1LANA

Leucine aminopeptidase complex with l-leucinal
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase (alpha-aminoacylpeptide)
molecule keywords LEUCINE AMINOPEPTIDASE
publication title Two-metal ion mechanism of bovine lens leucine aminopeptidase: active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.
pubmed doi rcsb
total genus 170
structure length 484
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lanA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lanA02
4P4BA 3KI9A 4W9YA 3IIDA 3FMCA 2POKA 4MHPA 2JBKA 5FSVA 1TXZA 4LQGA 4IQYA 4UIAA 2EK8A 3SI1A 3FX6A 3FVLA 4ZX8A 3KGQA 4MCQA 4GUAA 3BXMA 3KHXA 3WC5A 4A38A 4NGMA 2I3CA 4F9UA 4JVVA 4ABKA 1TKFA 3VATA 3KL9A 1VGYA 4ZI6A 2O4HA 3B3WA 4MHNA 4PXBA 5K8NA 3IC1A 3IO1A 2IJZA 1YW6A 2QVPA 3S9LA 3PB7X 1YLOA 1JQGA 1YD9A 1PYTB 4J5SA 1LCPA 1TF8A 3BI0A 2PJ0A 3TX8A 1GYTA 4ETKA 4TWEA 3CPXA 1BAVA 4JZ0A 3NH5A 1ZG7A 4A39A 3V45A 4MHYA 3VARA 5JM6A 3PFEA 1HDQA 2X47A 1F2OA 4Z65A 2XD7A 1XMBA 3WT4A 3GQEA 2QJ8A 5DS0A 2ACFA 3L2NA 2GREA 2ZENA 3V38A 1BLLE 4P6YA 4ZY2A 4UEZA 3GLJA 4R76A 1NSAA 5LYLA 3FEEA 6CPAA 4TU0A 4OC0A 4O23A 1Z5RA 4ZYQA 3PEIA 3NH4A 1DE4C 1QMUA 2PJAA 5K8MA 2PJ2A 1ZLIA 2CIJA 5FSUA 1XJOA 3KQXA 4X3RA 1ELLP 1VHUA 2AFOA 3WABA 1CG2A 3EWPA 2PIYA 3CDXA 4OC5A 4BD9A 1ZLHA 1LANA 5THWA 5AILA 3KR5A 5DUSA 2PJCA 2AFUA 3BHXA 4K3NA 1TKJA 4DYOA 3SIHA 1Y0YA 4NGTA 4AXVA 3FF3A 4FBEA 3D7HA 4PXDA 1ARMA 4NGSA 2FG1A 2GLFA 3V7ZA 4J4ZA 3FH4A 4NGQA 1ZR5A 2CTCA 2JEWA 5CBMA 3SJFA 2BOAA 4R7MA 3KASA 2XEFA 3B3CA 3S9MA 3WC7A 3RAMA 4R8FA 4P4IA 3PB9X 4FWUA 4WJBA 3SJEA 4EMEA 3GPOA 5CB3A 2ABZA 2Q51A 2ZELA 4DJLA 2C6GA 1XRYA 2BCOA 1ZG8A 1VHEA 4JGKA 1IY7A 3RBUA 3ISXA 4JLLA 3WC6A 1YSJA 4FAIA 5LRGA 1LOKA 2DX6A 5HXDA 4X2TA 8CPAA 5CB5A 2PJBA 2OOTA 2PVWA 4OC1A 2ANPA 3JZTA 2F8HA 1CBXA 4OMEA 5IB9A 2XEIA 4GVVA 4UIBA 3NA6A 2JBJA 1OBRA 3LWUA 5HIHA 3VFQA 2L8RA 2AFCA 2ZOFA 3EW5A 2PJ3A 3B7IA 3Q6ZA 5JH9A 2V8VA 3MN8A 3EJGA 4ZX9A 3BI1A 2V77A 2V8HA 2ZOGA 3ISZA 4UEFA 2OR4A 1ARLA 2G9DA 2F7VA 4OKOA 5HVFA 4UF4A 4J5QA 2DEAA 4NGRA 2ZEEA 2RFHA 4NGPA 2NSMA 4P4FA 2ZEDA 3IWWA 4CPAA 1YMEA 3H8EA 2FXKA 1VIXA 2PJ7A 1CP6A 1H8LA 4NGNA 4P45A 4F9VA 3SJXA 4EFDA 3SI2A 1R3NA 3HLPA 3ETIA 1BPNA 4GVWA 2IMOA 5LRKA 4MXUA 2LGRA 3D67A 4H2KA 4OC3A 2HB6A 3PB6X 4NFRA 1HDUA 5FSXA 3RZAA 1CX8A 1F57A 2GU2A 2C1CA 4D86A 1HEEA 3PBBA 3B35A 3FECA 3I1UA 4B6ZA 1RTQA 1HJZA 1YW4A 2EK9A 2PJ4A 5D29A 3K2KA 4P4DA 2VRIA 4NJQA 1M4LA 3SI0A 4MMOA 1QQ9A 4NJRA 2EEEA 2CF4A 4IK2A 2ZEGA 4MRIA 5D8NA 3EWQA 4ZY1A 2FVGA 2ZEOA 5K8PA 2FAVA 5E3BA 3VH9A 2CTBA 3D7DA 2V8DA 4WWVA 2J9AA 3B2YA 3B3SA 2XEJA 3SIIA 4KYBA 2PJ9A 3GUXA 2BFQA 3JRUA 5ELYA 4PPZA 4P44A 1Y0RA 3KZWA 4P4EA 1Z8LA 4F8ZA 4UMLA 4MCSA 1Q7LA 3TC8A 2XEGA 1Y7EA 5JGFA 1FT7A 1ZR3A 3H8GA 3EJFA 1XFOA 2BO9A 2IQ6A 4PXEA 2AFZA 2ZEFA 3IEHA 2PJ6A 4FUUA 1ELMP 3H8FA 1NJRA 4PQAA 1SPVA 1ZG9A 5LRJA 2PJ5A 3T8WA 1TXRA 1AMPA 2QYVA 5HVGA 5I4MA 4PXCA 3IFEA 2GLJA 4A37A 1KWMA 3EKEA 4KSIA 4OP4A 1TKHA 2PVVA 3GQOA 1TF9A 2AFSA 2Q4ZA 2ZEHA 3K9TA 4EWTA 4P10A 5CMSA 3V2BA 1DTDA 4G1PA 2WYRA 3EWRA 1UWYA 4OIWA 1XBUA 5LYIA 3NFZA 4ZY0A 2C6CA 1BPMA 1LAMA 2PIZA 1AYEA 4X8IA 2PCUA 2PRQA 2BFRA 1CP7A 2V8GA 3EWOA 2ZEMA 3PB8X 5HVHA 2ZEPA 3SIGA 2WZNA 4JYWA 3KHZA 3NH8A 2VL1A 3D7GA 4OC4A 2AFXA 3S9NA 4K0CA 3D68A 3D7FA 4P4JA 4YWYA 3SJGA 4MCPA 4J5RA 1R43A 2HC9A 3QNVA 4MCRA 4ONWA 2RB7A 3PFOA 3PRTA 3IIBA 3Q71A 1LFWA 3D66A 1TY8A 4YU9A 1EE3P 4R6TA 3D4UA 5LYFA 3IIFA 3B3TA 4OC2A 3KR4A 2PJ1A 7CPAA 1IGBA 1VHOA 3IJ3A 5CPAA 2C6PA 1FNOA 3MRUA 4IAVA 2AFMA 5K8OA 3GPQA 4ABLA 2PJ8A 3FJUA 2PE3A 4ESSA 5FSYA 3PBEA 3SIJA 1CPXA 2NYQA 3HUVA 3GPGA 3DLJA 3N5FA 3B3VA 1CPSA 3KQZA 2O53A 4Q7AA 4RUHA 3CPAA 3GB0A 5F09A 3PB4X 4GM5A 2Q43A 4MHZA 5HOLA 2EWBA 5LYDA 3FEDA 3LMSA 4OIDA 3CT9A 2AFWA 1LAPA 1Z2LA 5FSZA 4DUKA 4TNUA 4JCAA 4ETJA 5J1QA 4UEEA 1PCAA 1F2PA 4IHMA 4A94A 3DGVA
chains in the Genus database with same CATH superfamily
