4K0CA

Crystal structure of the computationally designed serine hydrolase. northeast structural genomics consortium (nesg) target or317
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTVPGAWVGGLPAEAVRRVMVEEIKKAPDTLEVTGVHGTEKSAEACRRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR317
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords designed serine hydrolase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k0cA00
4J5QA 3EJFA 3T8WA 2AFCA 1TXZA 3EJGA 4J4ZA 2LGRA 2DX6A 4ZY0A 4ZX8A 3V2BA 4ABKA 5FSVA 3KR4A 4ZY1A 4ABLA 1YD9A 2FAVA 3Q71A 5HOLA 4KYBA 3EWQA 4GUAA 1LCPA 1ZR5A 3GPOA 3H8EA 3H8GA 1LAMA 3SIGA 3SIIA 3IIDA 3EWPA 2X47A 1NJRA 3KQXA 4ETJA 4D86A 3VFQA 3EWRA 3Q6ZA 1LANA 2J9AA 3ETIA 3EWOA 3PEIA 3SIJA 1TY8A 4R76A 4JVVA 4K0CA 3KQZA 3JZTA 2BFQA 4IQYA 4K3NA 2VRIA 2FG1A 3EKEA 3EW5A 3GQEA 5FSYA 5AILA 3IIFA 2EWBA 2BFRA 1BLLE 1BPNA 5FSXA 4J5SA 2ACFA 4TU0A 2XD7A 3IJ3A 4ZI6A 4ZYQA 5FSUA 5D8NA 4JLLA 3SIHA 2EEEA 3GQOA 4KSIA 3JRUA 4R6TA 4R7MA 4J5RA 4ZX9A 5HIHA 5CMSA 4GVWA 3KZWA 3GPQA 4UMLA 4X2TA 1ZR3A 3H8FA 3GPGA 1GYTA 2FXKA 5CB3A 3KR5A 4ETKA 5CBMA 1LAPA 1BPMA 5DUSA 2L8RA 4JGKA 5FSZA 1VHUA 3V45A 4ESSA 4GVVA 5CB5A 1SPVA 4JCAA 1HJZA 4ZY2A 5E3BA
chains in the Genus database with same CATH superfamily
4J5QA 3EJFA 3T8WA 2AFCA 1TXZA 3EJGA 4J4ZA 2LGRA 2DX6A 4ZY0A 4ZX8A 3V2BA 4ABKA 5FSVA 3KR4A 4ZY1A 4ABLA 1YD9A 2FAVA 3Q71A 5HOLA 1HJZA 4KYBA 3EWQA 4GUAA 1LCPA 1ZR5A 3GPOA 3H8EA 3H8GA 1LAMA 3SIGA 3SIIA 3IIDA 3EWPA 2X47A 1NJRA 3KQXA 4ETJA 4D86A 3VFQA 3EWRA 2WCTA 3Q6ZA 1LANA 2J9AA 3ETIA 3EWOA 3PEIA 3SIJA 1TY8A 4R76A 4JVVA 4K0CA 3KQZA 3JZTA 2BFQA 4IQYA 4K3NA 2VRIA 2FG1A 3EKEA 3EW5A 3GQEA 5FSYA 5AILA 3IIFA 2EWBA 2BFRA 1BLLE 1BPNA 5FSXA 4J5SA 2ACFA 4TU0A 2W2GA 2XD7A 3IJ3A 4ZI6A 4ZYQA 5FSUA 5D8NA 4JLLA 3SIHA 2EEEA 3GQOA 4KSIA 3JRUA 4R6TA 4R7MA 4J5RA 4ZX9A 5HIHA 5CMSA 4GVWA 2KQVA 3KZWA 3GPQA 4UMLA 4X2TA 1ZR3A 3H8FA 3GPGA 1GYTA 2FXKA 5CB3A 3KR5A 2RNKA 4ETKA 5CBMA 1LAPA 1BPMA 5DUSA 2L8RA 4JGKA 2JZFA 1VHUA 5FSZA 3V45A 4ESSA 4GVVA 5CB5A 1SPVA 4JCAA 2JZEA 4ZY2A 5E3BA 2JZDA
chains in the Genus database with same CATH topology
