  3I1U A;  4P10 A;  5DUS A;  1UWY A;  5E3B A;  4JZ0 A;  1ARM A;  3KQX A;  4R8F A;  4P45 A;  3PRT A;  3BI1 A;  1HDU A;  3D66 A;  4F9V A;  4IAV A;  5LYF A;  1TKH A;  1LCP A;  4IHM A;  3DLJ A;  2V8D A;  3JRU A;  1AYE A;  3V45 A;  3IC1 A;  2EWB A;  4J5Q A;  1TXZ A;  2XEG A;  4F8Z A;  3FEC A;  2CIJ A;  3EKE A;  3BXM A;  4GUA A;  2OOT A;  5FSZ A;  3B3S A;  2XEF A;  3SJF A;  1YW4 A;  4NGQ A;  4UIB A;  5D8N A;  2ABZ A;  5CB5 A;  3B3V A;  4OID A;  1QQ9 A;  2GU2 A;  1VHE A;  4ZX9 A;  1IGB A;  3PB9 X;  4ZY1 A;  3KAS A;  4ZX8 A;  2PJ6 A;  4MCQ A;  1Y0R A;  2O4H A;  3CT9 A;  3KQZ A;  3ISX A;  3B7I A;  2IMO A;  2EEE A;  3VAR A;  3WT4 A;  1ZG7 A;  1FT7 A;  4OC3 A;  2QVP A;  3GUX A;  1ZLI A;  4ZYQ A;  1QMU A;  5CBM A;  1TKJ A;  4OME A;  3T8W A;  1HEE A;  4P44 A;  1CX8 A;  3SI1 A;  6CPA A;  4ONW A;  4P4D A;  4OC5 A;  2HC9 A;  3KI9 A;  4NJQ A;  1LFW A;  4FAI A;  4A94 A;  1LAM A;  4LQG A;  2JEW A;  3PFO A;  2VRI A;  4O23 A;  4JVV A;  2F8H A;  5K8P A;  2QJ8 A;  4NGP A;  3WAB A;  1YD9 A;  3S9L A;  2BFQ A;  1JQG A;  4P4J A;  1LAP A;  4W9Y A;  5JM6 A;  3SJX A;  2X47 A;  3PB6 X;  1VHU A;  3VFQ A;  4PXB A;  4DJL A;  3DGV A;  5HXD A;  5IB9 A;  4R7M A;  1Y7E A;  5I4M A;  4A39 A;  3SIH A;  1CPS A;  3WC5 A;  5LRJ A;  5THW A;  4TU0 A;  3D68 A;  3S9M A;  1AMP A;  2PRQ A;  1YME A;  2PIY A;  2FAV A;  4AXV A;  1RTQ A;  3HUV A;  3GPO A;  2CTB A;  2WYR A;  4UML A;  4GVV A;  1XJO A;  3D4U A;  1LAN A;  2PJB A;  1M4L A;  1SPV A;  5LYI A;  3IIF A;  1XBU A;  5K8O A;  3IO1 A;  3KZW A;  4D86 A;  4UF4 A;  3KR5 A;  4ABK A;  2PJ3 A;  4JYW A;  3PBE A;  5K8N A;  2BO9 A;  3EWO A;  1H8L A;  3SIG A;  2PJ8 A;  4JLL A;  1ZLH A;  5K8M A;  2IJZ A;  1XRY A;  1ZG9 A;  2Q51 A;  3GB0 A;  3Q6Z A;  2PJ1 A;  3KHZ A;  4P6Y A;  4CPA A;  4GM5 A;  1ZG8 A;  4NGT A;  3SI0 A;  5FSY A;  4KSI A;  4P4F A;  4OKO A;  3SJG A;  2IQ6 A;  5DS0 A;  4MHZ A;  3ETI A;  5J1Q A;  4NGS A;  2ZOF A;  1PCA A;  3TX8 A;  4Z65 A;  2AFM A;  3IFE A;  4OP4 A;  3SJE A;  3WC7 A;  2XEJ A;  3D7D A;  4NJR A;  5LRG A;  2ZEH A;  4ZY0 A;  1ARL A;  4TNU A;  1OBR A;  3B35 A;  2ZEL A;  1NSA A;  2F7V A;  5LYD A;  1TXR A;  2V8V A;  3IWW A;  4P4I A;  4MHN A;  2EK8 A;  4MCR A;  4EWT A;  4GVW A;  2BFR A;  2RFH A;  2AFO A;  4ZI6 A;  4ESS A;  4P4E A;  3V2B A;  2JBK A;  1VHO A;  1BLL E;  2PJ2 A;  3SIJ A;  4MHP A;  2FVG A;  3PBB A;  1TKF A;  3GQO A;  2QYV