3CZXA 4P4BA 3TT2A 3KI9A 4W9YA 3PZJA 3IIDA 1XMTA 3FMCA 4KSAA 2POKA 4JXQA 4MHPA 2F5IA 2JBKA 5FSVA 2B5GB 2PC1A 1TXZA 5JPHA 4LQGA 5EMIA 4IQYA 1BOBA 4Y49B 1CM0A 2B4DA 4UIAA 3E0KA 2EK8A 3SI1A 1YX0A 3FNCA 3FX6A 3FVLA 4ZX8A 1Z4EA 3KGQA 4MCQA 4XPDC 4Y49C 4GUAA 1IYLA 4UFVA 3BXMA 3KHXA 4R57A 3WC5A 4A38A 4NGMA 4C7HA 2I3CA 4HPSA 4JVVA 4MY0A 4F9UA 4QUSA 3D8PA 2P6FA 4KOTA 1IU8A 4ABKA 1TKFA 5AG5A 3EC4A 1RO5A 3TO7A 3VATA 3KL9A 4KVOE 1IB1E 1VGYA 4ZI6A 2O4HA 3B3WA 4J3GA 2HUZA 4MHNA 4PXBA 4CGOA 4M85A 5K8NA 2PQ8A 3IC1A 3IO1A 2ZW5A 5EC4A 2IJZA 2CXAA 4U9ZA 1YW6A 2OH1A 2QVPA 4Q36A 4KOUA 5G1ZA 3S9LA 3PB7X 2BL1A 1YLOA 4R3KA 4LQ6A 1RXTA 5F49A 1JQGA 4OAEA 3BLNA 4B5OA 1YD9A 1PUAA 1PYTB 4KOXA 4J5SA 1LCPA 1TF8A 5C88A 2JZDA 2DXQA 2PJ0A 3BI0A 4KLWA 4MFJA 3TX8A 2Q7BA 5IX3A 2Q0YA 1GYTA 4ETKA 4TWEA 4IUSA 3CPXA 4E2AA 5KTDA 1NMTA 1BAVA 4JZ0A 3NH5A 4KOYA 1ZG7A 2FT0A 1B6BA 1MK4A 1K4JA 4A39A 1LRZA 4E0AA 2AE6A 5IV0A 3V45A 2RC4A 4MHYA 3VARA 5JM6A 2KQVA 3PFEA 1HDQA 2FCKA 3F5BA 1R57A 2X47A 4DNCA 1F2OA 4CAEA 4B13A 4UCPA 4Z65A 1MJ9A 2WUUA 2XD7A 1XMBA 1YREA 3WT4A 2K5TA 3GQEA 2ATRA 2QJ8A 5DS0A 1OZPA 3EXNA 2ACFA 3L2NA 2O28A 5G21A 2GREA 1Y7RA 2ZENA 3F0AA 4LUAA 3V38A 1BLLE 4P6YA 1KUVA 4AVCA 2JDCA 2PDOA 4ZY2A 4UEZA 4II9A 3GLJA 4R76A 1NSAA 5LYLA 3FEEA 6CPAA 2I00A 4TU0A 4OC0A 4O23A 1Z5RA 2EO8A 3MGDA 4ZYQA 1I21A 3PEIA 4PK2A 3SXNA 3NH4A 1DE4C 1QMUA 4A95A 2FIWA 2PJAA 2VBQA 2JLMA 5K8MA 2PJ2A 2OU2A 1ZLIA 2CIJA 5FSUA 1AUGA 3I3GA 2QECA 4HNWB 1XJOA 4NSQA 3KQXA 2Q4YA 1KUYA 2OZUA 1ELLP 4X3RA 2R98A 1VHUA 5F47A 2DF5A 2AFOA 3WABA 1CG2A 3EWPA 2EVNA 2PIYA 3CDXA 4I49A 1P4NA 4OC5A 5DWMA 1WWZA 4BD9A 4BINA 1ZLHA 1LANA 2FSRA 2PR8A 4X5KA 3C26A 5THWA 3W91A 1A2ZA 4A31A 2FE7A 3IU2A 5AILA 2NMTA 2P0WA 3KR5A 2A4NA 5DUSA 3UY5A 2Z3LA 1VKCA 3SXOA 2IL4A 2PJCA 1YR0A 2AFUA 3BHXA 4K3NA 1TKJA 4NXYA 4DYOA 2ZW4A 3B8GA 3SIHA 1Y0YA 2Q4VA 4NGTA 4AXVA 2EUIA 1KUXA 3FF3A 4FBEA 4MFPA 3D7HA 4PXDA 1ARMA 1YK3A 2FG1A 2GLFA 4NGSA 3VWEA 3W6SA 3NE8A 3V7ZA 1Q2YA 4J4ZA 3FH4A 4NGQA 1ZR5A 4JJXA 4PSXA 2CTCA 4XNHB 4JD6A 5IB0A 4KUAA 2JEWA 4XPLA 5CBMA 4R9MA 3I9SA 3SJFA 2BOAA 5E96A 4R7MA 2DPTA 3KASA 2XEFA 2P6GA 3H5ZA 4NEXA 4U5YA 2Z3OA 1Y9WA 3B3CA 5K8PA 3S9MA 1XIXA 3WC7A 3RAMA 4R8FA 2FS5A 4P4IA 3PB9X 4FWUA 4WJBA 3SJEA 4EMEA 3GPOA 4JXRA 5CB3A 2ABZA 2Q51A 2ZELA 4KORA 3TOBA 4DJLA 3FB3A 3PP9A 1IIDA 1MJBA 2C6GA 5AG6A 1XRYA 2BCOA 1ZG8A 4PSWA 1VHEA 2Q44A 4QBJA 4JGKA 4B14A 2Z3MA 4CYQA 1IY7A 2VZZA 3R9GA 1S7NA 3RBUA 2B3UA 3ISXA 4C2XA 4KOWA 4JLLA 3WC6A 1YSJA 4FAIA 5LRGA 1LOKA 2DX6A 2R7HA 4KLVA 5G22A 5HXDA 4F0YA 2JZEA 4X2TA 4QB9A 8CPAA 4H6UA 5CB5A 3LACA 4L89A 2PJBA 3TCVA 4M6GA 2OOTA 4NF1A 2FL4A 2PVWA 4UFXA 4KVXA 4FD7A 1M44A 2BUEA 2HV2A 3CXSA 3G3SA 4UCNA 2QMLA 4OC1A 4CGMA 2ANPA 3JZTA 2F8HA 4RS2A 1NE9A 2R8VA 1CBXA 4OMEA 5IB9A 2XEIA 4GVVA 4CGLA 2Q04A 1YLEA 4YRHA 3D2PA 5BWAB 2R1IA 1PU9A 4H6ZA 3NA6A 2JBJA 1OBRA 4UIBA 2ZW7A 3JTKA 3RNZA 3LWUA 1YVKA 3DR6A 5HIHA 3EO4A 3VFQA 2EBJA 3DR8A 1CJWA 2L8RA 2AFCA 3JVNA 2ZOFA 3EW5A 1QSRA 2PJ3A 3Q6ZA 3B7IA 3N7ZA 2V8VA 3MN8A 3ZJ0A 1I12A 5JH9A 2WPXA 2ZPAA 3EJGA 4LX9A 4ZX9A 2G3AA 3BI1A 3D2MA 4HKFA 5AG4A 2V77A 2V8HA 2ZOGA 3ISZA 4UEFA 2OR4A 4B11A 1SQHA 5KTAA 2REFA 1ARLA 2G9DA 2F7VA 4OKOA 1Z8WA 5HVFA 4CAVA 2CNMA 4UCMA 3LD2A 4J5QA 4UF4A 3IWEA 2DEAA 4NGRA 1Z9UA 1IOFA 2Z11A 2ZEEA 4B5PB 3GKRA 2RFHA 4NGPA 2NSMA 4P4FA 1J4JA 2ZEDA 3F8KA 3IWWA 4AB7A 1YMEA 4CPAA 3H8EA 3TTHA 4F6AA 5HMNA 2FXKA 1M4GA 1VIXA 2VQYA 2J8NA 4MI4A 5ISVA 2G3TA 1CP6A 2PJ7A 3R1KA 5F48A 3TE4A 5A28A 1H8LA 4NGNA 4P45A 4F9VA 4E8OA 2OB0A 3SJXA 1M4DA 4JLYA 4EFDA 2GE3A 3SI2A 1M1DA 3BJ8A 4QVTA 1R3NA 4H89A 2W2GA 2B5GA 2Z10A 2B4DB 2GFQA 3HLPA 3ETIA 3EY5A 1QSNA 1BPNA 4GVWA 2IMOA 5LRKA 2FIAA 4MXUA 3R96A 4CAFA 2LGRA 1S5KA 3D67A 3VWDA 4ZGYB 2GIVA 4H2KA 4OC3A 2HB6A 2REEA 3PB6X 4KVME 3QAYA 4NFRA 1HDUA 4C2ZA 5FSXA 4FD6A 3RZAA 1CX8A 4C7IA 1F57A 2G0BA 2GU2A 1Q2CA 4MFKA 2C1CA 4D86A 1HEEA 4CGNA 3PBBA 3B35A 3FECA 3I1UA 1Q2DA 1RTQA 1XEBA 1HJZA 1YW4A 2Z0ZA 4MBUA 2EK9A 4B6ZA 4MFLA 5I0CA 5J8FA 2PJ4A 5D29A 1WK4A 3K2KA 4P4DA 2VRIA 2VXKA 4NJQA 4KZTA 1M4LA 3SI0A 4MMOA 2Z3PA 1QQ9A 4UWIA 4NJRA 3IWGA 2RNKA 2HQYA 5JQ4A 4CRZB 3A9LA 2CNTA 2EEEA 2CF4A 3CXQA 2ZEGA 2J8MA 4IK2A 4MRIA 4ORFA 5J8CA 1S7FA 5D8NA 1B87A 3EWQA 4ZY1A 2FVGA 2Q7SA 2ZEOA 4KS9A 2FAVA 5E3BA 2JDDA 4OLLA 2PSWA 4PV6A 4MY3A 3S6FA 2CTBA 3VH9A 1YQEA 3D7DA 2V8DA 4WWVA 1Z8XA 2J9AA 3TO9A 2DPSA 1IOIA 3B2YA 3JUWA 1MJAA 4XNHC 4IF5A 5EBVA 5AGEA 3B3SA 2WPWA 2XEJA 1S3ZA 4KOSA 3SIIA 5F46A 4KYBA 2PJ9A 3GUXA 2BFQA 3QB8A 3JRUA 5ELYA 4PPZA 4P44A 2ODFA 1Y0RA 4FD5A 4KSFA 3KZWA 4P4EA 1Z8LA 4F8ZA 3P2FA 4UMLA 4MCSA 4GS4A 1Q7LA 3TC8A 3BJ7A 2YNCC 1XE4A 2VZYA 2XEGA 1Y7EA 5JGFA 4AG7A 1FT7A 4MHDA 1ZO0A 3NE7A 5KTCA 1ZR3A 3H8GA 4AG9A 1M4IA 4B12A 3V8IA 3W6XA 3EJFA 1XFOA 2BO9A 2IQ6A 4PXEA 4MFZA 4QC6A 4CGPA 2AFZA 1GHEA 4ZBGA 2ZEFA 3IEHA 2PJ6A 4HNYB 