1LANA

Leucine aminopeptidase complex with l-leucinal
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Two-metal ion mechanism of bovine lens leucine aminopeptidase: active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
total genus 170
structure length 484
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lanA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lanA02
4MHZA 5FSVA 1BAVA 1VHOA 3PB6X 7CPAA 4X2TA 4EMEA 4GVWA 5JM6A 2WZNA 3D66A 3GPGA 3LWUA 1IY7A 4UMLA 2AFSA 1JQGA 2CIJA 1LCPA 2PIYA 5F09A 3D67A 4OP4A 5LYDA 4ETKA 2PJ6A 3SJEA 2HB6A 3D4UA 2ZOFA 4WWVA 3S9MA 1VHEA 3RAMA 1CPSA 1SPVA 3FF3A 4J5RA 5HXDA 4AXVA 3GUXA 1Z8LA 3IEHA 4ZY0A 3BI0A 4UEEA 1HDQA 3JZTA 1CG2A 1TKFA 3PB9X 4J4ZA 3H8GA 4A94A 4ZY1A 4EFDA 3SIIA 1ZR3A 1ZG7A 3VARA 1CPXA 2GU2A 2XEIA 2FXKA 1ELLP 4TNUA 4Z65A 3BHXA 2C6GA 3D7HA 4PXBA 5THWA 2HC9A 4A37A 4GUAA 4F9VA 2AFCA 4UEZA 3NH5A 1Y7EA 1YMEA 3SJFA 4TU0A 1KWMA 4R7MA 2XEJA 1R3NA 4W9YA 2C6CA 5HVHA 3B3CA 1R43A 1LAMA 1NJRA 3RBUA 3GPQA 4P45A 2EK9A 3IWWA 3KASA 2EEEA 3MN8A 4K3NA 3GPOA 5JH9A 5AILA 2PJ5A 4ZI6A 4P4IA 2DX6A 4Q7AA 4IAVA 5DS0A 5ELYA 2ZOGA 2O53A 4WJBA 4P6YA 1ZG9A 3B3TA 3I1UA 2FAVA 3B2YA 3NFZA 4MCRA 4DJLA 1LOKA 2ANPA 4OC4A 5HOLA 1M4LA 3PRTA 4CPAA 2ZEGA 4OIDA 4FAIA 1LANA 1AMPA 2AFMA 2ZEFA 5CBMA 1LFWA 1YSJA 1DE4C 4P4DA 4NGNA 1PYTB 4IK2A 4FBEA 5J1QA 4BD9A 4FUUA 3KZWA 2CF4A 1TF9A 4P10A 2NSMA 1RTQA 4EWTA 2PJCA 2PJAA 3FVLA 1GYTA 2OOTA 2BFRA 4NGSA 4B6ZA 4OC2A 3N5FA 4P44A 2RB7A 4P4FA 2ZEDA 1VHUA 4OC3A 1HJZA 4PXCA 3KQXA 2VRIA 4NGMA 2L8RA 2PE3A 3L2NA 4MXUA 4R8FA 1YW6A 4UEFA 2QYVA 3KGQA 5HVFA 4PQAA 3WC7A 5D29A 3SJXA 1CX8A 2ZEPA 3FH4A 3B3WA 3PBBA 3GB0A 1XJOA 4P4BA 5K8MA 3V38A 3IO1A 4UIAA 5D8NA 2XEGA 4J5SA 1BLLE 1XRYA 5LYFA 2RFHA 2BFQA 4D86A 5CPAA 1VGYA 2ZENA 3NH8A 3GQOA 4ABLA 1F2OA 4JZ0A 4O23A 1CP7A 3EJGA 3V45A 4YWYA 2QVPA 3Q71A 3KR5A 2Q4ZA 2CTCA 3SJGA 4YU9A 4OIWA 2QJ8A 2WYRA 6CPAA 4H2KA 5CB3A 3EKEA 1TXRA 4MMOA 3D68A 4KYBA 4UF4A 3CDXA 1BPNA 4A38A 2FG1A 1CBXA 4MRIA 3KHZA 1EE3P 3D7FA 3EJFA 4ABKA 3NH4A 1XFOA 4MCPA 5FSYA 4RUHA 4UIBA 4DUKA 2C6PA 4JCAA 1Q7LA 4R6TA 3VATA 1VIXA 3BI1A 3S9LA 2C1CA 4F8ZA 3B7IA 5E3BA 3H8FA 1ELMP 1ZR5A 3WT4A 4JYWA 1H8LA 3PFOA 4MHYA 4NFRA 4PPZA 4PXDA 3DLJA 3IIFA 2VL1A 4LQGA 1DTDA 2IQ6A 3ISZA 2ABZA 2JBJA 3FECA 4ESSA 2PCUA 4P4JA 4OMEA 3ISXA 3SIHA 1Y0RA 2LGRA 3K2KA 3PFEA 4J5QA 4G1PA 1CP6A 3PEIA 1ZLIA 3ETIA 5K8NA 4ZYQA 2ZEMA 2IMOA 3SIGA 3SI0A 3B35A 2Q43A 3JRUA 2XEFA 3NA6A 4A39A 4X8IA 3PB7X 2CTBA 5LRKA 5HIHA 5FSZA 2GREA 3IIDA 2BO9A 1ZLHA 4FWUA 1ARMA 2IJZA 3BXMA 3V7ZA 3IIBA 3WC5A 1HEEA 2FVGA 4MCQA 1QQ9A 4OC0A 3FX6A 3KR4A 3FMCA 1ZG8A 3EWPA 3TX8A 2JEWA 3KHXA 3SIJA 3HUVA 2ZEHA 5K8OA 3QNVA 1HDUA 2PIZA 3KL9A 3LMSA 2O4HA 2AFOA 5IB9A 1ARLA 1TKHA 3D7DA 2Q51A 3PBEA 3K9TA 1TKJA 1LAPA 2DEAA 4NJRA 5CMSA 3D7GA 2JBKA 4NGQA 2AFXA 2PJ2A 4OC5A 3VFQA 5JGFA 2NYQA 2PVVA 1F57A 1NSAA 3DGVA 3FEDA 4IHMA 3T8WA 3CPXA 4ZX8A 3Q6ZA 1XMBA 3B3VA 3RZAA 5FSUA 1Z5RA 3V2BA 3B3SA 2OR4A 4NJQA 2X47A 1YLOA 2GLJA 2PRQA 1IGBA 4ONWA 2EWBA 4MHPA 1AYEA 3GQEA 1UWYA 2V77A 3MRUA 2I3CA 2AFZA 4F9UA 4JLLA 1Z2LA 1TY8A 3KQZA 1F2PA 2PJ4A 2PJ1A 2V8DA 2XD7A 1TF8A 1FNOA 2AFWA 5FSXA 4OC1A 1YD9A 1QMUA 2PJ0A 5LYIA 4ZX9A 2PJ8A 4GVVA 2BCOA 4K0CA 5CB5A 3SI2A 4R76A 4NGPA 4PXEA 2J9AA 3WABA 2G9DA 8CPAA 2V8GA 1YW4A 4MCSA 3GLJA 4X3RA 4JGKA 2ACFA 4KSIA 3FJUA 5LRJA 2PVWA 1BPMA 4IQYA 5HVGA 2ZELA 4OKOA 3H8EA 2BOAA 2PJ3A 4NGTA 3PB4X 5LYLA 2AFUA 1PCAA 3EWRA 2GLFA 4GM5A 1XBUA 1Y0YA 2POKA 3TC8A 2F7VA 2ZEEA 4DYOA 4ZY2A 2PJ7A 2EK8A 1TXZA 3EWQA 2PJBA 3IC1A 3SI1A 2F8HA 3CT9A 4NGRA 3IJ3A 3EW5A 5LRGA 3CPAA 2PJ9A 4P4EA 1FT7A 5DUSA 5I4MA 4MHNA 3IFEA 3PB8X 4JVVA 3KI9A 4TWEA 3HLPA 5K8PA 3WC6A 3VH9A 3FEEA 3S9NA 2ZEOA 3EWOA 2V8VA 4ETJA 2V8HA 1OBRA
chains in the Genus database with same CATH superfamily