A;  4DYO A;  1CP7 A;  4UEE A;  3FEE A;  4KYB A;  3D7H A;  2GRE A;  2C6C A;  2PJ9 A;  2AFW A;  2C6P A;  4K0C A;  3H8F A;  2WZN A;  4BD9 A;  3ISZ A;  5ELY A;  4OC0 A;  2DEA A;  1CBX A;  2ZEO A;  1F2O A;  2ZED A;  3PFE A;  2PJ0 A;  1R3N A;  1YSJ A;  3IIB A;  5CMS A;  2HB6 A;  4X2T A;  4FUU A;  3NH8 A;  4ETK A;  3D67 A;  1NJR A;  4NGR A;  1Z5R A;  4EFD A;  3EWR A;  2GLF A;  3LMS A;  5FSU A;  4X8I A;  4A37 A;  1CP6 A;  1F57 A;  3KL9 A;  4MXU A;  3RAM A;  4OC1 A;  2J9A A;  5HVF A;  1XFO A;  4ABL A;  2EK9 A;  3HLP A;  2ZEE A;  2NYQ A;  3SI2 A;  3NH4 A;  3H8E A;  5CB3 A;  4EME A;  1EE3 P;  3FJU A;  3BHX A;  4YWY A;  1Z2L A;  3GLJ A;  5HVG A;  2AFZ A;  4NGN A;  1CG2 A;  3B3C A;  3H8G A;  2GLJ A;  3PEI A;  2ZEF A;  2FXK A;  3D7F A;  2FG1 A;  3FH4 A;  2RB7 A;  1YLO A;  3NFZ A;  2PE3 A;  4IQY A;  1KWM A;  5JH9 A;  3NA6 A;  4OC4 A;  3IJ3 A;  3V38 A;  4MCS A;  3PB8 X;  2XEI A;  1IY7 A;  2LGR A;  3LWU A;  4JCA A;  4ETJ A;  2G9D A;  2V8G A;  2ZEM A;  1ZR5 A;  2PIZ A;  5HVH A;  4UIA A;  2PCU A;  2POK A;  1DE4 C;  2NSM A;  1CPX A;  5AIL A;  2JBJ A;  1BPN A;  3MRU A;  2ACF A;  2DX6 A;  3D7G A;  3JZT A;  4PXC A;  4F9U A;  3CPA A;  4R6T A;  2AFU A;  4JGK A; 
#chains in the Genus database with same CATH topology
 1M4I A;  4C2X A;  4A38 A;  3FVL A;  3EWQ A;  4IK2 A;  2BUE A;  1Z8T A;  1IOI A;  2BL1 A;  4KOS A;  3EJF A;  3EJG A;  4TWE A;  2Q7B A;  2Q43 A;  4YU9 A;  2XD7 A;  1PYT B;  4NFR A;  4DUK A;  3TCV A;  1QSR A;  1ELM P;  1F2P A;  4UEF A;  3VAT A;  2P0W A;  1N71 A;  2PJ5 A;  2PSW A;  1ZR3 A;  4OAD A;  3D3S A;  4Q7A A;  3KGQ A;  2Q4V A;  4BBH A;  1VIX A;  2P6G A;  3FMC A;  4KUA A;  4CAW A;  2EVN A;  1ELL P;  2O53 A;  1ZO0 A;  1P4N A;  2PVV A;  2ANP A;  1TF9 A;  2Z3P A;  5HIH A;  2Q4Z A;  3IID A;  1DTD A;  2ZW7 A;  2R8V A;  4ONU A;  4Q36 A;  3S6F A;  1TIQ A;  3VWD A;  5JGF A;  2CTC A;  2PVW A;  3RZA A;  4QC6 A;  3BLN A;  3VWE A;  3EWP A;  4B14 A;  5FSV A;  1TF8 A;  5AG5 A;  2JDC A;  4P4B A;  3SXN A;  4JXQ A;  4X3R A;  4R76 A;  3RO0 A;  4CYP A;  4PXD A;  1B6B A;  1PUA A;  3FF3 A;  4ZY2 A;  4UEZ A;  5H84 A;  3H4Q A;  4J5S A;  5G22 A;  1NSL A;  3BI0 A;  2PJ7 A;  2WPW A;  1M1D A;  4WJB A;  1I1D A;  1M4G A;  1LOK A;  4YFJ A;  4A30 A;  1IB1 E;  3WC6 A;  3B3W A;  3CPX A;  3S6H A;  4A31 A;  3QNV A;  2OZG A;  5HOL A;  4WWV A;  4K3N A;  1X10 A;  4EVY A;  3PB4 X;  4G1P A;  3V8I