3FXTA 3CXPA 4FUUA 4A30A 4U9YA 1ELMP 2OZHA 3T90A 4KUBA 5GCNA 3H8FA 1NJRA 4CYPA 4XPDB 1S60A 4L8AA 4PQAA 2AJ6A 3TOAA 3H4QA 1SPVA 1ZG9A 5LRJA 1BO4A 2PJ5A 3T8WA 4M6IA 1TXRA 1AMPA 2QYVA 5HVGA 3T9YA 2QIRA 5I4MA 4PXCA 3IFEA 2GLJA 1ON0A 2VI7A 1IYKA 3R95A 4A37A 4AVBA 1KWMA 1NSLA 3EKEA 4KSIA 4OP4A 1TKHA 3TO6A 3GQOA 2PVVA 1TF9A 2AFSA 3FYNA 4PK3A 4CYOA 3RO0A 4FD4A 4YGOA 2Q4ZA 2ZEHA 5H84A 4YFJA 3K9TA 4EWTA 4OADA 4R87A 4P10A 4A94A 4RI1A 5CMSA 3V2BA 1DTDA 4G1PA 2I79A 2P6EA 2WYRA 3EWRA 1UWYA 3FRMA 4OIWA 1XBUA 5LYIA 4DUKA 3NFZA 1QSMA 4ZY0A 2C6CA 4UBRA 4CS0B 4UWJA 4CAWA 4ONUA 1BPMA 1LAMA 3IGRA 2PIZA 1TIQA 2YNDA 1AYEA 4MFQA 4HNXB 4X8IA 2PCUA 3KKWA 1JWQA 2PRQA 2BEIA 3PGPA 2J8RA 2BFRA 1CP7A 2V8GA 4JWPA 3P2HA 3EWOA 4EVYA 3IU1A 2WSAA 3QAHA 2ZEMA 3FBUA 2WCTA 4UFWA 4A33A 2ZXVA 3PB8X 5HVHA 2ZEPA 3SIGA 2KCWA 2WZNA 4JYWA 4NCZA 2PR1A 3DSBA 3S6KA 1YVOA 3KHZA 2ARHA 3NH8A 1IICA 1S7LA 2VL1A 3K9UA 4B10A 2YNCA 3D7GA 1U6MA 4OC4A 4CAXA 2AFXA 3S9NA 4K0CA 3D68A 4BBHA 4Q38A 2Z3KA 1Y9KA 3D7FA 4P4JA 5H86A 4YWYA 4MCPA 3SJGA 4J5RA 1R43A 2HC9A 3QNVA 4MCRA 4ONWA 2ZW6A 2RB7A 4MJ8A 2Y0MA 3DDDA 1P0HA 3PFOA 2CNSA 2JEVA 5HH1A 3FIXA 1YGHA 3S6GA 1Z4RA 3RYOA 3PRTA 2BSWA 3Q71A 3IIBA 1LFWA 3D66A 1TY8A 2B4BA 3G8WA 4YU9A 1EE3P 4R6TA 3D4UA 5LYFA 3EFAA 2X7BA 3TFYA 1VHSA 4C2YA 3IIFA 1QSTA 1Z8TA 2GANA 2FXFA 5G20A 3B3TA 4OC2A 3KR4A 2PJ1A 7CPAA 2CY2A 1IGBA 1VHOA 3IJ3A 5DWNA 5CPAA 2C6PA 2H5MA 1FNOA 1X10A 3MRUA 4IAVA 3R9EA 2PRBA 1S7KA 1QSOA 1V0CA 2AFMA 4AVAA 5C82A 1I1DA 4M6HA 4R3LA 3ZZIA 5K8OA 3GPQA 4ABLA 2VEZA 2YGWA 2PJ8A 2B3VA 2C27A 3DNSA 3FJUA 2PE3A 4ESSA 5FSYA 5AG7A 1X12A 3PBEA 3SIJA 1CPXA 2NYQA 4C68A 3HUVA 3GPGA 3WR7A 3DLJA 3R9FA 3N5FA 3B3VA 1CPSA 3KQZA 2O53A 4Q7AA 4RUHA 3CPAA 3GB0A 5F09A 3PB4X 4GM5A 2Q43A 4MHZA 2D4PA 4A32A 1FY7A 5HOLA 4GXHA 4XPKA 1UFHA 1XOVA 3D3SA 3S6HA 2EWBA 5LYDA 1XF8A 3GIUA 2OZGA 3FEDA 3LMSA 4CRYB 3OWCA 5A27A 4OIDA 3CT9A 4B5PA 5FVJA 1N71A 4RN7A 4UA3A 2AFWA 1KZFA 4M3SA 5CNPA 1LAPA 1Z2LA 4KOVA 5FSZA 1L0CA 3LODA 4K30A 4JCAA 2YNEA 4TNUA 4ETJA 2B58A 4A2ZA 4CYNA 4F0XA 5J1QA 4BMHA 3GYAA 3SHPA 2D4OA 4UEEA 2JZFA 1F2PA 1PCAA 2Z3NA 3GY9A 4IHMA 3DGVA
chains in the Genus database with same CATH topology
4P4BA 3KI9A 4W9YA 3IIDA 3FMCA 2POKA 4MHPA 2JBKA 5FSVA 1TXZA 4LQGA 4IQYA 4UIAA 2EK8A 3SI1A 3FX6A 3FVLA 4ZX8A 3KGQA 4MCQA 4GUAA 3BXMA 3KHXA 3WC5A 4A38A 4NGMA 2I3CA 4F9UA 4JVVA 4ABKA 1TKFA 3VATA 3KL9A 1VGYA 4ZI6A 2O4HA 3B3WA 4MHNA 4PXBA 5K8NA 3IC1A 3IO1A 2IJZA 1YW6A 2QVPA 3S9LA 3PB7X 1YLOA 1JQGA 1YD9A 1PYTB 4J5SA 1LCPA 1TF8A 3BI0A 2PJ0A 3TX8A 1GYTA 4ETKA 4TWEA 3CPXA 1BAVA 4JZ0A 3NH5A 1ZG7A 4A39A 3V45A 4MHYA 3VARA 5JM6A 3PFEA 1HDQA 2X47A 1F2OA 4Z65A 2XD7A 1XMBA 3WT4A 3GQEA 2QJ8A 5DS0A 2ACFA 3L2NA 2GREA 2ZENA 3V38A 1BLLE 4P6YA 4ZY2A 4UEZA 3GLJA 4R76A 1NSAA 5LYLA 3FEEA 6CPAA 4TU0A 4OC0A 4O23A 1Z5RA 4ZYQA 3PEIA 3NH4A 1DE4C 1QMUA 2PJAA 5K8MA 2PJ2A 1ZLIA 2CIJA 5FSUA 1XJOA 3KQXA 4X3RA 1ELLP 1VHUA 2AFOA 3WABA 1CG2A 3EWPA 2PIYA 3CDXA 4OC5A 4BD9A 1ZLHA 1LANA 5THWA 5AILA 3KR5A 5DUSA 2PJCA 2AFUA 3BHXA 4K3NA 1TKJA 4DYOA 3SIHA 1Y0YA 4NGTA 4AXVA 3FF3A 4FBEA 3D7HA 4PXDA 1ARMA 4NGSA 2FG1A 2GLFA 3V7ZA 4J4ZA 3FH4A 4NGQA 1ZR5A 2CTCA 2JEWA 5CBMA 3SJFA 2BOAA 4R7MA 3KASA 2XEFA 3B3CA 3S9MA 3WC7A 3RAMA 4R8FA 4P4IA 3PB9X 4FWUA 4WJBA 3SJEA 4EMEA 3GPOA 5CB3A 2ABZA 2Q51A 2ZELA 4DJLA 2C6GA 1XRYA 2BCOA 1ZG8A 1VHEA 4JGKA 1IY7A 3RBUA 3ISXA 4JLLA 3WC6A 1YSJA 4FAIA 5LRGA 1LOKA 2DX6A 5HXDA 4X2TA 8CPAA 5CB5A 2PJBA 2OOTA 2PVWA 4OC1A 2ANPA 3JZTA 2F8HA 1CBXA 4OMEA 5IB9A 2XEIA 4GVVA 4UIBA 3NA6A 2JBJA 1OBRA 3LWUA 5HIHA 3VFQA 2L8RA 2AFCA 2ZOFA 3EW5A 2PJ3A 3B7IA 3Q6ZA 5JH9A 2V8VA 3MN8A 3EJGA 4ZX9A 3BI1A 2V77A 2V8HA 2ZOGA 3ISZA 4UEFA 2OR4A 1ARLA 2G9DA 2F7VA 4OKOA 5HVFA 4UF4A 4J5QA 2DEAA 4NGRA 2ZEEA 2RFHA 4NGPA 2NSMA 4P4FA 2ZEDA 3IWWA 4CPAA 1YMEA 3H8EA 2FXKA 1VIXA 2PJ7A 1CP6A 1H8LA 4NGNA 4P45A 4F9VA 3SJXA 4EFDA 3SI2A 1R3NA 3HLPA 3ETIA 1BPNA 4GVWA 2IMOA 5LRKA 4MXUA 2LGRA 3D67A 4H2KA 4OC3A 2HB6A 3PB6X 4NFRA 1HDUA 5FSXA 3RZAA 1CX8A 1F57A 2GU2A 2C1CA 4D86A 1HEEA 3PBBA 3B35A 3FECA 3I1UA 4B6ZA 1RTQA 1HJZA 1YW4A 2EK9A 2PJ4A 5D29A 3K2KA 4P4DA 2VRIA 4NJQA 1M4LA 3SI0A 4MMOA 1QQ9A 4NJRA 2EEEA 2CF4A 4IK2A 2ZEGA 4MRIA 5D8NA 3EWQA 4ZY1A 2FVGA 2ZEOA 5K8PA 2FAVA 5E3BA 3VH9A 2CTBA 3D7DA 2V8DA 4WWVA 2J9AA 3B2YA 3B3SA 2XEJA 3SIIA 4KYBA 2PJ9A 3GUXA 2BFQA 3JRUA 5ELYA 4PPZA 4P44A 1Y0RA 3KZWA 4P4EA 