4MHZA 2VEZA 5FSVA 1BAVA 1VHOA 2D4PA 3PB6X 3H4QA 4A33A 1Q2YA 7CPAA 4X2TA 3TOBA 4EMEA 4GVWA 2OZHA 2Z3NA 3GIUA 4CAFA 2I79A 5JM6A 4BMHA 1XE4A 4CYOA 2WZNA 3D66A 2R8VA 3GPGA 4KOTA 3LWUA 1Y9KA 2A4NA 1IY7A 4UMLA 2AFSA 1JQGA 2CIJA 1LCPA 2PIYA 2GANA 4CGNA 2ZW7A 4C68A 5F09A 3D67A 3CXPA 4OP4A 4HNWB 5AG5A 5LYDA 4ETKA 2PJ6A 3FYNA 3SJEA 1K4JA 2HB6A 1IYLA 2ZOFA 3D4UA 4WWVA 4A95A 4B12A 3S9MA 1VHEA 3RAMA 1CPSA 2K5TA 4R3LA 1P4NA 2EUIA 4C2ZA 1SPVA 3FF3A 4J5RA 4IUSA 4XPDC 4AXVA 1NSLA 5HXDA 4FD4A 3VWDA 3GUXA 1Z8LA 3IEHA 4ZY0A 1Z9UA 3BI0A 4UCPA 4UEEA 4A2ZA 1HDQA 3JZTA 2JDDA 1XF8A 2EBJA 1CG2A 1TKFA 2IL4A 3PB9X 1YVKA 4J4ZA 3H8GA 2GE3A 3OWCA 4MY3A 3S6KA 4A94A 4M3SA 4PSXA 4ZY1A 4EFDA 2J8RA 3SIIA 3IU1A 2QECA 1RXTA 2DF5A 4CAXA 5DWNA 1ZR3A 4FD7A 5F46A 3K9UA 2ZW5A 1ZG7A 3TE4A 3VARA 1CPXA 4A31A 2GU2A 2XEIA 1Q2CA 2WCTA 2FXKA 1ELLP 2VZYA 4TNUA 1Z8TA 2C6GA 2Q7SA 3BHXA 3D7HA 2OZGA 4PXBA 1XEBA 4Z65A 5THWA 4ZBGA 1FY7A 2HC9A 2B5GA 4A37A 1B6BA 3I9SA 4GUAA 4F9VA 2AFCA 3LODA 4UEZA 4F0YA 3CXQA 3NH5A 1U6MA 1Y7EA 1YMEA 1Y9WA 3SJFA 4TU0A 1KWMA 4R7MA 2XEJA 4RS2A 1R3NA 2FXFA 4W9YA 2PQ8A 2C6CA 3IWEA 4CS0B 5HVHA 3W6XA 3B3CA 4XNHC 1R43A 1LAMA 1NJRA 3PZJA 3GPQA 1Y7RA 4P45A 3RBUA 2EK9A 3IWWA 1GHEA 3KASA 2EEEA 3MN8A 4K3NA 3GPOA 5JH9A 5AILA 2PJ5A 4ZI6A 2WSAA 2YNEA 4P4IA 2VXKA 2DX6A 4KLWA 4Q7AA 4NEXA 4IAVA 4C7HA 5DS0A 1YK3A 2ARHA 3FBUA 2ZOGA 2R98A 2DPTA 2O53A 4WJBA 4P6YA 1ZG9A 3B3TA 3I1UA 2FAVA 3F8KA 2VI7A 1UFHA 3B2YA 3NFZA 4R87A 4MCRA 2WUUA 4DJLA 4FD5A 1WWZA 4B10A 1LOKA 1P0HA 2ANPA 3P2FA 4OC4A 5HOLA 1M4LA 1S3ZA 3PRTA 3R1KA 4CPAA 5IB0A 3BLNA 2ZEGA 2G3TA 4OIDA 2B4BA 3QAYA 2AJ6A 4JD6A 1LANA 4FAIA 1AMPA 4FD6A 4LQ6A 2AFMA 2ZEFA 5CBMA 2ZW4A 1LFWA 1YSJA 1LRZA 1DE4C 2PRBA 3F5BA 4NGNA 4P4DA 1CM0A 1PYTB 4IK2A 4KSAA 4FBEA 5J1QA 2P6GA 4KS9A 4KVOE 4C7IA 2OB0A 2Q4VA 4I49A 2D4OA 5EMIA 5DWMA 4BD9A 4BINA 4FUUA 3KZWA 4QC6A 2EVNA 1M4GA 4OLLA 4C2XA 1X10A 2CF4A 1TF9A 4P10A 5EBVA 4CGOA 4HPSA 2NSMA 4H6UA 3W6SA 1RTQA 4EWTA 1MJBA 2ATRA 2G0BA 2PJCA 4UCMA 2PJAA 3NE7A 4Q36A 3FVLA 1MK4A 3TTHA 1GYTA 1XMTA 2J8MA 2PSWA 3IU2A 3TFYA 3DDDA 2WPXA 3ZZIA 2C27A 5C82A 2OOTA 2BFRA 4XPDB 1M44A 3IGRA 4PK2A 3FNCA 4NGSA 4B6ZA 1JWQA 4OC2A 3N5FA 4JJXA 2RB7A 4M6HA 4P44A 4P4FA 5G20A 4CGMA 5AG7A 2ZEDA 3BJ7A 1VHUA 4QVTA 3S6HA 1KUYA 1OZPA 2DXQA 4MI4A 4OC3A 4CYPA 1HJZA 1YX0A 3LACA 3KQXA 2VRIA 4PXCA 3ZJ0A 2G3AA 3R95A 4KZTA 4NGMA 3R9FA 3EO4A 4ZGYB 2Z11A 2ODFA 3VWEA 4KUAA 2L8RA 2PE3A 2REEA 3L2NA 4CYQA 3N7ZA 4MXUA 4R8FA 5JQ4A 4XPLA 1YW6A 1XIXA 3V8IA 4UEFA 3RYOA 2QYVA 3KGQA 5HVFA 4PQAA 3WC7A 2BL1A 5D29A 3SJXA 1CX8A 2ZEPA 3FH4A 3B3WA 3SXOA 3PBBA 4UFWA 2B58A 3GB0A 3GYAA 1KZFA 1XJOA 4P4BA 2I00A 4Y49C 3IO1A 3V38A 3FB3A 5K8MA 4L8AA 4R57A 4J3GA 4MFPA 4UIAA 2OZUA 3RO0A 5D8NA 4AVAA 2JZFA 2XEGA 4J5SA 4UCNA 3EC4A 1BLLE 1XRYA 5A28A 1IYKA 1I21A 1VKCA 5LYFA 2B3UA 2NMTA 5KTAA 2RFHA 2BFQA 4D86A 4DNCA 2YNCA 4MBUA 5CPAA 2B4DB 5E96A 1VGYA 2ZENA 3EXNA 3GQOA 3NH8A 4F6AA 4ABLA 2FIWA 4MY0A 1F2OA 5I0CA 2CXAA 4JZ0A 2WPWA 4MFQA 4O23A 4A30A 1IU8A 2X7BA 5AG4A 1CP7A 3EJGA 3V45A 4YWYA 2QVPA 3Q71A 4OADA 3KR5A 3TT2A 2VQYA 2Z3PA 2Q4ZA 2CTCA 3SJGA 4YU9A 4QBJA 2FL4A 4PV6A 4KORA 4OIWA 3CXSA 2QJ8A 4MFZA 2Z10A 5J8CA 1KUXA 2BEIA 4P4EA 4KOYA 2WYRA 2R7HA 6CPAA 4CRZB 4H2KA 5CB3A 3EKEA 1TXRA 4MMOA 3D68A 4KYBA 3E0KA 4MFJA 2DPSA 3NE8A 1VHSA 1BOBA 2PR8A 4RN7A 4UF4A 4NCZA 5GCNA 3CDXA 2CNTA 4JXRA 1BPNA 4A38A 2FG1A 2ZXVA 2YNCC 1CBXA 5F47A 4MRIA 3TOAA 3S6GA 3KHZA 5G1ZA 4U9YA 1Q2DA 1EE3P 3D7FA 3EJFA 4ABKA 2YNDA 4GXHA 1J4JA 2GFQA 4BBHA 3NH4A 2O28A 4H89A 4HNYB 4R3KA 5EC4A 1XFOA 2Z0ZA 1S7FA 4MCPA 5FSYA 3TO6A 4RUHA 4UIBA 4CAWA 2Q4YA 4DUKA 3EFAA 1A2ZA 2C6PA 2OU2A 4JCAA 4YFJA 1Q7LA 4R6TA 4ONUA 3VATA 4II9A 1VIXA 3BI1A 2Q44A 3PGPA 5A27A 3S9LA 2JLMA 2C1CA 4F8ZA 1MJAA 5H86A 1IICA 3B7IA 4PSWA 5E3BA 3H8FA 1ELMP 1M1DA 1ZR5A 3WT4A 4JYWA 3D3SA 1IOIA 1H8LA 4UFVA 3PFOA 4MHYA 4NFRA 4PPZA 4PXDA 3DNSA 3DLJA 3IIFA 4AG7A 3D2PA 2VL1A 3JVNA 4HKFA 4LQGA 4CGLA 1DTDA 1NMTA 2IQ6A 3GKRA 3ISZA 4U9ZA 3WR7A 2P6FA 3DR8A 2FT0A 4E2AA 2ABZA 2JBJA 3FECA 1I1DA 5HMNA 4ESSA 1B87A 2PCUA 4MJ8A 3SHPA 1X12A 4P4JA 2QMLA 4JLYA 4OMEA 3GY9A 3MGDA 4KOSA 3ISXA 1TIQA 3SIHA 1Y0RA 4KOVA 2LGRA 2P6EA 3K2KA 3PFEA 3DSBA 1M4DA 4J5QA 3FXTA 4G1PA 1CP6A 3PEIA 1YQEA 1M4IA 1ZLIA 3JUWA 5G22A 3KKWA 1YREA 4A32A 3ETIA 4B5PB 4X5KA 5K8NA 4AB7A 1IB1E 4ZYQA 2W2GA 2ZEMA 3F0AA 2FCKA 2IMOA 3SIGA 3B8GA 3SI0A 1IIDA 4Y49B 3B35A 2Q43A 3JRUA 1NE9A 2XEFA 3NA6A 4A39A 4X8IA 4B5OA 3PB7X 4UBRA 2YGWA 2CTBA 3D8PA 5LRKA 5HIHA 5FSZA 2GREA 3IIDA 2BO9A 1KUVA 3DR6A 1ZLHA 2Z3KA 1ARMA 4FWUA 4F0XA 2IJZA 1MJ9A 4LX9A 3BXMA 4B11A 3V7ZA 3IIBA 1S7KA 3WC5A 1HEEA 4R9MA 2AE6A 4B13A 2FVGA 2QIRA 1QQ9A 4MCQA 4OC0A 5G21A 3EY5A 3FX6A 5F48A 3KR4A 1ON0A 1CJWA 1WK4A 3FMCA 1ZG8A 4CYNA 3TO9A 3EWPA 3I3GA 3TX8A 2JEWA 3KHXA 3SIJA 1AUGA 2FS5A 2ZEHA 3HUVA 4MFKA 5K8OA 3QNVA 4K30A 1HDUA 2VZZA 2PIZA 2B3VA 3KL9A 3LMSA 2O4HA 4AVBA 5BWAB 2AFOA 5IB9A 4AVCA 4CRYB 