A;  4KSF A;  1R43 A;  4IUS A;  2R1I A;  4B6Z A;  7CPA A;  1J4J A;  2BOA A;  2BCO A;  5KTC A;  3EO4 A;  2KCW A;  2AFX A;  1JWQ A;  3PZJ A;  2Z3O A;  3FX6 A;  3WR7 A;  2I3C A;  4MRI A;  4PXE A;  4B10 A;  4FBE A;  5LRK A;  3Q71 A;  2Q4Y A;  4M85 A;  2QIR A;  4FWU A;  4KUB A;  2VZZ A;  5J8C A;  3S9N A;  2PJC A;  4J3G A;  5CNP A;  3RBU A;  5F09 A;  1IID A;  2PJ4 A;  4IF5 A;  2PJA A;  3SII A;  4PSW A;  5D29 A;  2CF4 A;  3EXN A;  3VH9 A;  5IV0 A;  1S7L A;  4H6U A;  2VI7 A;  2AFC A;  1LRZ A;  4CGL A;  2YNC A;  4ORF A;  2L8R A;  1BPM A;  1Z8L A;  4JD6 A;  4H2K A;  1XF8 A;  1QSO A;  2DPT A;  4KOU A;  2C1C A;  5FSX A;  2AFS A;  1FNO A;  2V8H A;  4CRZ B;  1Q7L A;  3EW5 A;  2QML A;  2RC4 A;  3EFA A;  3FED A;  3B3T A;  2ZEP A;  4CGO A;  3KHX A;  1PU9 A;  3GPQ A;  4J5R A;  2ZEG A;  5EMI A;  1M44 A;  4OC2 A;  2DPS A;  5CPA A;  5HMN A;  1Z8X A;  3GQE A;  5LYL A;  4MCP A;  4HNX B;  4OIW A;  3MN8 A;  4J4Z A;  3K9U A;  4KSA A;  2VZY A;  5AGE A;  2VL1 A;  4CYO A;  1Y0Y A;  1YK3 A;  1MJB A;  4KOY A;  1TY8 A;  4UFW A;  1KZF A;  4R3K A;  2PR1 A;  4B11 A;  4U9Y A;  2J8N A;  3TC8 A;  3R96 A;  4NGM A;  1BAV A;  1VGY A;  2FXF A;  4PPZ A;  3IEH A;  2V77 A;  4Q38 A;  3T9Y A;  2AE6 A;  1HJZ A;  2ZEN A;  4LX9 A;  2WSA A;  5F49 A;  2ZPA A;  3PGP A;  3QB8 A;  4KOV A;  3L2N A;  1HDQ A;  2PRB A;  4MHY A;  4F0Y A;  4MMO A;  4U5Y A;  2JLM A;  3A9L A;  1XEB A;  1YW6 A;  2HUZ A;  2OR4 A;  3DNS A;  2DXQ A;  3NH5 A;  4PQA A;  3S6K A;  4QVT A;  3V7Z A;  3S6G A;  3N5F A;  4B5O A;  2B5G A;  4KVX A;  2Z3K A;  5G1Z A;  4F0X A;  1XMB A;  2YGW A;  4HPS A;  1Z9U A;  1YVO A;  3PB7 X;  3SHP A;  3D8P A;  4MFJ A;  4MY0 A;  8CPA A;  1GYT A;  2C6G A;  3CXS A;  4UWI A;  3B2Y A;  3KR4 A;  4B5P B;  4UCM A;  3GPG A;  1OZP A;  4RUH A;  3K2K A;  3K9T A;  2ZOG A;  3CDX A;  3I1U A;  3NE8 A;  3F8K A;  4P10 A;  4CAE A;  2GAN A;  1IYL A;  4FD6 A;  5DUS A;  1UWY A;  5E3B A;  2FIA A;  1ARM A;  4JZ0 A;  3KQX A;  1BOB A;  4C2Y A;  4R8F A;  1FY7 A;  4P45 A;  3PRT A;  3BI1 A;  1HDU A;  3D66 A;  3P2F A;  4F9V A;  1A2Z A;  4IAV A;  1XOV A;  3N7Z A;  5LYF A;  1YRE A;  3R95 A;  5KTA A;  4Y49 C;  1TKH A;  1LCP A;  4IHM A;  3DLJ A;  3TO7 A;  2CNM A;  3JRU A;  1AYE A;  1AUG A;  2F5I A;  2V8D A;  3V45 A;  3IC1 A;  2EWB A;  2KQV A;  4J5Q A;  4UA3 A;  5AG7 A;  1TXZ A;  5AG4 A;  2XEG A;  2Z0Z A;  1YR0 A;  5C82 A;  4AVA A;  4F8Z