1Z8LA 4F8ZA 4UMLA 4MCSA 1Q7LA 3TC8A 2XEGA 1Y7EA 5JGFA 1FT7A 1ZR3A 3H8GA 3EJFA 1XFOA 2BO9A 2IQ6A 4PXEA 2AFZA 2ZEFA 3IEHA 2PJ6A 4FUUA 1ELMP 3H8FA 1NJRA 4PQAA 1SPVA 1ZG9A 5LRJA 2PJ5A 3T8WA 1TXRA 1AMPA 2QYVA 5HVGA 5I4MA 4PXCA 3IFEA 2GLJA 4A37A 1KWMA 3EKEA 4KSIA 4OP4A 1TKHA 2PVVA 3GQOA 1TF9A 2AFSA 2Q4ZA 2ZEHA 3K9TA 4EWTA 4P10A 5CMSA 3V2BA 1DTDA 4G1PA 2WYRA 3EWRA 1UWYA 4OIWA 1XBUA 5LYIA 3NFZA 4ZY0A 2C6CA 1BPMA 1LAMA 2PIZA 1AYEA 4X8IA 2PCUA 2PRQA 2BFRA 1CP7A 2V8GA 3EWOA 2ZEMA 3PB8X 5HVHA 2ZEPA 3SIGA 2WZNA 4JYWA 3KHZA 3NH8A 2VL1A 3D7GA 4OC4A 2AFXA 3S9NA 4K0CA 3D68A 3D7FA 4P4JA 4YWYA 3SJGA 4MCPA 4J5RA 1R43A 2HC9A 3QNVA 4MCRA 4ONWA 2RB7A 3PFOA 3PRTA 3IIBA 3Q71A 1LFWA 3D66A 1TY8A 4YU9A 1EE3P 4R6TA 3D4UA 5LYFA 3IIFA 3B3TA 4OC2A 3KR4A 2PJ1A 7CPAA 1IGBA 1VHOA 3IJ3A 5CPAA 2C6PA 1FNOA 3MRUA 4IAVA 2AFMA 5K8OA 3GPQA 4ABLA 2PJ8A 3FJUA 2PE3A 4ESSA 5FSYA 3PBEA 3SIJA 1CPXA 2NYQA 3HUVA 3GPGA 3DLJA 3N5FA 3B3VA 1CPSA 3KQZA 2O53A 4Q7AA 4RUHA 3CPAA 3GB0A 5F09A 3PB4X 4GM5A 2Q43A 4MHZA 5HOLA 2EWBA 5LYDA 3FEDA 3LMSA 4OIDA 3CT9A 2AFWA 1LAPA 1Z2LA 5FSZA 4DUKA 4TNUA 4JCAA 4ETJA 5J1QA 4UEEA 1PCAA 1F2PA 4IHMA 4A94A 3DGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4B A;  3KI9 A;  4W9Y A;  3IID A;  3FMC A;  2POK A;  4MHP A;  2JBK A;  5FSV A;  1TXZ A;  4LQG A;  4IQY A;  4UIA A;  2EK8 A;  3SI1 A;  3FX6 A;  3FVL A;  4ZX8 A;  3KGQ A;  4MCQ A;  4GUA A;  3BXM A;  3KHX A;  3WC5 A;  4A38 A;  4NGM A;  2I3C A;  4F9U A;  4JVV A;  4ABK A;  1TKF A;  3VAT A;  3KL9 A;  1VGY A;  4ZI6 A;  2O4H A;  3B3W A;  4MHN A;  4PXB A;  5K8N A;  3IC1 A;  3IO1 A;  2IJZ A;  1YW6 A;  2QVP A;  3S9L A;  3PB7 X;  1YLO A;  1JQG A;  1YD9 A;  1PYT B;  4J5S A;  1LCP A;  1TF8 A;  3BI0 A;  2PJ0 A;  3TX8 A;  1GYT A;  4ETK A;  4TWE A;  3CPX A;  1BAV A;  4JZ0 A;  3NH5 A;  1ZG7 A;  4A39 A;  3V45 A;  4MHY A;  3VAR A;  5JM6 A;  3PFE A;  1HDQ A;  2X47 A;  1F2O A;  4Z65 A;  2XD7 A;  1XMB A;  3WT4 A;  3GQE A;  2QJ8 A;  5DS0 A;  2ACF A;  3L2N A;  2GRE A;  2ZEN A;  3V38 A;  1BLL E;  4P6Y A;  4ZY2 A;  4UEZ A;  3GLJ A;  4R76 A;  1NSA A;  5LYL A;  3FEE A;  6CPA A;  4TU0 A;  4OC0 A;  4O23 A;  1Z5R A;  4ZYQ A;  3PEI A;  3NH4 A;  1DE4 C;  1QMU A;  2PJA A;  5K8M A;  2PJ2 A;  1ZLI A;  2CIJ A;  5FSU A;  1XJO A;  3KQX A;  4X3R A;  1ELL P;  1VHU A;  2AFO A;  3WAB A;  1CG2 A;  3EWP A;  2PIY A;  3CDX A;  4OC5 A;  4BD9 A;  1ZLH A;  1LAN A;  5THW A;  5AIL A;  3KR5 A;  5DUS A;  2PJC A;  2AFU A;  3BHX A;  4K3N A;  1TKJ A;  4DYO A;  3SIH A;  1Y0Y A;  4NGT A;  4AXV A;  3FF3 A;  4FBE A;  3D7H A;  4PXD A;  1ARM A;  4NGS A;  2FG1 A;  2GLF A;  3V7Z A;  4J4Z A;  3FH4 A;  4NGQ A;  1ZR5 A;  2CTC A;  2JEW A;  5CBM A;  3SJF A;  2BOA A;  4R7M A;  3KAS A;  2XEF A;  3B3C A;  3S9M A;  3WC7 A;  3RAM A;  4R8F A;  4P4I A;  3PB9 X;  4FWU A;  4WJB A;  3SJE A;  4EME A;  3GPO A;  5CB3 A;  2ABZ A;  2Q51 A;  2ZEL A;  4DJL A;  2C6G A;  1XRY A;  2BCO A;  1ZG8 A;  1VHE A;  4JGK A;  1IY7 A;  3RBU A;  3ISX A;  4JLL A;  3WC6 A;  1YSJ A;  4FAI A;  5LRG A;  1LOK A;  2DX6 A;  5HXD A;  4X2T A;  8CPA A;  5CB5 A;  2PJB A;  2OOT A;  2PVW A;  4OC1 A;  2ANP A;  3JZT A;  2F8H A;  1CBX A;  4OME A;  5IB9 A;  2XEI A;  4GVV A;  4UIB A;  3NA6 A;  2JBJ A;  1OBR A;  3LWU A;  5HIH A;  3VFQ A;  2L8R A;  2AFC A;  2ZOF A;  3EW5 A;  2PJ3 A;  3B7I A;  3Q6Z A;  5JH9 A;  2V8V A;  3MN8 A;  3EJG A;  4ZX9 A;  3BI1 A;  2V77 A;  2V8H A;  2ZOG A;  3ISZ A;  4UEF A;  2OR4 A;  1ARL A;  2G9D A;  2F7V A;  4OKO A;  5HVF A;  4UF4 A;  4J5Q A;  2DEA A;  4NGR A;  2ZEE A;  2RFH A;  4NGP A;  2NSM A;  4P4F A;  2ZED A;  3IWW A;  4CPA A;  1YME A;  3H8E A;  2FXK A;  1VIX A;  2PJ7 A;  1CP6 A;  1H8L A;  4NGN A;  4P45 A;  4F9V A;  3SJX A;  4EFD A;  3SI2 A;  1R3N A;  3HLP A;  3ETI A;  1BPN A;  4GVW A;  2IMO A;  5LRK A;  4MXU A;  2LGR A;  3D67 A;  4H2K A;  4OC3 A;  2HB6 A;  3PB6 X;  4NFR A;  1HDU A;  5FSX A;  3RZA A;  1CX8 A;  1F57 A;  2GU2 A;  2C1C A;  4D86 A;  1HEE A;  3PBB A;  3B35 A;  3FEC A;  3I1U A;  4B6Z A;  1RTQ A;  1HJZ A;  1YW4 A;  2EK9 A;  2PJ4 A;  5D29 A;  3K2K A;  4P4D A;  2VRI A;  4NJQ A;  1M4L A;  3SI0 A;  4MMO A;  1QQ9 A;  4NJR A;  2EEE A;  2CF4 A;  4IK2 A;  2ZEG A;  4MRI A;  5D8N A;  3EWQ A;  4ZY1 A;  2FVG A;  2ZEO A;  5K8P A;  2FAV A;  5E3B A;  3VH9 A;  2CTB A;  3D7D A;  2V8D A;  4WWV A;  2J9A A;  3B2Y A;  3B3S A;  2XEJ A;  3SII A;  