2RC4A 1ARLA 1TKHA 2Z3LA 1QSRA 2BSWA 3H5ZA 3D7DA 3T90A 2Q51A 3PBEA 3K9TA 1TKJA 1LAPA 2CNSA 2DEAA 4LUAA 4NJRA 4C2YA 1N71A 5CMSA 3D7GA 4YRHA 2CY2A 4XNHB 4U5YA 1QSOA 2JBKA 4NGQA 2CNMA 2AFXA 3FRMA 1PU9A 2PJ2A 2JEVA 2BUEA 4OC5A 3VFQA 5JGFA 2NYQA 3C26A 2PVVA 1F57A 1YLEA 3PP9A 2R1IA 4HNXB 3P2HA 1NSAA 4KVME 1I12A 1R57A 3DGVA 1Z8WA 5KTCA 1RO5A 5ISVA 4M6GA 3R9EA 3FEDA 3SXNA 4IHMA 3T8WA 2B5GB 4KOUA 2KCWA 4RI1A 1QSNA 3A9LA 3CPXA 4M6IA 2VBQA 4ZX8A 4OAEA 3R96A 3Q6ZA 1XMBA 3BJ8A 2B4DA 5HH1A 3B3VA 3CZXA 3RZAA 5FSUA 1Z5RA 3V2BA 3B3SA 2OR4A 4NJQA 5C88A 2X47A 1YLOA 2GLJA 2J8NA 1S7LA 4CAVA 2PRQA 1IGBA 4ONWA 2EWBA 4MHPA 1AYEA 4UWIA 5H84A 3GQEA 2RNKA 1UWYA 1YVOA 2V77A 3MRUA 2PC1A 4KLVA 4CGPA 2ZW6A 1SQHA 3RNZA 4H6ZA 2I3CA 5F49A 3TCVA 3G3SA 4MHDA 1Z4EA 3TO7A 1PUAA 2AFZA 4F9UA 2Q7BA 1QSTA 4JLLA 1Z2LA 5IX3A 1TY8A 3KQZA 4B14A 4KOWA 1F2PA 2PJ4A 2PJ1A 2V8DA 2XD7A 1TF8A 1FNOA 4NSQA 2AFWA 5FSXA 4OC1A 5JPHA 2JZDA 1YD9A 4QB9A 1QMUA 2PJ0A 4NF1A 5LYIA 4ZX9A 1S60A 2PJ8A 1QSMA 4GVVA 2BCOA 4QUSA 1YGHA 2Z3MA 4K0CA 4UFXA 5CB5A 4GS4A 3SI2A 2FSRA 4R76A 4NGPA 4PXEA 2HV2A 2GIVA 5AGEA 2J9AA 4XPKA 3WABA 3QB8A 2G9DA 8CPAA 2V8GA 1YW4A 4MCSA 2F5IA 3GLJA 4X3RA 5ELYA 4E8OA 5KTDA 4E0AA 1BO4A 4JGKA 5J8FA 1XOVA 2JDCA 2KQVA 2PDOA 4KUBA 4YGOA 3S6FA 1V0CA 2ACFA 4KSIA 3FJUA 5LRJA 3IWGA 2PVWA 1BPMA 4IQYA 1S7NA 5HVGA 1Z4RA 1IOFA 1S5KA 2ZELA 3H8EA 2Q0YA 4KOXA 4OKOA 2HUZA 1ZO0A 4Q38A 2BOAA 2PJ3A 2FIAA 4NGTA 3W91A 4CAEA 3PB4X 5LYLA 2AFUA 1PCAA 2Z3OA 2ZPAA 3EWRA 2GLFA 2REFA 4JWPA 4GM5A 1XBUA 1Y0YA 2EO8A 2POKA 3TC8A 2F7VA 1Z8XA 1L0CA 2ZEEA 4UWJA 4ZY2A 4KSFA 4MFLA 2JZEA 3R9GA 2PJ7A 2OH1A 5CNPA 4DYOA 2EK8A 1TXZA 3EWQA 2PJBA 3IC1A 3SI1A 5IV0A 2PR1A 4L89A 3G8WA 2F8HA 2FE7A 3CT9A 4NGRA 4UA3A 1YR0A 3IJ3A 3EW5A 4IF5A 5LRGA 4EVYA 2P0WA 3D2MA 3CPAA 2PJ9A 3QAHA 4NXYA 4ORFA 1FT7A 5DUSA 2H5MA 4MHNA 3IFEA 3PB8X 4M85A 4JVVA 4PK3A 3KI9A 3UY5A 5I4MA 4TWEA 3HLPA 5AG6A 5FVJA 2HQYA 4JXQA 3JTKA 5K8PA 3WC6A 4B5PA 3VH9A 2Y0MA 3T9YA 3FEEA 4AG9A 3S9NA 3EWOA 2ZEOA 2V8VA 2Q04A 4ETJA 3LD2A 4KVXA 3FIXA 2V8HA 1OBRA
chains in the Genus database with same CATH topology
4MHZA 5FSVA 1BAVA 1VHOA 3PB6X 7CPAA 4X2TA 4EMEA 4GVWA 5JM6A 2WZNA 3D66A 3GPGA 3LWUA 1IY7A 4UMLA 2AFSA 1JQGA 2CIJA 1LCPA 2PIYA 5F09A 3D67A 4OP4A 5LYDA 4ETKA 2PJ6A 3SJEA 2HB6A 3D4UA 2ZOFA 4WWVA 3S9MA 1VHEA 3RAMA 1CPSA 1SPVA 3FF3A 4J5RA 5HXDA 4AXVA 3GUXA 1Z8LA 3IEHA 4ZY0A 3BI0A 4UEEA 1HDQA 3JZTA 1CG2A 1TKFA 3PB9X 4J4ZA 3H8GA 4A94A 4ZY1A 4EFDA 3SIIA 1ZR3A 1ZG7A 3VARA 1CPXA 2GU2A 2XEIA 2FXKA 1ELLP 4TNUA 4Z65A 3BHXA 2C6GA 3D7HA 4PXBA 5THWA 2HC9A 4A37A 4GUAA 4F9VA 2AFCA 4UEZA 3NH5A 1Y7EA 1YMEA 3SJFA 4TU0A 1KWMA 4R7MA 2XEJA 1R3NA 4W9YA 2C6CA 5HVHA 3B3CA 1R43A 1LAMA 1NJRA 3RBUA 3GPQA 4P45A 2EK9A 3IWWA 3KASA 2EEEA 3MN8A 4K3NA 3GPOA 5JH9A 5AILA 2PJ5A 4ZI6A 4P4IA 2DX6A 4Q7AA 4IAVA 5DS0A 5ELYA 2ZOGA 2O53A 4WJBA 4P6YA 1ZG9A 3B3TA 3I1UA 2FAVA 3B2YA 3NFZA 4MCRA 4DJLA 1LOKA 2ANPA 4OC4A 5HOLA 1M4LA 3PRTA 4CPAA 2ZEGA 4OIDA 4FAIA 1LANA 1AMPA 2AFMA 2ZEFA 5CBMA 1LFWA 1YSJA 1DE4C 4P4DA 4NGNA 1PYTB 4IK2A 4FBEA 5J1QA 4BD9A 4FUUA 3KZWA 2CF4A 1TF9A 4P10A 2NSMA 1RTQA 4EWTA 2PJCA 2PJAA 3FVLA 1GYTA 2OOTA 2BFRA 4NGSA 4B6ZA 4OC2A 3N5FA 4P44A 2RB7A 4P4FA 2ZEDA 1VHUA 4OC3A 1HJZA 4PXCA 3KQXA 2VRIA 4NGMA 2L8RA 2PE3A 3L2NA 4MXUA 4R8FA 1YW6A 4UEFA 2QYVA 3KGQA 5HVFA 4PQAA 3WC7A 5D29A 3SJXA 1CX8A 2ZEPA 3FH4A 3B3WA 3PBBA 3GB0A 1XJOA 4P4BA 5K8MA 3V38A 3IO1A 4UIAA 5D8NA 2XEGA 4J5SA 1BLLE 1XRYA 5LYFA 2RFHA 2BFQA 4D86A 5CPAA 1VGYA 2ZENA 3NH8A 3GQOA 4ABLA 1F2OA 4JZ0A 4O23A 1CP7A 3EJGA 3V45A 4YWYA 2QVPA 3Q71A 3KR5A 2Q4ZA 2CTCA 3SJGA 4YU9A 4OIWA 2QJ8A 2WYRA 6CPAA 4H2KA 5CB3A 3EKEA 1TXRA 4MMOA 3D68A 4KYBA 4UF4A 3CDXA 1BPNA 4A38A 2FG1A 1CBXA 4MRIA 3KHZA 1EE3P 3D7FA 3EJFA 4ABKA 3NH4A 1XFOA 4MCPA 5FSYA 4RUHA 4UIBA 4DUKA 2C6PA 4JCAA 1Q7LA 4R6TA 3VATA 1VIXA 3BI1A 3S9LA 2C1CA 4F8ZA 3B7IA 5E3BA 3H8FA 1ELMP 1ZR5A 3WT4A 4JYWA 1H8LA 3PFOA 4MHYA 4NFRA 4PPZA 4PXDA 3DLJA 3IIFA 2VL1A 4LQGA 1DTDA 2IQ6A 3ISZA 2ABZA 2JBJA 3FECA 4ESSA 2PCUA 4P4JA 4OMEA 3ISXA 3SIHA 1Y0RA 2LGRA 3K2KA 3PFEA 4J5QA 4G1PA 1CP6A 3PEIA 1ZLIA 3ETIA 5K8NA 4ZYQA 2ZEMA 2IMOA 3SIGA 3SI0A 3B35A 2Q43A 3JRUA 2XEFA 3NA6A 4A39A 4X8IA 3PB7X 2CTBA 5LRKA 5HIHA 5FSZA 2GREA 3IIDA 2BO9A 1ZLHA 4FWUA 1ARMA 2IJZA 3BXMA 3V7ZA 3IIBA 3WC5A 1HEEA 2FVGA 4MCQA 1QQ9A 4OC0A 3FX6A 3KR4A 3FMCA 1ZG8A 3EWPA 3TX8A 