A;  3FEC A;  4KZT A;  2CIJ A;  4DNC A;  3EKE A;  3BXM A;  4GUA A;  2OOT A;  1KUY A;  3W6X A;  2B4D A;  5FSZ A;  1YLE A;  3B3S A;  4MHD A;  2XEF A;  4R9M A;  4A37 A;  4JWP A;  3SJF A;  2R7H A;  1YW4 A;  3H5Z A;  4NGQ A;  4UIB A;  5D8N A;  1Y9K A;  2ABZ A;  5CB5 A;  1YX0 A;  3B3V A;  4OID A;  3ZZI A;  1QQ9 A;  2GU2 A;  1VHE A;  4ZX9 A;  1IGB A;  3PB9 X;  3W91 A;  4ZY1 A;  3TTH A;  3KAS A;  4ZX8 A;  2PJ6 A;  4MCQ A;  2B5G B;  5AG6 A;  1Y0R A;  2O4H A;  3CT9 A;  1S7N A;  1Q2Y A;  3KQZ A;  2AJ6 A;  3I9S A;  3ISX A;  4CYN A;  3B7I A;  1VKC A;  2EEE A;  1ON0 A;  2IMO A;  2W2G A;  3LOD A;  4KS9 A;  4KVM E;  1ZG7 A;  1FT7 A;  3TT2 A;  3VAR A;  3WT4 A;  2WCT A;  4OC3 A;  3IU1 A;  2QVP A;  1NMT A;  1ZLI A;  3GUX A;  1Z4R A;  4R87 A;  4ZYQ A;  1QMU A;  5CBM A;  1TKJ A;  4NSQ A;  4E2A A;  1BO4 A;  3C26 A;  2ZW5 A;  3IU2 A;  5E96 A;  4OME A;  4AB7 A;  4A32 A;  3T8W A;  1HEE A;  2HV2 A;  3BJ8 A;  1XIX A;  4P44 A;  1CX8 A;  3SI1 A;  5IX3 A;  6CPA A;  1QSN A;  1RXT A;  4NCZ A;  4ONW A;  4OC5 A;  4P4D A;  1V0C A;  2WUU A;  2HC9 A;  3R9F A;  3KI9 A;  4CAF A;  3DR6 A;  4NJQ A;  1LFW A;  5EBV A;  4A94 A;  4FAI A;  4A33 A;  1IIC A;  1LAM A;  4MBU A;  4LQG A;  2JEW A;  3GKR A;  4QUS A;  4MFK A;  3B8G A;  2YNE A;  3PFO A;  5GCN A;  2VRI A;  4O23 A;  4JVV A;  1VHS A;  2F8H A;  3R9E A;  4L89 A;  1GHE A;  5K8P A;  2J8M A;  2EUI A;  2QJ8 A;  4NGP A;  3FYN A;  3WAB A;  1YD9 A;  2FL4 A;  4FD4 A;  3S9L A;  2BFQ A;  1JQG A;  4P4J A;  1YVK A;  1LAP A;  4W9Y A;  5JM6 A;  3CZX A;  2B4D B;  3ZJ0 A;  1Z8W A;  3SJX A;  3IGR A;  2X47 A;  3PB6 X;  1VHU A;  2Z10 A;  2D4O A;  2HQY A;  3VFQ A;  4PXB A;  4DJL A;  3DGV A;  5HXD A;  5IB9 A;  1IYK A;  4XPD B;  4R7M A;  1Y7E A;  5I0C A;  4A39 A;  5I4M A;  1I12 A;  4XNH C;  3G8W A;  3SIH A;  1CPS A;  2C27 A;  2VEZ A;  1Q2C A;  3WC5 A;  4AVC A;  5H86 A;  3FBU A;  5LRJ A;  5THW A;  4TU0 A;  3D68 A;  2PQ8 A;  1WWZ A;  1X12 A;  2Q7S A;  5G21 A;  3S9M A;  1AMP A;  2PRQ A;  1YME A;  2CXA A;  2PIY A;  3T90 A;  2FAV A;  4AXV A;  2FE7 A;  3DR8 A;  1RTQ A;  2ARH A;  3GPO A;  3HUV A;  2CTB A;  5FVJ A;  3I3G A;  4MI4 A;  4YGO A;  2WYR A;  4UML A;  2B3V A;  3LAC A;  4GVV A;  1S7F A;  4NXY A;  1XJO A;  3D4U A;  3FXT A;  1LAN A;  5EC4 A;  4UWJ A;  2PJB A;  3E0K A;  1M4L A;  1SPV A;  5HH1 A;  3IWG A;  5LYI A;  3IIF A;  1XBU A;  4MJ8 A;  5K8O A;  5ISV A;  1SQH