4KYB A;  2PJ9 A;  3GUX A;  2BFQ A;  3JRU A;  5ELY A;  4PPZ A;  4P44 A;  1Y0R A;  3KZW A;  4P4E A;  1Z8L A;  4F8Z A;  4UML A;  4MCS A;  1Q7L A;  3TC8 A;  2XEG A;  1Y7E A;  5JGF A;  1FT7 A;  1ZR3 A;  3H8G A;  3EJF A;  1XFO A;  2BO9 A;  2IQ6 A;  4PXE A;  2AFZ A;  2ZEF A;  3IEH A;  2PJ6 A;  4FUU A;  1ELM P;  3H8F A;  1NJR A;  4PQA A;  1SPV A;  1ZG9 A;  5LRJ A;  2PJ5 A;  3T8W A;  1TXR A;  1AMP A;  2QYV A;  5HVG A;  5I4M A;  4PXC A;  3IFE A;  2GLJ A;  4A37 A;  1KWM A;  3EKE A;  4KSI A;  4OP4 A;  1TKH A;  2PVV A;  3GQO A;  1TF9 A;  2AFS A;  2Q4Z A;  2ZEH A;  3K9T A;  4EWT A;  4P10 A;  5CMS A;  3V2B A;  1DTD A;  4G1P A;  2WYR A;  3EWR A;  1UWY A;  4OIW A;  1XBU A;  5LYI A;  3NFZ A;  4ZY0 A;  2C6C A;  1BPM A;  1LAM A;  2PIZ A;  1AYE A;  4X8I A;  2PCU A;  2PRQ A;  2BFR A;  1CP7 A;  2V8G A;  3EWO A;  2ZEM A;  3PB8 X;  5HVH A;  2ZEP A;  3SIG A;  2WZN A;  4JYW A;  3KHZ A;  3NH8 A;  2VL1 A;  3D7G A;  4OC4 A;  2AFX A;  3S9N A;  4K0C A;  3D68 A;  3D7F A;  4P4J A;  4YWY A;  3SJG A;  4MCP A;  4J5R A;  1R43 A;  2HC9 A;  3QNV A;  4MCR A;  4ONW A;  2RB7 A;  3PFO A;  3PRT A;  3IIB A;  3Q71 A;  1LFW A;  3D66 A;  1TY8 A;  4YU9 A;  1EE3 P;  4R6T A;  3D4U A;  5LYF A;  3IIF A;  3B3T A;  4OC2 A;  3KR4 A;  2PJ1 A;  7CPA A;  1IGB A;  1VHO A;  3IJ3 A;  5CPA A;  2C6P A;  1FNO A;  3MRU A;  4IAV A;  2AFM A;  5K8O A;  3GPQ A;  4ABL A;  2PJ8 A;  3FJU A;  2PE3 A;  4ESS A;  5FSY A;  3PBE A;  3SIJ A;  1CPX A;  2NYQ A;  3HUV A;  3GPG A;  3DLJ A;  3N5F A;  3B3V A;  1CPS A;  3KQZ A;  2O53 A;  4Q7A A;  4RUH A;  3CPA A;  3GB0 A;  5F09 A;  3PB4 X;  4GM5 A;  2Q43 A;  4MHZ A;  5HOL A;  2EWB A;  5LYD A;  3FED A;  3LMS A;  4OID A;  3CT9 A;  2AFW A;  1LAP A;  1Z2L A;  5FSZ A;  4DUK A;  4TNU A;  4JCA A;  4ETJ A;  5J1Q A;  4UEE A;  1PCA A;  1F2P A;  4IHM A;  4A94 A;  3DGV A; 
#chains in the Genus database with same CATH topology
 3CZX A;  4P4B A;  3TT2 A;  3KI9 A;  4W9Y A;  3PZJ A;  3IID A;  1XMT A;  3FMC A;  4KSA A;  2POK A;  4JXQ A;  4MHP A;  2F5I A;  2JBK A;  5FSV A;  2B5G B;  2PC1 A;  1TXZ A;  5JPH A;  4LQG A;  5EMI A;  4IQY A;  1BOB A;  4Y49 B;  1CM0 A;  2B4D A;  4UIA A;  3E0K A;  2EK8 A;  3SI1 A;  1YX0 A;  3FNC A;  3FX6 A;  3FVL A;  4ZX8 A;  1Z4E A;  3KGQ A;  4MCQ A;  4XPD C;  4Y49 C;  4GUA A;  1IYL A;  4UFV A;  3BXM A;  3KHX A;  4R57 A;  3WC5 A;  4A38 A;  4NGM A;  4C7H A;  2I3C A;  4HPS A;  4JVV A;  4MY0 A;  4F9U A;  4QUS A;  3D8P A;  2P6F A;  4KOT A;  1IU8 A;  4ABK A;  1TKF A;  5AG5 A;  3EC4 A;  1RO5 A;  3TO7 A;  3VAT A;  3KL9 A;  4KVO E;  1IB1 E;  1VGY A;  4ZI6 A;  2O4H A;  3B3W A;  4J3G A;  2HUZ A;  4MHN A;  4PXB A;  4CGO A;  4M85 A;  5K8N A;  2PQ8 A;  3IC1 A;  3IO1 A;  2ZW5 A;  5EC4 A;  2IJZ A;  2CXA A;  4U9Z A;  1YW6 A;  2OH1 A;  2QVP A;  4Q36 A;  4KOU A;  5G1Z A;  3S9L A;  3PB7 X;  2BL1 A;  1YLO A;  4R3K A;  4LQ6 A;  1RXT A;  5F49 A;  1JQG A;  4OAE A;  3BLN A;  4B5O A;  1YD9 A;  1PUA A;  1PYT B;  4KOX A;  4J5S A;  1LCP A;  1TF8 A;  5C88 A;  2JZD A;  2DXQ A;  2PJ0 A;  3BI0 A;  4KLW A;  4MFJ A;  3TX8 A;  2Q7B A;  5IX3 A;  2Q0Y A;  1GYT A;  4ETK A;  4TWE A;  4IUS A;  3CPX A;  4E2A A;  5KTD A;  1NMT A;  1BAV A;  4JZ0 A;  3NH5 A;  4KOY A;  1ZG7 A;  2FT0 A;  1B6B A;  1MK4 A;  1K4J A;  4A39 A;  1LRZ A;  4E0A A;  2AE6 A;  5IV0 A;  3V45 A;  2RC4 A;  4MHY A;  3VAR A;  5JM6 A;  2KQV A;  3PFE A;  1HDQ A;  2FCK A;  3F5B A;  1R57 A;  2X47 A;  4DNC A;  1F2O A;  4CAE A;  4B13 A;  4UCP A;  4Z65 A;  1MJ9 A;  2WUU A;  2XD7 A;  1XMB A;  1YRE A;  3WT4 A;  2K5T A;  3GQE A;  2ATR A;  2QJ8 A;  5DS0 A;  1OZP A;  3EXN A;  2ACF A;  3L2N A;  2O28 A;  5G21 A;  2GRE A;  1Y7R A;  2ZEN A;  3F0A A;  4LUA A;  3V38 A;  1BLL E;  4P6Y A;  1KUV A;  4AVC A;  2JDC A;  2PDO A;  4ZY2 A;  4UEZ A;  4II9 A;  3GLJ A;  4R76 A;  1NSA A;  5LYL A;  3FEE A;  6CPA A;  2I00 A;  4TU0 A;  4OC0 A;  4O23 A;  1Z5R A;  2EO8 A;  3MGD A;  4ZYQ A;  1I21 A;  3PEI A;  4PK2 A;  3SXN A;  3NH4 A;  1DE4 C;  1QMU A;  4A95 A;  2FIW A;  2PJA A;  2VBQ A;  2JLM A;  5K8M A;  2PJ2 A;  2OU2 A;  1ZLI A;  2CIJ A;  5FSU A;  1AUG A;  3I3G A;  2QEC A;  4HNW B;  1XJO A;  4NSQ A;  3KQX A;  2Q4Y A;  1KUY A;  2OZU A;  1ELL P;  4X3R A;  2R98 A;  1VHU A;  5F47 A;  2DF5 A;  2AFO A;  3WAB A;  1CG2 A;  3EWP A;  2EVN A;  2PIY A;  3CDX A;  4I49 A;  1P4N A;  4OC5 A;  5DWM A;  1WWZ A;  4BD9 A;  4BIN A;  