2JEWA 3KHXA 3SIJA 3HUVA 2ZEHA 5K8OA 3QNVA 1HDUA 2PIZA 3KL9A 3LMSA 2O4HA 2AFOA 5IB9A 1ARLA 1TKHA 3D7DA 2Q51A 3PBEA 3K9TA 1TKJA 1LAPA 2DEAA 4NJRA 5CMSA 3D7GA 2JBKA 4NGQA 2AFXA 2PJ2A 4OC5A 3VFQA 5JGFA 2NYQA 2PVVA 1F57A 1NSAA 3DGVA 3FEDA 4IHMA 3T8WA 3CPXA 4ZX8A 3Q6ZA 1XMBA 3B3VA 3RZAA 5FSUA 1Z5RA 3V2BA 3B3SA 2OR4A 4NJQA 2X47A 1YLOA 2GLJA 2PRQA 1IGBA 4ONWA 2EWBA 4MHPA 1AYEA 3GQEA 1UWYA 2V77A 3MRUA 2I3CA 2AFZA 4F9UA 4JLLA 1Z2LA 1TY8A 3KQZA 1F2PA 2PJ4A 2PJ1A 2V8DA 2XD7A 1TF8A 1FNOA 2AFWA 5FSXA 4OC1A 1YD9A 1QMUA 2PJ0A 5LYIA 4ZX9A 2PJ8A 4GVVA 2BCOA 4K0CA 5CB5A 3SI2A 4R76A 4NGPA 4PXEA 2J9AA 3WABA 2G9DA 8CPAA 2V8GA 1YW4A 4MCSA 3GLJA 4X3RA 4JGKA 2ACFA 4KSIA 3FJUA 5LRJA 2PVWA 1BPMA 4IQYA 5HVGA 2ZELA 4OKOA 3H8EA 2BOAA 2PJ3A 4NGTA 3PB4X 5LYLA 2AFUA 1PCAA 3EWRA 2GLFA 4GM5A 1XBUA 1Y0YA 2POKA 3TC8A 2F7VA 2ZEEA 4DYOA 4ZY2A 2PJ7A 2EK8A 1TXZA 3EWQA 2PJBA 3IC1A 3SI1A 2F8HA 3CT9A 4NGRA 3IJ3A 3EW5A 5LRGA 3CPAA 2PJ9A 4P4EA 1FT7A 5DUSA 5I4MA 4MHNA 3IFEA 3PB8X 4JVVA 3KI9A 4TWEA 3HLPA 5K8PA 3WC6A 3VH9A 3FEEA 3S9NA 2ZEOA 3EWOA 2V8VA 4ETJA 2V8HA 1OBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHZ A;  5FSV A;  1BAV A;  1VHO A;  3PB6 X;  7CPA A;  4X2T A;  4EME A;  4GVW A;  5JM6 A;  2WZN A;  3D66 A;  3GPG A;  3LWU A;  1IY7 A;  4UML A;  2AFS A;  1JQG A;  2CIJ A;  1LCP A;  2PIY A;  5F09 A;  3D67 A;  4OP4 A;  5LYD A;  4ETK A;  2PJ6 A;  3SJE A;  2HB6 A;  3D4U A;  2ZOF A;  4WWV A;  3S9M A;  1VHE A;  3RAM A;  1CPS A;  1SPV A;  3FF3 A;  4J5R A;  5HXD A;  4AXV A;  3GUX A;  1Z8L A;  3IEH A;  4ZY0 A;  3BI0 A;  4UEE A;  1HDQ A;  3JZT A;  1CG2 A;  1TKF A;  3PB9 X;  4J4Z A;  3H8G A;  4A94 A;  4ZY1 A;  4EFD A;  3SII A;  1ZR3 A;  1ZG7 A;  3VAR A;  1CPX A;  2GU2 A;  2XEI A;  2FXK A;  1ELL P;  4TNU A;  4Z65 A;  3BHX A;  2C6G A;  3D7H A;  4PXB A;  5THW A;  2HC9 A;  4A37 A;  4GUA A;  4F9V A;  2AFC A;  4UEZ A;  3NH5 A;  1Y7E A;  1YME A;  3SJF A;  4TU0 A;  1KWM A;  4R7M A;  2XEJ A;  1R3N A;  4W9Y A;  2C6C A;  5HVH A;  3B3C A;  1R43 A;  1LAM A;  1NJR A;  3RBU A;  3GPQ A;  4P45 A;  2EK9 A;  3IWW A;  3KAS A;  2EEE A;  3MN8 A;  4K3N A;  3GPO A;  5JH9 A;  5AIL A;  2PJ5 A;  4ZI6 A;  4P4I A;  2DX6 A;  4Q7A A;  4IAV A;  5DS0 A;  5ELY A;  2ZOG A;  2O53 A;  4WJB A;  4P6Y A;  1ZG9 A;  3B3T A;  3I1U A;  2FAV A;  3B2Y A;  3NFZ A;  4MCR A;  4DJL A;  1LOK A;  2ANP A;  4OC4 A;  5HOL A;  1M4L A;  3PRT A;  4CPA A;  2ZEG A;  4OID A;  4FAI A;  1LAN A;  1AMP A;  2AFM A;  2ZEF A;  5CBM A;  1LFW A;  1YSJ A;  1DE4 C;  4P4D A;  4NGN A;  1PYT B;  4IK2 A;  4FBE A;  5J1Q A;  4BD9 A;  4FUU A;  3KZW A;  2CF4 A;  1TF9 A;  4P10 A;  2NSM A;  1RTQ A;  4EWT A;  2PJC A;  2PJA A;  3FVL A;  1GYT A;  2OOT A;  2BFR A;  4NGS A;  4B6Z A;  4OC2 A;  3N5F A;  4P44 A;  2RB7 A;  4P4F A;  2ZED A;  1VHU A;  4OC3 A;  1HJZ A;  4PXC A;  3KQX A;  2VRI A;  4NGM A;  2L8R A;  2PE3 A;  3L2N A;  4MXU A;  4R8F A;  1YW6 A;  4UEF A;  2QYV A;  3KGQ A;  5HVF A;  4PQA A;  3WC7 A;  5D29 A;  3SJX A;  1CX8 A;  2ZEP A;  3FH4 A;  3B3W A;  3PBB A;  3GB0 A;  1XJO A;  4P4B A;  5K8M A;  3V38 A;  3IO1 A;  4UIA A;  5D8N A;  2XEG A;  4J5S A;  1BLL E;  1XRY A;  5LYF A;  2RFH A;  2BFQ A;  4D86 A;  5CPA A;  1VGY A;  2ZEN A;  3NH8 A;  3GQO A;  4ABL A;  1F2O A;  4JZ0 A;  4O23 A;  1CP7 A;  3EJG A;  3V45 A;  4YWY A;  2QVP A;  3Q71 A;  3KR5 A;  2Q4Z A;  2CTC A;  3SJG A;  4YU9 A;  4OIW A;  2QJ8 A;  2WYR A;  6CPA A;  4H2K A;  5CB3 A;  3EKE A;  1TXR A;  4MMO A;  3D68 A;  4KYB A;  4UF4 A;  3CDX A;  1BPN A;  4A38 A;  2FG1 A;  1CBX A;  4MRI A;  3KHZ A;  1EE3 P;  3D7F A;  3EJF A;  4ABK A;  3NH4 A;  1XFO A;  4MCP A;  5FSY A;  4RUH A;  4UIB A;  4DUK A;  2C6P A;  4JCA A;  1Q7L A;  4R6T A;  3VAT A;  1VIX A;  3BI1 A;  3S9L A;  2C1C A;  4F8Z A;  3B7I A;  5E3B A;  3H8F A;  1ELM P;  1ZR5 A;  3WT4 A;  4JYW A;  1H8L A;  3PFO A;  4MHY A;  4NFR A;  4PPZ A;  4PXD A;  3DLJ A;  3IIF A;  2VL1 A;  4LQG A;  1DTD A;  2IQ6 A;  3ISZ A;  2ABZ A;  2JBJ A;  3FEC A;  4ESS A;  2PCU A;  4P4J A;  4OME A;  3ISX A;  3SIH A;  1Y0R A;  2LGR A;  3K2K A;  3PFE A;  4J5Q A;  4G1P A;  1CP6 A;  3PEI A;  1ZLI A;  3ETI A;  5K8N A;  4ZYQ A;  2ZEM A;  2IMO A;  3SIG A;  3SI0 A;  3B35 A;  2Q43 A;  3JRU A;  2XEF A;  3NA6 A;  4A39 A;  4X8I A;  3PB7 X;  2CTB A;  5LRK A;  5HIH A;  5FSZ A;  2GRE A;  3IID A;  2BO9 A;  1ZLH A;  4FWU A;  1ARM A;  