A;  1KUX A;  3IO1 A;  4AG7 A;  3KZW A;  4D86 A;  4UF4 A;  3UY5 A;  2REF A;  4JJX A;  3KR5 A;  3R9G A;  4OAE A;  4ABK A;  2ODF A;  2PJ3 A;  1UFH A;  5KTD A;  1XMT A;  2JZD A;  2FT0 A;  4JYW A;  3PBE A;  1I21 A;  1S7K A;  2Z3L A;  2REE A;  5K8N A;  5C88 A;  2QEC A;  2B3U A;  2BO9 A;  3OWC A;  3F5B A;  1YGH A;  3EWO A;  1H8L A;  3SIG A;  1CJW A;  2PJ8 A;  4JLL A;  4R57 A;  1ZLH A;  5K8M A;  2JEV A;  1QST A;  2IJZ A;  1XRY A;  1ZG9 A;  4CYQ A;  1R57 A;  2OZU A;  2Q51 A;  3GB0 A;  3Q6Z A;  2PJ1 A;  3KHZ A;  4M6H A;  4P6Y A;  2PDO A;  4GM5 A;  1ZG8 A;  4I49 A;  4NGT A;  4CGP A;  3SI0 A;  5FSY A;  4CAX A;  4UCN A;  4OLL A;  4FD5 A;  4C2Z A;  4KSI A;  2B58 A;  1S60 A;  1S5K A;  2OZH A;  5A28 A;  4PK2 A;  4P4F A;  2Q44 A;  4B12 A;  4OKO A;  4H89 A;  3R1K A;  3SJG A;  3FB3 A;  2IQ6 A;  2O28 A;  5DS0 A;  4MHZ A;  3ETI A;  5J1Q A;  3JUW A;  4NGS A;  4C68 A;  2ZOF A;  1PCA A;  2FIW A;  3D2M A;  3TX8 A;  2R98 A;  4Z65 A;  1MJ9 A;  2AFM A;  4PV6 A;  3IFE A;  4OP4 A;  3SJE A;  5JQ4 A;  4KLV A;  3WC7 A;  2XEJ A;  3D7D A;  4NJR A;  4CRY B;  1NE9 A;  5LRG A;  4BMH A;  2PR8 A;  2ZEH A;  4ZY0 A;  1ARL A;  2Z3N A;  4TNU A;  1OBR A;  3B35 A;  4ZGY B;  4RN7 A;  2ZEL A;  1NSA A;  2F7V A;  3GY9 A;  5LYD A;  5IB0 A;  1TXR A;  5G20 A;  4CAV A;  3TFY A;  2V8V A;  3IWW A;  4Y49 B;  4NEX A;  2FCK A;  4P4I A;  2BSW A;  4MHN A;  4F6A A;  2EK8 A;  4MFQ A;  4MCR A;  4EWT A;  4GVW A;  4H6Z A;  3RYO A;  2WPX A;  4CGN A;  2BFR A;  2RFH A;  2AFO A;  4KLW A;  4ZI6 A;  4ESS A;  2JDD A;  2EBJ A;  1M4D A;  3JTK A;  1IU8 A;  4P4E A;  3QAY A;  2IL4 A;  4KOT A;  3V2B A;  2JZE A;  5BWA B;  2JBK A;  2Q0Y A;  1VHO A;  1BLL E;  2PJ2 A;  3SIJ A;  4MHP A;  2FVG A;  3PBB A;  4QBJ A;  1TKF A;  4A2Z A;  4MY3 A;  3GQO A;  3P2H A;  2QYV A;  2CY2 A;  1S3Z A;  3LD2 A;  4UFV A;  4DYO A;  1CP7 A;  3RNZ A;  2G3T A;  4UEE A;  2PC1 A;  2Y0M A;  3FEE A;  4KYB A;  4QB9 A;  3D7H A;  5F46 A;  4GS4 A;  2GRE A;  2C6C A;  2PJ9 A;  2AFW A;  3FRM A;  5F48 A;  2H5M A;  2JZF A;  2C6P A;  4K0C A;  3PP9 A;  2P6E A;  4NF1 A;  3H8F A;  2WZN A;  4BD9 A;  3ISZ A;  5ELY A;  4AG9 A;  4OC0 A;  1CM0 A;  2DEA A;  1CBX A;  2ZEO A;  1F2O A;  2P6F A;  2ZED A;  3PFE A;  4XPL A;  2EO8 A;  3GYA A;  2PJ0 A;  2ZXV A;  4HNY B;  2ZW4 A;  3KKW A;  1R3N A;  1YSJ A;  3IIB A;  3W6S A;  3TOA A;  1Y9W A;  5CMS A;  2HB6 A;  4GXH A;  2VQY A;  3TE4 