1ZLH A;  1LAN A;  2FSR A;  2PR8 A;  4X5K A;  3C26 A;  5THW A;  3W91 A;  1A2Z A;  4A31 A;  2FE7 A;  3IU2 A;  5AIL A;  2NMT A;  2P0W A;  3KR5 A;  2A4N A;  5DUS A;  3UY5 A;  2Z3L A;  1VKC A;  3SXO A;  2IL4 A;  2PJC A;  1YR0 A;  2AFU A;  3BHX A;  4K3N A;  1TKJ A;  4NXY A;  4DYO A;  2ZW4 A;  3B8G A;  3SIH A;  1Y0Y A;  2Q4V A;  4NGT A;  4AXV A;  2EUI A;  1KUX A;  3FF3 A;  4FBE A;  4MFP A;  3D7H A;  4PXD A;  1ARM A;  1YK3 A;  2FG1 A;  2GLF A;  4NGS A;  3VWE A;  3W6S A;  3NE8 A;  3V7Z A;  1Q2Y A;  4J4Z A;  3FH4 A;  4NGQ A;  1ZR5 A;  4JJX A;  4PSX A;  2CTC A;  4XNH B;  4JD6 A;  5IB0 A;  4KUA A;  2JEW A;  4XPL A;  5CBM A;  4R9M A;  3I9S A;  3SJF A;  2BOA A;  5E96 A;  4R7M A;  2DPT A;  3KAS A;  2XEF A;  2P6G A;  3H5Z A;  4NEX A;  4U5Y A;  2Z3O A;  1Y9W A;  3B3C A;  5K8P A;  3S9M A;  1XIX A;  3WC7 A;  3RAM A;  4R8F A;  2FS5 A;  4P4I A;  3PB9 X;  4FWU A;  4WJB A;  3SJE A;  4EME A;  3GPO A;  4JXR A;  5CB3 A;  2ABZ A;  2Q51 A;  2ZEL A;  4KOR A;  3TOB A;  4DJL A;  3FB3 A;  3PP9 A;  1IID A;  1MJB A;  2C6G A;  5AG6 A;  1XRY A;  2BCO A;  1ZG8 A;  4PSW A;  1VHE A;  2Q44 A;  4QBJ A;  4JGK A;  4B14 A;  2Z3M A;  4CYQ A;  1IY7 A;  2VZZ A;  3R9G A;  1S7N A;  3RBU A;  2B3U A;  3ISX A;  4C2X A;  4KOW A;  4JLL A;  3WC6 A;  1YSJ A;  4FAI A;  5LRG A;  1LOK A;  2DX6 A;  2R7H A;  4KLV A;  5G22 A;  5HXD A;  4F0Y A;  2JZE A;  4X2T A;  4QB9 A;  8CPA A;  4H6U A;  5CB5 A;  3LAC A;  4L89 A;  2PJB A;  3TCV A;  4M6G A;  2OOT A;  4NF1 A;  2FL4 A;  2PVW A;  4UFX A;  4KVX A;  4FD7 A;  1M44 A;  2BUE A;  2HV2 A;  3CXS A;  3G3S A;  4UCN A;  2QML A;  4OC1 A;  4CGM A;  2ANP A;  3JZT A;  2F8H A;  4RS2 A;  1NE9 A;  2R8V A;  1CBX A;  4OME A;  5IB9 A;  2XEI A;  4GVV A;  4CGL A;  2Q04 A;  1YLE A;  4YRH A;  3D2P A;  5BWA B;  2R1I A;  1PU9 A;  4H6Z A;  3NA6 A;  2JBJ A;  1OBR A;  4UIB A;  2ZW7 A;  3JTK A;  3RNZ A;  3LWU A;  1YVK A;  3DR6 A;  5HIH A;  3EO4 A;  3VFQ A;  2EBJ A;  3DR8 A;  1CJW A;  2L8R A;  2AFC A;  3JVN A;  2ZOF A;  3EW5 A;  1QSR A;  2PJ3 A;  3Q6Z A;  3B7I A;  3N7Z A;  2V8V A;  3MN8 A;  3ZJ0 A;  1I12 A;  5JH9 A;  2WPX A;  2ZPA A;  3EJG A;  4LX9 A;  4ZX9 A;  2G3A A;  3BI1 A;  3D2M A;  4HKF A;  5AG4 A;  2V77 A;  2V8H A;  2ZOG A;  3ISZ A;  4UEF A;  2OR4 A;  4B11 A;  1SQH A;  5KTA A;  2REF A;  1ARL A;  2G9D A;  2F7V A;  4OKO A;  1Z8W A;  5HVF A;  4CAV A;  2CNM A;  4UCM A;  3LD2 A;  4J5Q A;  4UF4 A;  3IWE A;  2DEA A;  4NGR A;  1Z9U A;  1IOF A;  2Z11 A;  2ZEE A;  4B5P B;  3GKR A;  2RFH A;  4NGP A;  2NSM A;  4P4F A;  1J4J A;  2ZED A;  3F8K A;  3IWW A;  4AB7 A;  1YME A;  4CPA A;  3H8E A;  3TTH A;  4F6A A;  5HMN A;  2FXK A;  1M4G A;  1VIX A;  2VQY A;  2J8N A;  4MI4 A;  5ISV A;  2G3T A;  1CP6 A;  2PJ7 A;  3R1K A;  5F48 A;  3TE4 A;  5A28 A;  1H8L A;  4NGN A;  4P45 A;  4F9V A;  4E8O A;  2OB0 A;  3SJX A;  1M4D A;  4JLY A;  4EFD A;  2GE3 A;  3SI2 A;  1M1D A;  3BJ8 A;  4QVT A;  1R3N A;  4H89 A;  2W2G A;  2B5G A;  2Z10 A;  2B4D B;  2GFQ A;  3HLP A;  3ETI A;  3EY5 A;  1QSN A;  1BPN A;  4GVW A;  2IMO A;  5LRK A;  2FIA A;  4MXU A;  3R96 A;  4CAF A;  2LGR A;  1S5K A;  3D67 A;  3VWD A;  4ZGY B;  2GIV A;  4H2K A;  4OC3 A;  2HB6 A;  2REE A;  3PB6 X;  4KVM E;  3QAY A;  4NFR A;  1HDU A;  4C2Z A;  5FSX A;  4FD6 A;  3RZA A;  1CX8 A;  4C7I A;  1F57 A;  2G0B A;  2GU2 A;  1Q2C A;  4MFK A;  2C1C A;  4D86 A;  1HEE A;  4CGN A;  3PBB A;  3B35 A;  3FEC A;  3I1U A;  1Q2D A;  1RTQ A;  1XEB A;  1HJZ A;  1YW4 A;  2Z0Z A;  4MBU A;  2EK9 A;  4B6Z A;  4MFL A;  5I0C A;  5J8F A;  2PJ4 A;  5D29 A;  1WK4 A;  3K2K A;  4P4D A;  2VRI A;  2VXK A;  4NJQ A;  4KZT A;  1M4L A;  3SI0 A;  4MMO A;  2Z3P A;  1QQ9 A;  4UWI A;  4NJR A;  3IWG A;  2RNK A;  2HQY A;  5JQ4 A;  4CRZ B;  3A9L A;  2CNT A;  2EEE A;  2CF4 A;  3CXQ A;  2ZEG A;  2J8M A;  4IK2 A;  4MRI A;  4ORF A;  5J8C A;  1S7F A;  5D8N A;  1B87 A;  3EWQ A;  4ZY1 A;  2FVG A;  2Q7S A;  2ZEO A;  4KS9 A;  2FAV A;  5E3B A;  2JDD A;  4OLL A;  2PSW A;  4PV6 A;  4MY3 A;  3S6F A;  2CTB A;  3VH9 A;  1YQE A;  3D7D A;  2V8D A;  4WWV A;  1Z8X A;  2J9A A;  3TO9 A;  2DPS A;  1IOI A;  3B2Y A;  3JUW A;  1MJA A;  4XNH C;  4IF5 A;  5EBV A;  5AGE A;  3B3S A;  2WPW A;  2XEJ A;  1S3Z A;  4KOS A;  3SII A;  5F46 A;  4KYB A;  2PJ9 A;  3GUX A;  2BFQ A;  3QB8 A;  3JRU A;  5ELY A;  4PPZ A;  4P44 A;  2ODF A;  1Y0R A;  4FD5 A;  4KSF A;  3KZW A;  