2IJZ A;  3BXM A;  3V7Z A;  3IIB A;  3WC5 A;  1HEE A;  2FVG A;  4MCQ A;  1QQ9 A;  4OC0 A;  3FX6 A;  3KR4 A;  3FMC A;  1ZG8 A;  3EWP A;  3TX8 A;  2JEW A;  3KHX A;  3SIJ A;  3HUV A;  2ZEH A;  5K8O A;  3QNV A;  1HDU A;  2PIZ A;  3KL9 A;  3LMS A;  2O4H A;  2AFO A;  5IB9 A;  1ARL A;  1TKH A;  3D7D A;  2Q51 A;  3PBE A;  3K9T A;  1TKJ A;  1LAP A;  2DEA A;  4NJR A;  5CMS A;  3D7G A;  2JBK A;  4NGQ A;  2AFX A;  2PJ2 A;  4OC5 A;  3VFQ A;  5JGF A;  2NYQ A;  2PVV A;  1F57 A;  1NSA A;  3DGV A;  3FED A;  4IHM A;  3T8W A;  3CPX A;  4ZX8 A;  3Q6Z A;  1XMB A;  3B3V A;  3RZA A;  5FSU A;  1Z5R A;  3V2B A;  3B3S A;  2OR4 A;  4NJQ A;  2X47 A;  1YLO A;  2GLJ A;  2PRQ A;  1IGB A;  4ONW A;  2EWB A;  4MHP A;  1AYE A;  3GQE A;  1UWY A;  2V77 A;  3MRU A;  2I3C A;  2AFZ A;  4F9U A;  4JLL A;  1Z2L A;  1TY8 A;  3KQZ A;  1F2P A;  2PJ4 A;  2PJ1 A;  2V8D A;  2XD7 A;  1TF8 A;  1FNO A;  2AFW A;  5FSX A;  4OC1 A;  1YD9 A;  1QMU A;  2PJ0 A;  5LYI A;  4ZX9 A;  2PJ8 A;  4GVV A;  2BCO A;  4K0C A;  5CB5 A;  3SI2 A;  4R76 A;  4NGP A;  4PXE A;  2J9A A;  3WAB A;  2G9D A;  8CPA A;  2V8G A;  1YW4 A;  4MCS A;  3GLJ A;  4X3R A;  4JGK A;  2ACF A;  4KSI A;  3FJU A;  5LRJ A;  2PVW A;  1BPM A;  4IQY A;  5HVG A;  2ZEL A;  4OKO A;  3H8E A;  2BOA A;  2PJ3 A;  4NGT A;  3PB4 X;  5LYL A;  2AFU A;  1PCA A;  3EWR A;  2GLF A;  4GM5 A;  1XBU A;  1Y0Y A;  2POK A;  3TC8 A;  2F7V A;  2ZEE A;  4DYO A;  4ZY2 A;  2PJ7 A;  2EK8 A;  1TXZ A;  3EWQ A;  2PJB A;  3IC1 A;  3SI1 A;  2F8H A;  3CT9 A;  4NGR A;  3IJ3 A;  3EW5 A;  5LRG A;  3CPA A;  2PJ9 A;  4P4E A;  1FT7 A;  5DUS A;  5I4M A;  4MHN A;  3IFE A;  3PB8 X;  4JVV A;  3KI9 A;  4TWE A;  3HLP A;  5K8P A;  3WC6 A;  3VH9 A;  3FEE A;  3S9N A;  2ZEO A;  3EWO A;  2V8V A;  4ETJ A;  2V8H A;  1OBR A; 
#chains in the Genus database with same CATH topology
 4MHZ A;  2VEZ A;  5FSV A;  1BAV A;  1VHO A;  2D4P A;  3PB6 X;  3H4Q A;  4A33 A;  1Q2Y A;  7CPA A;  4X2T A;  3TOB A;  4EME A;  4GVW A;  2OZH A;  2Z3N A;  3GIU A;  4CAF A;  2I79 A;  5JM6 A;  4BMH A;  1XE4 A;  4CYO A;  2WZN A;  3D66 A;  2R8V A;  3GPG A;  4KOT A;  3LWU A;  1Y9K A;  2A4N A;  1IY7 A;  4UML A;  2AFS A;  1JQG A;  2CIJ A;  1LCP A;  2PIY A;  2GAN A;  4CGN A;  2ZW7 A;  4C68 A;  5F09 A;  3D67 A;  3CXP A;  4OP4 A;  4HNW B;  5AG5 A;  5LYD A;  4ETK A;  2PJ6 A;  3FYN A;  3SJE A;  1K4J A;  2HB6 A;  1IYL A;  2ZOF A;  3D4U A;  4WWV A;  4A95 A;  4B12 A;  3S9M A;  1VHE A;  3RAM A;  1CPS A;  2K5T A;  4R3L A;  1P4N A;  2EUI A;  4C2Z A;  1SPV A;  3FF3 A;  4J5R A;  4IUS A;  4XPD C;  4AXV A;  1NSL A;  5HXD A;  4FD4 A;  3VWD A;  3GUX A;  1Z8L A;  3IEH A;  4ZY0 A;  1Z9U A;  3BI0 A;  4UCP A;  4UEE A;  4A2Z A;  1HDQ A;  3JZT A;  2JDD A;  1XF8 A;  2EBJ A;  1CG2 A;  1TKF A;  2IL4 A;  3PB9 X;  1YVK A;  4J4Z A;  3H8G A;  2GE3 A;  3OWC A;  4MY3 A;  3S6K A;  4A94 A;  4M3S A;  4PSX A;  4ZY1 A;  4EFD A;  2J8R A;  3SII A;  3IU1 A;  2QEC A;  1RXT A;  2DF5 A;  4CAX A;  5DWN A;  1ZR3 A;  4FD7 A;  5F46 A;  3K9U A;  2ZW5 A;  1ZG7 A;  3TE4 A;  3VAR A;  1CPX A;  4A31 A;  2GU2 A;  2XEI A;  1Q2C A;  2WCT A;  2FXK A;  1ELL P;  2VZY A;  4TNU A;  1Z8T A;  2C6G A;  2Q7S A;  3BHX A;  3D7H A;  2OZG A;  4PXB A;  1XEB A;  4Z65 A;  5THW A;  4ZBG A;  1FY7 A;  2HC9 A;  2B5G A;  4A37 A;  1B6B A;  3I9S A;  4GUA A;  4F9V A;  2AFC A;  3LOD A;  4UEZ A;  4F0Y A;  3CXQ A;  3NH5 A;  1U6M A;  1Y7E A;  1YME A;  1Y9W A;  3SJF A;  4TU0 A;  1KWM A;  4R7M A;  2XEJ A;  4RS2 A;  1R3N A;  2FXF A;  4W9Y A;  2PQ8 A;  2C6C A;  3IWE A;  4CS0 B;  5HVH A;  3W6X A;  3B3C A;  4XNH C;  1R43 A;  1LAM A;  1NJR A;  3PZJ A;  3GPQ A;  1Y7R A;  4P45 A;  3RBU A;  2EK9 A;  3IWW A;  1GHE A;  3KAS A;  2EEE A;  3MN8 A;  4K3N A;  3GPO A;  5JH9 A;  5AIL A;  2PJ5 A;  4ZI6 A;  2WSA A;  2YNE A;  4P4I A;  2VXK A;  2DX6 A;  4KLW A;  4Q7A A;  4NEX A;  4IAV A;  4C7H A;  5DS0 A;  1YK3 A;  2ARH A;  3FBU A;  2ZOG A;  2R98 A;  2DPT A;  2O53 A;  4WJB A;  4P6Y A;  1ZG9 A;  3B3T A;  3I1U A;  2FAV A;  3F8K A;  2VI7 A;  1UFH A;  3B2Y A;  3NFZ A;  4R87 A;  4MCR A;  2WUU A;  4DJL A;  4FD5 A;  1WWZ A;  4B10 A;  1LOK A;  1P0H A;  2ANP A;  3P2F A;  4OC4 A;  5HOL A;  1M4L A;  1S3Z A;  3PRT A;  3R1K A;  4CPA A;  5IB0 A;  3BLN A;  2ZEG A;  2G3T A;  4OID A;  2B4B A;  3QAY A;  2AJ6 A;  4JD6 A;  1LAN A;  4FAI A;  1AMP A;  4FD6 A;  4LQ6 A;  2AFM