A;  4X2T A;  4XPD C;  2FSR A;  2ATR A;  4FUU A;  2CNS A;  3D2P A;  1B87 A;  3NH8 A;  4ETK A;  3D67 A;  1NJR A;  4UBR A;  5F47 A;  4B13 A;  4NGR A;  1Z5R A;  4M3S A;  4XPK A;  2BEI A;  3DDD A;  2K5T A;  4KVO E;  4MFP A;  2GFQ A;  3EWR A;  2GLF A;  2NMT A;  1L0C A;  3LMS A;  4MFL A;  1P0H A;  2GIV A;  4EFD A;  5JPH A;  4B5P A;  2OU2 A;  5FSU A;  4UFX A;  3JVN A;  1MK4 A;  4X8I A;  2OH1 A;  1CP6 A;  1F57 A;  2Z11 A;  3KL9 A;  4MXU A;  3RAM A;  4OC1 A;  2J9A A;  5HVF A;  4E8O A;  1XFO A;  4ABL A;  2G0B A;  2EK9 A;  3FIX A;  3HLP A;  3SXO A;  2ZEE A;  2NYQ A;  4HNW B;  3SI2 A;  3MGD A;  2I00 A;  2Z3M A;  3NH4 A;  1Z4E A;  3DSB A;  2CNT A;  2B4B A;  3CXP A;  3CXQ A;  4KOW A;  3H8E A;  2J8R A;  2FS5 A;  4L8A A;  5CB3 A;  4KOX A;  4EME A;  4CPA A;  1EE3 P;  3FJU A;  1XE4 A;  2I79 A;  3BHX A;  1Z2L A;  4U9Z A;  4YWY A;  3GLJ A;  4A95 A;  5A27 A;  4PK3 A;  4C7I A;  1Y7R A;  5HVG A;  1RO5 A;  2AFZ A;  4NGN A;  1CG2 A;  4YRH A;  3BJ7 A;  2VBQ A;  3B3C A;  4UCP A;  4KOR A;  4JLY A;  2YNC C;  3TOB A;  3H8G A;  5DWN A;  2GLJ A;  4XNH B;  3PEI A;  4MFZ A;  2YND A;  2ZEF A;  4E0A A;  2FXK A;  3D7F A;  2FG1 A;  3FH4 A;  3GIU A;  2RB7 A;  4X5K A;  4M6G A;  2X7B A;  3EY5 A;  1YLO A;  5DWM A;  2DF5 A;  3IWE A;  3NFZ A;  2PE3 A;  4IQY A;  1KWM A;  4ZBG A;  4BIN A;  5JH9 A;  3FNC A;  2A4N A;  1U6M A;  3IJ3 A;  3NA6 A;  3G3S A;  4MCS A;  4OC4 A;  3V38 A;  3PB8 X;  2XEI A;  4CGM A;  1IY7 A;  2Q04 A;  2GE3 A;  2LGR A;  3LWU A;  4JCA A;  3EC4 A;  4M6I A;  4ETJ A;  2G9D A;  2V8G A;  2ZEM A;  4K30 A;  2VXK A;  4LUA A;  3TO9 A;  1ZR5 A;  3F0A A;  2PIZ A;  4CS0 B;  2G3A A;  4R3L A;  1IOF A;  4AVB A;  3QAH A;  4UIA A;  2PCU A;  2POK A;  1DE4 C;  5HVH A;  2RNK A;  1QSM A;  1KUV A;  2D4P A;  3TO6 A;  2NSM A;  1K4J A;  2OB0 A;  4JXR A;  3NE7 A;  1CPX A;  4HKF A;  5AIL A;  2JBJ A;  1WK4 A;  1YQE A;  4FD7 A;  4RS2 A;  1BPN A;  3MRU A;  4II9 A;  2ACF A;  2ZW6 A;  2DX6 A;  4LQ6 A;  3D7G A;  4RI1 A;  3JZT A;  4PSX A;  1Q2D A;  4PXC A;  4F9U A;  3CPA A;  4C7H A;  5J8F A;  4R6T A;  2AFU A;  4JGK A;  1MJA A; 
#chains in the Genus database with same CATH homology