4P4E A;  1Z8L A;  4F8Z A;  3P2F A;  4UML A;  4MCS A;  4GS4 A;  1Q7L A;  3TC8 A;  3BJ7 A;  2YNC C;  1XE4 A;  2VZY A;  2XEG A;  1Y7E A;  5JGF A;  4AG7 A;  1FT7 A;  4MHD A;  1ZO0 A;  3NE7 A;  5KTC A;  1ZR3 A;  3H8G A;  4AG9 A;  1M4I A;  4B12 A;  3V8I A;  3W6X A;  3EJF A;  1XFO A;  2BO9 A;  2IQ6 A;  4PXE A;  4MFZ A;  4QC6 A;  4CGP A;  2AFZ A;  1GHE A;  4ZBG A;  2ZEF A;  3IEH A;  2PJ6 A;  4HNY B;  3FXT A;  3CXP A;  4FUU A;  4A30 A;  4U9Y A;  1ELM P;  2OZH A;  3T90 A;  4KUB A;  5GCN A;  3H8F A;  1NJR A;  4CYP A;  4XPD B;  1S60 A;  4L8A A;  4PQA A;  2AJ6 A;  3TOA A;  3H4Q A;  1SPV A;  1ZG9 A;  5LRJ A;  1BO4 A;  2PJ5 A;  3T8W A;  4M6I A;  1TXR A;  1AMP A;  2QYV A;  5HVG A;  3T9Y A;  2QIR A;  5I4M A;  4PXC A;  3IFE A;  2GLJ A;  1ON0 A;  2VI7 A;  1IYK A;  3R95 A;  4A37 A;  4AVB A;  1KWM A;  1NSL A;  3EKE A;  4KSI A;  4OP4 A;  1TKH A;  3TO6 A;  3GQO A;  2PVV A;  1TF9 A;  2AFS A;  3FYN A;  4PK3 A;  4CYO A;  3RO0 A;  4FD4 A;  4YGO A;  2Q4Z A;  2ZEH A;  5H84 A;  4YFJ A;  3K9T A;  4EWT A;  4OAD A;  4R87 A;  4P10 A;  4A94 A;  4RI1 A;  5CMS A;  3V2B A;  1DTD A;  4G1P A;  2I79 A;  2P6E A;  2WYR A;  3EWR A;  1UWY A;  3FRM A;  4OIW A;  1XBU A;  5LYI A;  4DUK A;  3NFZ A;  1QSM A;  4ZY0 A;  2C6C A;  4UBR A;  4CS0 B;  4UWJ A;  4CAW A;  4ONU A;  1BPM A;  1LAM A;  3IGR A;  2PIZ A;  1TIQ A;  2YND A;  1AYE A;  4MFQ A;  4HNX B;  4X8I A;  2PCU A;  3KKW A;  1JWQ A;  2PRQ A;  2BEI A;  3PGP A;  2J8R A;  2BFR A;  1CP7 A;  2V8G A;  4JWP A;  3P2H A;  3EWO A;  4EVY A;  3IU1 A;  2WSA A;  3QAH A;  2ZEM A;  3FBU A;  2WCT A;  4UFW A;  4A33 A;  2ZXV A;  3PB8 X;  5HVH A;  2ZEP A;  3SIG A;  2KCW A;  2WZN A;  4JYW A;  4NCZ A;  2PR1 A;  3DSB A;  3S6K A;  1YVO A;  3KHZ A;  2ARH A;  3NH8 A;  1IIC A;  1S7L A;  2VL1 A;  3K9U A;  4B10 A;  2YNC A;  3D7G A;  1U6M A;  4OC4 A;  4CAX A;  2AFX A;  3S9N A;  4K0C A;  3D68 A;  4BBH A;  4Q38 A;  2Z3K A;  1Y9K A;  3D7F A;  4P4J A;  5H86 A;  4YWY A;  4MCP A;  3SJG A;  4J5R A;  1R43 A;  2HC9 A;  3QNV A;  4MCR A;  4ONW A;  2ZW6 A;  2RB7 A;  4MJ8 A;  2Y0M A;  3DDD A;  1P0H A;  3PFO A;  2CNS A;  2JEV A;  5HH1 A;  3FIX A;  1YGH A;  3S6G A;  1Z4R A;  3RYO A;  3PRT A;  2BSW A;  3Q71 A;  3IIB A;  1LFW A;  3D66 A;  1TY8 A;  2B4B A;  3G8W A;  4YU9 A;  1EE3 P;  4R6T A;  3D4U A;  5LYF A;  3EFA A;  2X7B A;  3TFY A;  1VHS A;  4C2Y A;  3IIF A;  1QST A;  1Z8T A;  2GAN A;  2FXF A;  5G20 A;  3B3T A;  4OC2 A;  3KR4 A;  2PJ1 A;  7CPA A;  2CY2 A;  1IGB A;  1VHO A;  3IJ3 A;  5DWN A;  5CPA A;  2C6P A;  2H5M A;  1FNO A;  1X10 A;  3MRU A;  4IAV A;  3R9E A;  2PRB A;  1S7K A;  1QSO A;  1V0C A;  2AFM A;  4AVA A;  5C82 A;  1I1D A;  4M6H A;  4R3L A;  3ZZI A;  5K8O A;  3GPQ A;  4ABL A;  2VEZ A;  2YGW A;  2PJ8 A;  2B3V A;  2C27 A;  3DNS A;  3FJU A;  2PE3 A;  4ESS A;  5FSY A;  5AG7 A;  1X12 A;  3PBE A;  3SIJ A;  1CPX A;  2NYQ A;  4C68 A;  3HUV A;  3GPG A;  3WR7 A;  3DLJ A;  3R9F A;  3N5F A;  3B3V A;  1CPS A;  3KQZ A;  2O53 A;  4Q7A A;  4RUH A;  3CPA A;  3GB0 A;  5F09 A;  3PB4 X;  4GM5 A;  2Q43 A;  4MHZ A;  2D4P A;  4A32 A;  1FY7 A;  5HOL A;  4GXH A;  4XPK A;  1UFH A;  1XOV A;  3D3S A;  3S6H A;  2EWB A;  5LYD A;  1XF8 A;  3GIU A;  2OZG A;  3FED A;  3LMS A;  4CRY B;  3OWC A;  5A27 A;  4OID A;  3CT9 A;  4B5P A;  5FVJ A;  1N71 A;  4RN7 A;  4UA3 A;  2AFW A;  1KZF A;  4M3S A;  5CNP A;  1LAP A;  1Z2L A;  4KOV A;  5FSZ A;  1L0C A;  3LOD A;  4K30 A;  4JCA A;  2YNE A;  4TNU A;  4ETJ A;  2B58 A;  4A2Z A;  4CYN A;  4F0X A;  5J1Q A;  4BMH A;  3GYA A;  3SHP A;  2D4O A;  4UEE A;  2JZF A;  1F2P A;  1PCA A;  2Z3N A;  3GY9 A;  4IHM A;  3DGV A; 
#chains in the Genus database with same CATH homology
 4P4B A;  3KI9 A;  4W9Y A;  3IID A;  3FMC A;  2POK A;  4MHP A;  2JBK A;  5FSV A;  1TXZ A;  4LQG A;  4IQY A;  4UIA A;  2EK8 A;  3SI1 A;  3FX6 A;  3FVL A;  4ZX8 A;  3KGQ A;  4MCQ A;  4GUA A;  3BXM A;  3KHX A;  3WC5 A;  4A38 A;  4NGM A;  2I3C A;  4F9U A;  4JVV A;  4ABK A;  1TKF A;  3VAT A;  3KL9 A;  1VGY A;  4ZI6 A;  2O4H A;  3B3W A;  4MHN A;  4PXB A;  5K8N A;  3IC1 A;  3IO1 A;  2IJZ A;  1YW6 A;  2QVP A;  3S9L A;  3PB7 X;  1YLO A;  1JQG A;  1YD9 A;  1PYT B;  4J5S A;  1LCP A;  1TF8 A;  3BI0 A;  2PJ0 A;  3TX8 A;  1GYT A;  4ETK A;  4TWE A;  3CPX A;  1BAV A;  4JZ0 A;  3NH5 A;  1ZG7 A;  4A39 A;  3V45 A;  4MHY A;  3VAR A;  5JM6 A;  3PFE A;  1HDQ A;  2X47 