A;  2ZEF A;  5CBM A;  2ZW4 A;  1LFW A;  1YSJ A;  1LRZ A;  1DE4 C;  2PRB A;  3F5B A;  4NGN A;  4P4D A;  1CM0 A;  1PYT B;  4IK2 A;  4KSA A;  4FBE A;  5J1Q A;  2P6G A;  4KS9 A;  4KVO E;  4C7I A;  2OB0 A;  2Q4V A;  4I49 A;  2D4O A;  5EMI A;  5DWM A;  4BD9 A;  4BIN A;  4FUU A;  3KZW A;  4QC6 A;  2EVN A;  1M4G A;  4OLL A;  4C2X A;  1X10 A;  2CF4 A;  1TF9 A;  4P10 A;  5EBV A;  4CGO A;  4HPS A;  2NSM A;  4H6U A;  3W6S A;  1RTQ A;  4EWT A;  1MJB A;  2ATR A;  2G0B A;  2PJC A;  4UCM A;  2PJA A;  3NE7 A;  4Q36 A;  3FVL A;  1MK4 A;  3TTH A;  1GYT A;  1XMT A;  2J8M A;  2PSW A;  3IU2 A;  3TFY A;  3DDD A;  2WPX A;  3ZZI A;  2C27 A;  5C82 A;  2OOT A;  2BFR A;  4XPD B;  1M44 A;  3IGR A;  4PK2 A;  3FNC A;  4NGS A;  4B6Z A;  1JWQ A;  4OC2 A;  3N5F A;  4JJX A;  2RB7 A;  4M6H A;  4P44 A;  4P4F A;  5G20 A;  4CGM A;  5AG7 A;  2ZED A;  3BJ7 A;  1VHU A;  4QVT A;  3S6H A;  1KUY A;  1OZP A;  2DXQ A;  4MI4 A;  4OC3 A;  4CYP A;  1HJZ A;  1YX0 A;  3LAC A;  3KQX A;  2VRI A;  4PXC A;  3ZJ0 A;  2G3A A;  3R95 A;  4KZT A;  4NGM A;  3R9F A;  3EO4 A;  4ZGY B;  2Z11 A;  2ODF A;  3VWE A;  4KUA A;  2L8R A;  2PE3 A;  2REE A;  3L2N A;  4CYQ A;  3N7Z A;  4MXU A;  4R8F A;  5JQ4 A;  4XPL A;  1YW6 A;  1XIX A;  3V8I A;  4UEF A;  3RYO A;  2QYV A;  3KGQ A;  5HVF A;  4PQA A;  3WC7 A;  2BL1 A;  5D29 A;  3SJX A;  1CX8 A;  2ZEP A;  3FH4 A;  3B3W A;  3SXO A;  3PBB A;  4UFW A;  2B58 A;  3GB0 A;  3GYA A;  1KZF A;  1XJO A;  4P4B A;  2I00 A;  4Y49 C;  3IO1 A;  3V38 A;  3FB3 A;  5K8M A;  4L8A A;  4R57 A;  4J3G A;  4MFP A;  4UIA A;  2OZU A;  3RO0 A;  5D8N A;  4AVA A;  2JZF A;  2XEG A;  4J5S A;  4UCN A;  3EC4 A;  1BLL E;  1XRY A;  5A28 A;  1IYK A;  1I21 A;  1VKC A;  5LYF A;  2B3U A;  2NMT A;  5KTA A;  2RFH A;  2BFQ A;  4D86 A;  4DNC A;  2YNC A;  4MBU A;  5CPA A;  2B4D B;  5E96 A;  1VGY A;  2ZEN A;  3EXN A;  3GQO A;  3NH8 A;  4F6A A;  4ABL A;  2FIW A;  4MY0 A;  1F2O A;  5I0C A;  2CXA A;  4JZ0 A;  2WPW A;  4MFQ A;  4O23 A;  4A30 A;  1IU8 A;  2X7B A;  5AG4 A;  1CP7 A;  3EJG A;  3V45 A;  4YWY A;  2QVP A;  3Q71 A;  4OAD A;  3KR5 A;  3TT2 A;  2VQY A;  2Z3P A;  2Q4Z A;  2CTC A;  3SJG A;  4YU9 A;  4QBJ A;  2FL4 A;  4PV6 A;  4KOR A;  4OIW A;  3CXS A;  2QJ8 A;  4MFZ A;  2Z10 A;  5J8C A;  1KUX A;  2BEI A;  4P4E A;  4KOY A;  2WYR A;  2R7H A;  6CPA A;  4CRZ B;  4H2K A;  5CB3 A;  3EKE A;  1TXR A;  4MMO A;  3D68 A;  4KYB A;  3E0K A;  4MFJ A;  2DPS A;  3NE8 A;  1VHS A;  1BOB A;  2PR8 A;  4RN7 A;  4UF4 A;  4NCZ A;  5GCN A;  3CDX A;  2CNT A;  4JXR A;  1BPN A;  4A38 A;  2FG1 A;  2ZXV A;  2YNC C;  1CBX A;  5F47 A;  4MRI A;  3TOA A;  3S6G A;  3KHZ A;  5G1Z A;  4U9Y A;  1Q2D A;  1EE3 P;  3D7F A;  3EJF A;  4ABK A;  2YND A;  4GXH A;  1J4J A;  2GFQ A;  4BBH A;  3NH4 A;  2O28 A;  4H89 A;  4HNY B;  4R3K A;  5EC4 A;  1XFO A;  2Z0Z A;  1S7F A;  4MCP A;  5FSY A;  3TO6 A;  4RUH A;  4UIB A;  4CAW A;  2Q4Y A;  4DUK A;  3EFA A;  1A2Z A;  2C6P A;  2OU2 A;  4JCA A;  4YFJ A;  1Q7L A;  4R6T A;  4ONU A;  3VAT A;  4II9 A;  1VIX A;  3BI1 A;  2Q44 A;  3PGP A;  5A27 A;  3S9L A;  2JLM A;  2C1C A;  4F8Z A;  1MJA A;  5H86 A;  1IIC A;  3B7I A;  4PSW A;  5E3B A;  3H8F A;  1ELM P;  1M1D A;  1ZR5 A;  3WT4 A;  4JYW A;  3D3S A;  1IOI A;  1H8L A;  4UFV A;  3PFO A;  4MHY A;  4NFR A;  4PPZ A;  4PXD A;  3DNS A;  3DLJ A;  3IIF A;  4AG7 A;  3D2P A;  2VL1 A;  3JVN A;  4HKF A;  4LQG A;  4CGL A;  1DTD A;  1NMT A;  2IQ6 A;  3GKR A;  3ISZ A;  4U9Z A;  3WR7 A;  2P6F A;  3DR8 A;  2FT0 A;  4E2A A;  2ABZ A;  2JBJ A;  3FEC A;  1I1D A;  5HMN A;  4ESS A;  1B87 A;  2PCU A;  4MJ8 A;  3SHP A;  1X12 A;  4P4J A;  2QML A;  4JLY A;  4OME A;  3GY9 A;  3MGD A;  4KOS A;  3ISX A;  1TIQ A;  3SIH A;  1Y0R A;  4KOV A;  2LGR A;  2P6E A;  3K2K A;  3PFE A;  3DSB A;  1M4D A;  4J5Q A;  3FXT A;  4G1P A;  1CP6 A;  3PEI A;  1YQE A;  1M4I A;  1ZLI A;  3JUW A;  5G22 A;  3KKW A;  1YRE A;  4A32 A;  3ETI A;  4B5P B;  4X5K A;  5K8N A;  4AB7 A;  1IB1 E;  4ZYQ A;  2W2G A;  2ZEM A;  3F0A A;  2FCK A;  2IMO A;  3SIG A;  3B8G A;  3SI0 A;  1IID A;  4Y49 B;  3B35 A;  2Q43 A;  3JRU A;  1NE9 A;  2XEF A;  3NA6 A;  4A39 A;  4X8I A;  4B5O A;  3PB7 X;  4UBR A;  2YGW A;  2CTB A;  3D8P A;  5LRK A;  5HIH A;  5FSZ A;  2GRE A;  3IID A;  2BO9 A;  1KUV A;  3DR6 A;  1ZLH A;  2Z3K A;  1ARM A;  4FWU A;  4F0X A;  2IJZ A;  1MJ9 A;  4LX9 A;  