 4A38 A;  3FVL A;  3EWQ A;  4IK2 A;  3EJF A;  3EJG A;  4TWE A;  2Q43 A;  4YU9 A;  2XD7 A;  1PYT B;  4NFR A;  4DUK A;  1ELM P;  1F2P A;  4UEF A;  3VAT A;  2PJ5 A;  1ZR3 A;  4Q7A A;  3KGQ A;  1VIX A;  3FMC A;  1ELL P;  2O53 A;  2PVV A;  2ANP A;  1TF9 A;  5HIH A;  2Q4Z A;  3IID A;  1DTD A;  5JGF A;  2CTC A;  2PVW A;  3RZA A;  3EWP A;  5FSV A;  1TF8 A;  4P4B A;  4X3R A;  4R76 A;  4PXD A;  3FF3 A;  4ZY2 A;  4UEZ A;  4J5S A;  3BI0 A;  2PJ7 A;  4WJB A;  1LOK A;  3WC6 A;  3B3W A;  3CPX A;  3QNV A;  5HOL A;  4WWV A;  4K3N A;  3PB4 X;  4G1P A;  1R43 A;  4B6Z A;  7CPA A;  2BOA A;  2BCO A;  2AFX A;  3FX6 A;  4FBE A;  2I3C A;  4MRI A;  4PXE A;  5LRK A;  3Q71 A;  4FWU A;  3S9N A;  2PJC A;  3RBU A;  5F09 A;  2PJ4 A;  2PJA A;  3SII A;  5D29 A;  2CF4 A;  3VH9 A;  2AFC A;  2L8R A;  1BPM A;  1Z8L A;  4H2K A;  2C1C A;  5FSX A;  2AFS A;  1FNO A;  2V8H A;  1Q7L A;  3EW5 A;  3FED A;  3B3T A;  2ZEP A;  3KHX A;  3GPQ A;  4J5R A;  2ZEG A;  4OC2 A;  5CPA A;  3GQE A;  5LYL A;  4MCP A;  4OIW A;  3MN8 A;  4J4Z A;  2VL1 A;  1Y0Y A;  1TY8 A;  3TC8 A;  4NGM A;  1BAV A;  1VGY A;  4PPZ A;  3IEH A;  2V77 A;  1HJZ A;  2ZEN A;  3L2N A;  1HDQ A;  4MHY A;  4MMO A;  3NH5 A;  4PQA A;  2OR4 A;  1YW6 A;  3V7Z A;  3N5F A;  1XMB A;  3PB7 X;  8CPA A;  1GYT A;  2C6G A;  3B2Y A;  3KR4 A;  3GPG A;  4RUH A;  3K2K A;  3K9T A;  2ZOG A;  3CDX A;  3I1U A;  4P10 A;  5DUS A;  1UWY A;  5E3B A;  4JZ0 A;  1ARM A;  3KQX A;  4R8F A;  4P45 A;  3PRT A;  3BI1 A;  1HDU A;  3D66 A;  4F9V A;  4IAV A;  5LYF A;  1TKH A;  1LCP A;  4IHM A;  3DLJ A;  2V8D A;  3JRU A;  1AYE A;  3V45 A;  3IC1 A;  2EWB A;  4J5Q A;  1TXZ A;  2XEG A;  4F8Z A;  3FEC A;  2CIJ A;  3EKE A;  3BXM A;  4GUA A;  2OOT A;  5FSZ A;  3B3S A;  2XEF A;  3SJF A;  1YW4 A;  4NGQ A;  4UIB A;  5D8N A;  2ABZ A;  5CB5 A;  3B3V A;  4OID A;  1QQ9 A;  2GU2 A;  1VHE A;  4ZX9 A;  1IGB A;  3PB9 X;  4ZY1 A;  3KAS A;  4ZX8 A;  2PJ6 A;  4MCQ A;  1Y0R A;  2O4H A;  3CT9 A;  3KQZ A;  3ISX A;  3B7I A;  2IMO A;  2EEE A;  3VAR A;  3WT4 A;  1ZG7 A;  1FT7 A;  4OC3 A;  2QVP A;  3GUX A;  1ZLI A;  4ZYQ A;  1QMU A;  5CBM A;  1TKJ A;  4OME A;  3T8W A;  1HEE A;  4P44 A;  1CX8 A;  3SI1 A;  6CPA A;  4ONW A;  4P4D A;  4OC5 A;  2HC9 A;  3KI9 A;  4NJQ A;  1LFW A;  4FAI A;  4A94 A;  1LAM A;  4LQG A;  2JEW A;  3PFO A;  2VRI A;  4O23 A;  4JVV A;  2F8H A;  5K8P A;  2QJ8 A;  4NGP A;  3WAB A;  1YD9 A;  3S9L A;  2BFQ A;  1JQG A;  4P4J A;  1LAP A;  4W9Y A;  5JM6 A;  3SJX A;  2X47 A;  3PB6 X;  1VHU A;  3VFQ A;  4PXB A;  4DJL A;  3DGV A;  5HXD A;  5IB9 A;  4R7M A;  1Y7E A;  5I4M A;  4A39 A;  3SIH A;  1CPS A;  3WC5 A;  5LRJ A;  5THW A;  4TU0 A;  3D68 A;  3S9M A;  1AMP A;  2PRQ A;  1YME A;  2PIY A;  2FAV A;  4AXV A;  1RTQ A;  3HUV A;  3GPO A;  2CTB A;  2WYR A;  4UML A;  4GVV A;  1XJO A;  3D4U A;  1LAN A;  2PJB A;  1M4L A;  1SPV A;  5LYI A;  3IIF A;  1XBU A;  5K8O A;  3IO1 A;  3KZW A;  4D86 A;  4UF4 A;  3KR5 A;  4ABK A;  2PJ3 A;  4JYW A;  3PBE A;  5K8N A;  2BO9 A;  3EWO A;  1H8L A;  3SIG A;  2PJ8 A;  4JLL A;  1ZLH A;  5K8M A;  2IJZ A;  1XRY A;  1ZG9 A;  2Q51 A;  3GB0 A;  3Q6Z A;  2PJ1 A;  3KHZ A;  4P6Y A;  4CPA A;  4GM5 A;  1ZG8 A;  4NGT A;  3SI0 A;  5FSY A;  4KSI A;  4P4F A;  4OKO A;  3SJG A;  2IQ6 A;  5DS0 A;  4MHZ A;  3ETI A;  5J1Q A;  4NGS A;  2ZOF A;  1PCA A;  3TX8 A;  4Z65 A;  2AFM A;  3IFE A;  4OP4 A;  3SJE A;  3WC7 A;  2XEJ A;  3D7D A;  4NJR A;  5LRG A;  2ZEH A;  4ZY0 A;  1ARL A;  4TNU A;  1OBR A;  3B35 A;  2ZEL A;  1NSA A;  2F7V A;  5LYD A;  1TXR A;  2V8V A;  3IWW A;  4P4I A;  4MHN A;  2EK8 A;  4MCR A;  4EWT A;  4GVW A;  2BFR A;  2RFH A;  2AFO A;  4ZI6 A;  4ESS A;  4P4E A;  3V2B A;  2JBK A;  1VHO A;  1BLL E;  2PJ2 A;  3SIJ A;  4MHP A;  2FVG A;  3PBB A;  1TKF A;  3GQO A;  2QYV A;  4DYO A;  1CP7 A;  4UEE A;  3FEE A;  4KYB A;  3D7H A;  2GRE A;  2C6C A;  2PJ9 A;  2AFW A;  2C6P A;  4K0C A;  3H8F A;  2WZN A;  4BD9 A;  3ISZ A;  5ELY A;  4OC0 A;  2DEA A;  1CBX A;  2ZEO A;  1F2O A;  2ZED A;  3PFE A;  2PJ0 A;  1R3N A;  1YSJ A;  3IIB A;  5CMS A;  2HB6 A;  4X2T A;  4FUU A;  3NH8 A;  4ETK A;  3D67 A;  1NJR A;  4NGR A;  1Z5R A;  4EFD A;  3EWR A;  2GLF A;  3LMS A;  5FSU A;  4X8I A;  4A37 A;  1CP6 A;  1F57 A;  3KL9 A;  4MXU A;  3RAM A;  4OC1 A;  2J9A A;  5HVF A;  1XFO A;  4ABL A;  2EK9 A;  3HLP A;  2ZEE A;  2NYQ A;  3SI2 A;  3NH4 A;  3H8E A;  5CB3 A;  4EME A;  1EE3 P;  3FJU A;  3BHX A;  4YWY A;  1Z2L A;  3GLJ A;  5HVG A;  2AFZ A;  4NGN A;  1CG2 A;  3B3C A;  3H8G A;  2GLJ A;  3PEI A;  2ZEF A;  2FXK A;  3D7F A;  2FG1 A;  3FH4 A;  2RB7 A;  1YLO A;  3NFZ A;  2PE3 A;  4IQY A;  1KWM A;  5JH9 A;  3NA6 A;  4OC4 A;  3IJ3 A;  3V38 A;  4MCS A;  3PB8 X;  2XEI A;  1IY7 A;  2LGR A;  3LWU A;  4JCA A;  4ETJ A;  2G9D A;  2V8G A;  2ZEM A;  1ZR5 A;  2PIZ A;  5HVH A;  4UIA A;  2PCU A;  2POK A;  1DE4 C;  2NSM A;  1CPX A;  5AIL A;  2JBJ A;  1BPN A;  3MRU A;  2ACF A;  2DX6 A;  3D7G A;  3JZT A;  4PXC A;  4F9U A;  3CPA A;  4R6T A;  2AFU A;  4JGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...