A;  1F2O A;  4Z65 A;  2XD7 A;  1XMB A;  3WT4 A;  3GQE A;  2QJ8 A;  5DS0 A;  2ACF A;  3L2N A;  2GRE A;  2ZEN A;  3V38 A;  1BLL E;  4P6Y A;  4ZY2 A;  4UEZ A;  3GLJ A;  4R76 A;  1NSA A;  5LYL A;  3FEE A;  6CPA A;  4TU0 A;  4OC0 A;  4O23 A;  1Z5R A;  4ZYQ A;  3PEI A;  3NH4 A;  1DE4 C;  1QMU A;  2PJA A;  5K8M A;  2PJ2 A;  1ZLI A;  2CIJ A;  5FSU A;  1XJO A;  3KQX A;  4X3R A;  1ELL P;  1VHU A;  2AFO A;  3WAB A;  1CG2 A;  3EWP A;  2PIY A;  3CDX A;  4OC5 A;  4BD9 A;  1ZLH A;  1LAN A;  5THW A;  5AIL A;  3KR5 A;  5DUS A;  2PJC A;  2AFU A;  3BHX A;  4K3N A;  1TKJ A;  4DYO A;  3SIH A;  1Y0Y A;  4NGT A;  4AXV A;  3FF3 A;  4FBE A;  3D7H A;  4PXD A;  1ARM A;  4NGS A;  2FG1 A;  2GLF A;  3V7Z A;  4J4Z A;  3FH4 A;  4NGQ A;  1ZR5 A;  2CTC A;  2JEW A;  5CBM A;  3SJF A;  2BOA A;  4R7M A;  3KAS A;  2XEF A;  3B3C A;  3S9M A;  3WC7 A;  3RAM A;  4R8F A;  4P4I A;  3PB9 X;  4FWU A;  4WJB A;  3SJE A;  4EME A;  3GPO A;  5CB3 A;  2ABZ A;  2Q51 A;  2ZEL A;  4DJL A;  2C6G A;  1XRY A;  2BCO A;  1ZG8 A;  1VHE A;  4JGK A;  1IY7 A;  3RBU A;  3ISX A;  4JLL A;  3WC6 A;  1YSJ A;  4FAI A;  5LRG A;  1LOK A;  2DX6 A;  5HXD A;  4X2T A;  8CPA A;  5CB5 A;  2PJB A;  2OOT A;  2PVW A;  4OC1 A;  2ANP A;  3JZT A;  2F8H A;  1CBX A;  4OME A;  5IB9 A;  2XEI A;  4GVV A;  4UIB A;  3NA6 A;  2JBJ A;  1OBR A;  3LWU A;  5HIH A;  3VFQ A;  2L8R A;  2AFC A;  2ZOF A;  3EW5 A;  2PJ3 A;  3B7I A;  3Q6Z A;  5JH9 A;  2V8V A;  3MN8 A;  3EJG A;  4ZX9 A;  3BI1 A;  2V77 A;  2V8H A;  2ZOG A;  3ISZ A;  4UEF A;  2OR4 A;  1ARL A;  2G9D A;  2F7V A;  4OKO A;  5HVF A;  4UF4 A;  4J5Q A;  2DEA A;  4NGR A;  2ZEE A;  2RFH A;  4NGP A;  2NSM A;  4P4F A;  2ZED A;  3IWW A;  4CPA A;  1YME A;  3H8E A;  2FXK A;  1VIX A;  2PJ7 A;  1CP6 A;  1H8L A;  4NGN A;  4P45 A;  4F9V A;  3SJX A;  4EFD A;  3SI2 A;  1R3N A;  3HLP A;  3ETI A;  1BPN A;  4GVW A;  2IMO A;  5LRK A;  4MXU A;  2LGR A;  3D67 A;  4H2K A;  4OC3 A;  2HB6 A;  3PB6 X;  4NFR A;  1HDU A;  5FSX A;  3RZA A;  1CX8 A;  1F57 A;  2GU2 A;  2C1C A;  4D86 A;  1HEE A;  3PBB A;  3B35 A;  3FEC A;  3I1U A;  4B6Z A;  1RTQ A;  1HJZ A;  1YW4 A;  2EK9 A;  2PJ4 A;  5D29 A;  3K2K A;  4P4D A;  2VRI A;  4NJQ A;  1M4L A;  3SI0 A;  4MMO A;  1QQ9 A;  4NJR A;  2EEE A;  2CF4 A;  4IK2 A;  2ZEG A;  4MRI A;  5D8N A;  3EWQ A;  4ZY1 A;  2FVG A;  2ZEO A;  5K8P A;  2FAV A;  5E3B A;  3VH9 A;  2CTB A;  3D7D A;  2V8D A;  4WWV A;  2J9A A;  3B2Y A;  3B3S A;  2XEJ A;  3SII A;  4KYB A;  2PJ9 A;  3GUX A;  2BFQ A;  3JRU A;  5ELY A;  4PPZ A;  4P44 A;  1Y0R A;  3KZW A;  4P4E A;  1Z8L A;  4F8Z A;  4UML A;  4MCS A;  1Q7L A;  3TC8 A;  2XEG A;  1Y7E A;  5JGF A;  1FT7 A;  1ZR3 A;  3H8G A;  3EJF A;  1XFO A;  2BO9 A;  2IQ6 A;  4PXE A;  2AFZ A;  2ZEF A;  3IEH A;  2PJ6 A;  4FUU A;  1ELM P;  3H8F A;  1NJR A;  4PQA A;  1SPV A;  1ZG9 A;  5LRJ A;  2PJ5 A;  3T8W A;  1TXR A;  1AMP A;  2QYV A;  5HVG A;  5I4M A;  4PXC A;  3IFE A;  2GLJ A;  4A37 A;  1KWM A;  3EKE A;  4KSI A;  4OP4 A;  1TKH A;  2PVV A;  3GQO A;  1TF9 A;  2AFS A;  2Q4Z A;  2ZEH A;  3K9T A;  4EWT A;  4P10 A;  5CMS A;  3V2B A;  1DTD A;  4G1P A;  2WYR A;  3EWR A;  1UWY A;  4OIW A;  1XBU A;  5LYI A;  3NFZ A;  4ZY0 A;  2C6C A;  1BPM A;  1LAM A;  2PIZ A;  1AYE A;  4X8I A;  2PCU A;  2PRQ A;  2BFR A;  1CP7 A;  2V8G A;  3EWO A;  2ZEM A;  3PB8 X;  5HVH A;  2ZEP A;  3SIG A;  2WZN A;  4JYW A;  3KHZ A;  3NH8 A;  2VL1 A;  3D7G A;  4OC4 A;  2AFX A;  3S9N A;  4K0C A;  3D68 A;  3D7F A;  4P4J A;  4YWY A;  3SJG A;  4MCP A;  4J5R A;  1R43 A;  2HC9 A;  3QNV A;  4MCR A;  4ONW A;  2RB7 A;  3PFO A;  3PRT A;  3IIB A;  3Q71 A;  1LFW A;  3D66 A;  1TY8 A;  4YU9 A;  1EE3 P;  4R6T A;  3D4U A;  5LYF A;  3IIF A;  3B3T A;  4OC2 A;  3KR4 A;  2PJ1 A;  7CPA A;  1IGB A;  1VHO A;  3IJ3 A;  5CPA A;  2C6P A;  1FNO A;  3MRU A;  4IAV A;  2AFM A;  5K8O A;  3GPQ A;  4ABL A;  2PJ8 A;  3FJU A;  2PE3 A;  4ESS A;  5FSY A;  3PBE A;  3SIJ A;  1CPX A;  2NYQ A;  3HUV A;  3GPG A;  3DLJ A;  3N5F A;  3B3V A;  1CPS A;  3KQZ A;  2O53 A;  4Q7A A;  4RUH A;  3CPA A;  3GB0 A;  5F09 A;  3PB4 X;  4GM5 A;  2Q43 A;  4MHZ A;  5HOL A;  2EWB A;  5LYD A;  3FED A;  3LMS A;  4OID A;  3CT9 A;  2AFW A;  1LAP A;  1Z2L A;  5FSZ A;  4DUK A;  4TNU A;  4JCA A;  4ETJ A;  5J1Q A;  4UEE A;  1PCA A;  1F2P A;  4IHM A;  4A94 A;  3DGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...