3BXM A;  4B11 A;  3V7Z A;  3IIB A;  1S7K A;  3WC5 A;  1HEE A;  4R9M A;  2AE6 A;  4B13 A;  2FVG A;  2QIR A;  1QQ9 A;  4MCQ A;  4OC0 A;  5G21 A;  3EY5 A;  3FX6 A;  5F48 A;  3KR4 A;  1ON0 A;  1CJW A;  1WK4 A;  3FMC A;  1ZG8 A;  4CYN A;  3TO9 A;  3EWP A;  3I3G A;  3TX8 A;  2JEW A;  3KHX A;  3SIJ A;  1AUG A;  2FS5 A;  2ZEH A;  3HUV A;  4MFK A;  5K8O A;  3QNV A;  4K30 A;  1HDU A;  2VZZ A;  2PIZ A;  2B3V A;  3KL9 A;  3LMS A;  2O4H A;  4AVB A;  5BWA B;  2AFO A;  5IB9 A;  4AVC A;  4CRY B;  2RC4 A;  1ARL A;  1TKH A;  2Z3L A;  1QSR A;  2BSW A;  3H5Z A;  3D7D A;  3T90 A;  2Q51 A;  3PBE A;  3K9T A;  1TKJ A;  1LAP A;  2CNS A;  2DEA A;  4LUA A;  4NJR A;  4C2Y A;  1N71 A;  5CMS A;  3D7G A;  4YRH A;  2CY2 A;  4XNH B;  4U5Y A;  1QSO A;  2JBK A;  4NGQ A;  2CNM A;  2AFX A;  3FRM A;  1PU9 A;  2PJ2 A;  2JEV A;  2BUE A;  4OC5 A;  3VFQ A;  5JGF A;  2NYQ A;  3C26 A;  2PVV A;  1F57 A;  1YLE A;  3PP9 A;  2R1I A;  4HNX B;  3P2H A;  1NSA A;  4KVM E;  1I12 A;  1R57 A;  3DGV A;  1Z8W A;  5KTC A;  1RO5 A;  5ISV A;  4M6G A;  3R9E A;  3FED A;  3SXN A;  4IHM A;  3T8W A;  2B5G B;  4KOU A;  2KCW A;  4RI1 A;  1QSN A;  3A9L A;  3CPX A;  4M6I A;  2VBQ A;  4ZX8 A;  4OAE A;  3R96 A;  3Q6Z A;  1XMB A;  3BJ8 A;  2B4D A;  5HH1 A;  3B3V A;  3CZX A;  3RZA A;  5FSU A;  1Z5R A;  3V2B A;  3B3S A;  2OR4 A;  4NJQ A;  5C88 A;  2X47 A;  1YLO A;  2GLJ A;  2J8N A;  1S7L A;  4CAV A;  2PRQ A;  1IGB A;  4ONW A;  2EWB A;  4MHP A;  1AYE A;  4UWI A;  5H84 A;  3GQE A;  2RNK A;  1UWY A;  1YVO A;  2V77 A;  3MRU A;  2PC1 A;  4KLV A;  4CGP A;  2ZW6 A;  1SQH A;  3RNZ A;  4H6Z A;  2I3C A;  5F49 A;  3TCV A;  3G3S A;  4MHD A;  1Z4E A;  3TO7 A;  1PUA A;  2AFZ A;  4F9U A;  2Q7B A;  1QST A;  4JLL A;  1Z2L A;  5IX3 A;  1TY8 A;  3KQZ A;  4B14 A;  4KOW A;  1F2P A;  2PJ4 A;  2PJ1 A;  2V8D A;  2XD7 A;  1TF8 A;  1FNO A;  4NSQ A;  2AFW A;  5FSX A;  4OC1 A;  5JPH A;  2JZD A;  1YD9 A;  4QB9 A;  1QMU A;  2PJ0 A;  4NF1 A;  5LYI A;  4ZX9 A;  1S60 A;  2PJ8 A;  1QSM A;  4GVV A;  2BCO A;  4QUS A;  1YGH A;  2Z3M A;  4K0C A;  4UFX A;  5CB5 A;  4GS4 A;  3SI2 A;  2FSR A;  4R76 A;  4NGP A;  4PXE A;  2HV2 A;  2GIV A;  5AGE A;  2J9A A;  4XPK A;  3WAB A;  3QB8 A;  2G9D A;  8CPA A;  2V8G A;  1YW4 A;  4MCS A;  2F5I A;  3GLJ A;  4X3R A;  5ELY A;  4E8O A;  5KTD A;  4E0A A;  1BO4 A;  4JGK A;  5J8F A;  1XOV A;  2JDC A;  2KQV A;  2PDO A;  4KUB A;  4YGO A;  3S6F A;  1V0C A;  2ACF A;  4KSI A;  3FJU A;  5LRJ A;  3IWG A;  2PVW A;  1BPM A;  4IQY A;  1S7N A;  5HVG A;  1Z4R A;  1IOF A;  1S5K A;  2ZEL A;  3H8E A;  2Q0Y A;  4KOX A;  4OKO A;  2HUZ A;  1ZO0 A;  4Q38 A;  2BOA A;  2PJ3 A;  2FIA A;  4NGT A;  3W91 A;  4CAE A;  3PB4 X;  5LYL A;  2AFU A;  1PCA A;  2Z3O A;  2ZPA A;  3EWR A;  2GLF A;  2REF A;  4JWP A;  4GM5 A;  1XBU A;  1Y0Y A;  2EO8 A;  2POK A;  3TC8 A;  2F7V A;  1Z8X A;  1L0C A;  2ZEE A;  4UWJ A;  4ZY2 A;  4KSF A;  4MFL A;  2JZE A;  3R9G A;  2PJ7 A;  2OH1 A;  5CNP A;  4DYO A;  2EK8 A;  1TXZ A;  3EWQ A;  2PJB A;  3IC1 A;  3SI1 A;  5IV0 A;  2PR1 A;  4L89 A;  3G8W A;  2F8H A;  2FE7 A;  3CT9 A;  4NGR A;  4UA3 A;  1YR0 A;  3IJ3 A;  3EW5 A;  4IF5 A;  5LRG A;  4EVY A;  2P0W A;  3D2M A;  3CPA A;  2PJ9 A;  3QAH A;  4NXY A;  4ORF A;  1FT7 A;  5DUS A;  2H5M A;  4MHN A;  3IFE A;  3PB8 X;  4M85 A;  4JVV A;  4PK3 A;  3KI9 A;  3UY5 A;  5I4M A;  4TWE A;  3HLP A;  5AG6 A;  5FVJ A;  2HQY A;  4JXQ A;  3JTK A;  5K8P A;  3WC6 A;  4B5P A;  3VH9 A;  2Y0M A;  3T9Y A;  3FEE A;  4AG9 A;  3S9N A;  3EWO A;  2ZEO A;  2V8V A;  2Q04 A;  4ETJ A;  3LD2 A;  4KVX A;  3FIX A;  2V8H A;  1OBR A; 
#chains in the Genus database with same CATH homology
 4MHZ A;  5FSV A;  1BAV A;  1VHO A;  3PB6 X;  7CPA A;  4X2T A;  4EME A;  4GVW A;  5JM6 A;  2WZN A;  3D66 A;  3GPG A;  3LWU A;  1IY7 A;  4UML A;  2AFS A;  1JQG A;  2CIJ A;  1LCP A;  2PIY A;  5F09 A;  3D67 A;  4OP4 A;  5LYD A;  4ETK A;  2PJ6 A;  3SJE A;  2HB6 A;  3D4U A;  2ZOF A;  4WWV A;  3S9M A;  1VHE A;  3RAM A;  1CPS A;  1SPV A;  3FF3 A;  4J5R A;  5HXD A;  4AXV A;  3GUX A;  1Z8L A;  3IEH A;  4ZY0 A;  3BI0 A;  4UEE A;  1HDQ A;  3JZT A;  1CG2 A;  1TKF A;  3PB9 X;  4J4Z A;  3H8G A;  4A94 A;  4ZY1 A;  4EFD A;  3SII A;  1ZR3 A;  1ZG7 A;  3VAR A;  1CPX A;  2GU2 A;  2XEI A;  2FXK A;  1ELL P;  4TNU A;  4Z65 A;  3BHX A;  2C6G A;  3D7H A;  4PXB A;  5THW A;  2HC9 A;  