4J5QA 3EJFA 3T8WA 2AFCA 1TXZA 3EJGA 4J4ZA 2LGRA 2DX6A 4ZY0A 4ZX8A 3V2BA 4ABKA 5FSVA 3KR4A 4ZY1A 4ABLA 1YD9A 2FAVA 3Q71A 5HOLA 4KYBA 3EWQA 4GUAA 1LCPA 1ZR5A 3GPOA 3H8EA 3H8GA 1LAMA 3SIGA 3SIIA 3IIDA 3EWPA 2X47A 1NJRA 3KQXA 4ETJA 4D86A 3VFQA 3EWRA 3Q6ZA 1LANA 2J9AA 3ETIA 3EWOA 3PEIA 3SIJA 1TY8A 4R76A 4JVVA 4K0CA 3KQZA 3JZTA 2BFQA 4IQYA 4K3NA 2VRIA 2FG1A 3EKEA 3EW5A 3GQEA 5FSYA 5AILA 3IIFA 2EWBA 2BFRA 1BLLE 1BPNA 5FSXA 4J5SA 2ACFA 4TU0A 2XD7A 3IJ3A 4ZI6A 4ZYQA 5FSUA 5D8NA 4JLLA 3SIHA 2EEEA 3GQOA 4KSIA 3JRUA 4R6TA 4R7MA 4J5RA 4ZX9A 5HIHA 5CMSA 4GVWA 3KZWA 3GPQA 4UMLA 4X2TA 1ZR3A 3H8FA 3GPGA 1GYTA 2FXKA 5CB3A 3KR5A 4ETKA 5CBMA 1LAPA 1BPMA 5DUSA 2L8RA 4JGKA 5FSZA 1VHUA 3V45A 4ESSA 4GVVA 5CB5A 1SPVA 4JCAA 1HJZA 4ZY2A 5E3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5Q A;  3EJF A;  3T8W A;  2AFC A;  1TXZ A;  3EJG A;  4J4Z A;  2LGR A;  2DX6 A;  4ZY0 A;  4ZX8 A;  3V2B A;  4ABK A;  5FSV A;  3KR4 A;  4ZY1 A;  4ABL A;  1YD9 A;  2FAV A;  3Q71 A;  5HOL A;  4KYB A;  3EWQ A;  4GUA A;  1LCP A;  1ZR5 A;  3GPO A;  3H8E A;  3H8G A;  1LAM A;  3SIG A;  3SII A;  3IID A;  3EWP A;  2X47 A;  1NJR A;  3KQX A;  4ETJ A;  4D86 A;  3VFQ A;  3EWR A;  3Q6Z A;  1LAN A;  2J9A A;  3ETI A;  3EWO A;  3PEI A;  3SIJ A;  1TY8 A;  4R76 A;  4JVV A;  4K0C A;  3KQZ A;  3JZT A;  2BFQ A;  4IQY A;  4K3N A;  2VRI A;  2FG1 A;  3EKE A;  3EW5 A;  3GQE A;  5FSY A;  5AIL A;  3IIF A;  2EWB A;  2BFR A;  1BLL E;  1BPN A;  5FSX A;  4J5S A;  2ACF A;  4TU0 A;  2XD7 A;  3IJ3 A;  4ZI6 A;  4ZYQ A;  5FSU A;  5D8N A;  4JLL A;  3SIH A;  2EEE A;  3GQO A;  4KSI A;  3JRU A;  4R6T A;  4R7M A;  4J5R A;  4ZX9 A;  5HIH A;  5CMS A;  4GVW A;  3KZW A;  3GPQ A;  4UML A;  4X2T A;  1ZR3 A;  3H8F A;  3GPG A;  1GYT A;  2FXK A;  5CB3 A;  3KR5 A;  4ETK A;  5CBM A;  1LAP A;  1BPM A;  5DUS A;  2L8R A;  4JGK A;  5FSZ A;  1VHU A;  3V45 A;  4ESS A;  4GVV A;  5CB5 A;  1SPV A;  4JCA A;  1HJZ A;  4ZY2 A;  5E3B A; 
#chains in the Genus database with same CATH topology
 4J5Q A;  3EJF A;  3T8W A;  2AFC A;  1TXZ A;  3EJG A;  4J4Z A;  2LGR A;  2DX6 A;  4ZY0 A;  4ZX8 A;  3V2B A;  4ABK A;  5FSV A;  3KR4 A;  4ZY1 A;  4ABL A;  1YD9 A;  2FAV A;  3Q71 A;  5HOL A;  1HJZ A;  4KYB A;  3EWQ A;  4GUA A;  1LCP A;  1ZR5 A;  3GPO A;  3H8E A;  3H8G A;  1LAM A;  3SIG A;  3SII A;  3IID A;  3EWP A;  2X47 A;  1NJR A;  3KQX A;  4ETJ A;  4D86 A;  3VFQ A;  3EWR A;  2WCT A;  3Q6Z A;  1LAN A;  2J9A A;  3ETI A;  3EWO A;  3PEI A;  3SIJ A;  1TY8 A;  4R76 A;  4JVV A;  4K0C A;  3KQZ A;  3JZT A;  2BFQ A;  4IQY A;  4K3N A;  2VRI A;  2FG1 A;  3EKE A;  3EW5 A;  3GQE A;  5FSY A;  5AIL A;  3IIF A;  2EWB A;  2BFR A;  1BLL E;  1BPN A;  5FSX A;  4J5S A;  2ACF A;  4TU0 A;  2W2G A;  2XD7 A;  3IJ3 A;  4ZI6 A;  4ZYQ A;  5FSU A;  5D8N A;  4JLL A;  3SIH A;  2EEE A;  3GQO A;  4KSI A;  3JRU A;  4R6T A;  4R7M A;  4J5R A;  4ZX9 A;  5HIH A;  5CMS A;  4GVW A;  2KQV A;  3KZW A;  3GPQ A;  4UML A;  4X2T A;  1ZR3 A;  3H8F A;  3GPG A;  1GYT A;  2FXK A;  5CB3 A;  3KR5 A;  2RNK A;  4ETK A;  5CBM A;  1LAP A;  1BPM A;  5DUS A;  2L8R A;  4JGK A;  2JZF A;  1VHU A;  5FSZ A;  3V45 A;  4ESS A;  4GVV A;  5CB5 A;  1SPV A;  4JCA A;  2JZE A;  4ZY2 A;  5E3B A;  2JZD A; 
#chains in the Genus database with same CATH homology
 4J5Q A;  3EJF A;  3T8W A;  2AFC A;  1TXZ A;  3EJG A;  4J4Z A;  2LGR A;  2DX6 A;  4ZY0 A;  4ZX8 A;  3V2B A;  4ABK A;  5FSV A;  3KR4 A;  4ZY1 A;  4ABL A;  1YD9 A;  2FAV A;  3Q71 A;  5HOL A;  4KYB A;  3EWQ A;  4GUA A;  1LCP A;  1ZR5 A;  3GPO A;  3H8E A;  3H8G A;  1LAM A;  3SIG A;  3SII A;  3IID A;  3EWP A;  2X47 A;  1NJR A;  3KQX A;  4ETJ A;  4D86 A;  3VFQ A;  3EWR A;  3Q6Z A;  1LAN A;  2J9A A;  3ETI A;  3EWO A;  3PEI A;  3SIJ A;  1TY8 A;  4R76 A;  4JVV A;  4K0C A;  3KQZ A;  3JZT A;  2BFQ A;  4IQY A;  4K3N A;  2VRI A;  2FG1 A;  3EKE A;  3EW5 A;  3GQE A;  5FSY A;  5AIL A;  3IIF A;  2EWB A;  2BFR A;  1BLL E;  1BPN A;  5FSX A;  4J5S A;  2ACF A;  4TU0 A;  2XD7 A;  3IJ3 A;  4ZI6 A;  4ZYQ A;  5FSU A;  5D8N A;  4JLL A;  3SIH A;  2EEE A;  3GQO A;  4KSI A;  3JRU A;  4R6T A;  4R7M A;  4J5R A;  4ZX9 A;  5HIH A;  5CMS A;  4GVW A;  3KZW A;  3GPQ A;  4UML A;  4X2T A;  1ZR3 A;  3H8F A;  3GPG A;  1GYT A;  2FXK A;  5CB3 A;  3KR5 A;  4ETK A;  5CBM A;  1LAP A;  1BPM A;  5DUS A;  2L8R A;  4JGK A;  5FSZ A;  1VHU A;  3V45 A;  4ESS A;  4GVV A;  5CB5 A;  1SPV A;  4JCA A;  1HJZ A;  4ZY2 A;  5E3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...