4A37 A;  4GUA A;  4F9V A;  2AFC A;  4UEZ A;  3NH5 A;  1Y7E A;  1YME A;  3SJF A;  4TU0 A;  1KWM A;  4R7M A;  2XEJ A;  1R3N A;  4W9Y A;  2C6C A;  5HVH A;  3B3C A;  1R43 A;  1LAM A;  1NJR A;  3RBU A;  3GPQ A;  4P45 A;  2EK9 A;  3IWW A;  3KAS A;  2EEE A;  3MN8 A;  4K3N A;  3GPO A;  5JH9 A;  5AIL A;  2PJ5 A;  4ZI6 A;  4P4I A;  2DX6 A;  4Q7A A;  4IAV A;  5DS0 A;  5ELY A;  2ZOG A;  2O53 A;  4WJB A;  4P6Y A;  1ZG9 A;  3B3T A;  3I1U A;  2FAV A;  3B2Y A;  3NFZ A;  4MCR A;  4DJL A;  1LOK A;  2ANP A;  4OC4 A;  5HOL A;  1M4L A;  3PRT A;  4CPA A;  2ZEG A;  4OID A;  4FAI A;  1LAN A;  1AMP A;  2AFM A;  2ZEF A;  5CBM A;  1LFW A;  1YSJ A;  1DE4 C;  4P4D A;  4NGN A;  1PYT B;  4IK2 A;  4FBE A;  5J1Q A;  4BD9 A;  4FUU A;  3KZW A;  2CF4 A;  1TF9 A;  4P10 A;  2NSM A;  1RTQ A;  4EWT A;  2PJC A;  2PJA A;  3FVL A;  1GYT A;  2OOT A;  2BFR A;  4NGS A;  4B6Z A;  4OC2 A;  3N5F A;  4P44 A;  2RB7 A;  4P4F A;  2ZED A;  1VHU A;  4OC3 A;  1HJZ A;  4PXC A;  3KQX A;  2VRI A;  4NGM A;  2L8R A;  2PE3 A;  3L2N A;  4MXU A;  4R8F A;  1YW6 A;  4UEF A;  2QYV A;  3KGQ A;  5HVF A;  4PQA A;  3WC7 A;  5D29 A;  3SJX A;  1CX8 A;  2ZEP A;  3FH4 A;  3B3W A;  3PBB A;  3GB0 A;  1XJO A;  4P4B A;  5K8M A;  3V38 A;  3IO1 A;  4UIA A;  5D8N A;  2XEG A;  4J5S A;  1BLL E;  1XRY A;  5LYF A;  2RFH A;  2BFQ A;  4D86 A;  5CPA A;  1VGY A;  2ZEN A;  3NH8 A;  3GQO A;  4ABL A;  1F2O A;  4JZ0 A;  4O23 A;  1CP7 A;  3EJG A;  3V45 A;  4YWY A;  2QVP A;  3Q71 A;  3KR5 A;  2Q4Z A;  2CTC A;  3SJG A;  4YU9 A;  4OIW A;  2QJ8 A;  2WYR A;  6CPA A;  4H2K A;  5CB3 A;  3EKE A;  1TXR A;  4MMO A;  3D68 A;  4KYB A;  4UF4 A;  3CDX A;  1BPN A;  4A38 A;  2FG1 A;  1CBX A;  4MRI A;  3KHZ A;  1EE3 P;  3D7F A;  3EJF A;  4ABK A;  3NH4 A;  1XFO A;  4MCP A;  5FSY A;  4RUH A;  4UIB A;  4DUK A;  2C6P A;  4JCA A;  1Q7L A;  4R6T A;  3VAT A;  1VIX A;  3BI1 A;  3S9L A;  2C1C A;  4F8Z A;  3B7I A;  5E3B A;  3H8F A;  1ELM P;  1ZR5 A;  3WT4 A;  4JYW A;  1H8L A;  3PFO A;  4MHY A;  4NFR A;  4PPZ A;  4PXD A;  3DLJ A;  3IIF A;  2VL1 A;  4LQG A;  1DTD A;  2IQ6 A;  3ISZ A;  2ABZ A;  2JBJ A;  3FEC A;  4ESS A;  2PCU A;  4P4J A;  4OME A;  3ISX A;  3SIH A;  1Y0R A;  2LGR A;  3K2K A;  3PFE A;  4J5Q A;  4G1P A;  1CP6 A;  3PEI A;  1ZLI A;  3ETI A;  5K8N A;  4ZYQ A;  2ZEM A;  2IMO A;  3SIG A;  3SI0 A;  3B35 A;  2Q43 A;  3JRU A;  2XEF A;  3NA6 A;  4A39 A;  4X8I A;  3PB7 X;  2CTB A;  5LRK A;  5HIH A;  5FSZ A;  2GRE A;  3IID A;  2BO9 A;  1ZLH A;  4FWU A;  1ARM A;  2IJZ A;  3BXM A;  3V7Z A;  3IIB A;  3WC5 A;  1HEE A;  2FVG A;  4MCQ A;  1QQ9 A;  4OC0 A;  3FX6 A;  3KR4 A;  3FMC A;  1ZG8 A;  3EWP A;  3TX8 A;  2JEW A;  3KHX A;  3SIJ A;  3HUV A;  2ZEH A;  5K8O A;  3QNV A;  1HDU A;  2PIZ A;  3KL9 A;  3LMS A;  2O4H A;  2AFO A;  5IB9 A;  1ARL A;  1TKH A;  3D7D A;  2Q51 A;  3PBE A;  3K9T A;  1TKJ A;  1LAP A;  2DEA A;  4NJR A;  5CMS A;  3D7G A;  2JBK A;  4NGQ A;  2AFX A;  2PJ2 A;  4OC5 A;  3VFQ A;  5JGF A;  2NYQ A;  2PVV A;  1F57 A;  1NSA A;  3DGV A;  3FED A;  4IHM A;  3T8W A;  3CPX A;  4ZX8 A;  3Q6Z A;  1XMB A;  3B3V A;  3RZA A;  5FSU A;  1Z5R A;  3V2B A;  3B3S A;  2OR4 A;  4NJQ A;  2X47 A;  1YLO A;  2GLJ A;  2PRQ A;  1IGB A;  4ONW A;  2EWB A;  4MHP A;  1AYE A;  3GQE A;  1UWY A;  2V77 A;  3MRU A;  2I3C A;  2AFZ A;  4F9U A;  4JLL A;  1Z2L A;  1TY8 A;  3KQZ A;  1F2P A;  2PJ4 A;  2PJ1 A;  2V8D A;  2XD7 A;  1TF8 A;  1FNO A;  2AFW A;  5FSX A;  4OC1 A;  1YD9 A;  1QMU A;  2PJ0 A;  5LYI A;  4ZX9 A;  2PJ8 A;  4GVV A;  2BCO A;  4K0C A;  5CB5 A;  3SI2 A;  4R76 A;  4NGP A;  4PXE A;  2J9A A;  3WAB A;  2G9D A;  8CPA A;  2V8G A;  1YW4 A;  4MCS A;  3GLJ A;  4X3R A;  4JGK A;  2ACF A;  4KSI A;  3FJU A;  5LRJ A;  2PVW A;  1BPM A;  4IQY A;  5HVG A;  2ZEL A;  4OKO A;  3H8E A;  2BOA A;  2PJ3 A;  4NGT A;  3PB4 X;  5LYL A;  2AFU A;  1PCA A;  3EWR A;  2GLF A;  4GM5 A;  1XBU A;  1Y0Y A;  2POK A;  3TC8 A;  2F7V A;  2ZEE A;  4DYO A;  4ZY2 A;  2PJ7 A;  2EK8 A;  1TXZ A;  3EWQ A;  2PJB A;  3IC1 A;  3SI1 A;  2F8H A;  3CT9 A;  4NGR A;  3IJ3 A;  3EW5 A;  5LRG A;  3CPA A;  2PJ9 A;  4P4E A;  1FT7 A;  5DUS A;  5I4M A;  4MHN A;  3IFE A;  3PB8 X;  4JVV A;  3KI9 A;  4TWE A;  3HLP A;  5K8P A;  3WC6 A;  3VH9 A;  3FEE A;  3S9N A;  2ZEO A;  3EWO A;  2V8V A;  4ETJ A;  2V8H A;  1OBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...