4K0CA

Crystal structure of the computationally designed serine hydrolase. northeast structural genomics consortium (nesg) target or317
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
ARIRDVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTVPGAWVGGLPAEAVRRVMVEEIKKAPDTLEVTGVHGTEKSAEACRRARLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target OR317
rcsb
source organism Synthetic construct
molecule tags Structural genomics, unknown function
molecule keywords designed serine hydrolase
total genus 50
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4k0cA00
3EJFA 1SPVA 1LAMA 2XD7A 4UMLA 1TY8A 3Q71A 5HOLA 4TU0A 3SIJA 4ZX8A 4JLLA 5FSUA 1LCPA 2BFQA 2EEEA 2FAVA 1HJZA 1ZR5A 4GUAA 4K0CA 3SIIA 2L8RA 3H8FA 3PEIA 1BPMA 3EWPA 4KYBA 3H8EA 3SIGA 4ESSA 5CB3A 3JZTA 5D8NA 3V45A 4R76A 3SIHA 1BPNA 3KQZA 4X2TA 4J5RA 3EJGA 3GPOA 3EWQA 1ZR3A 4ZX9A 1LANA 5E3BA 2AFCA 4JGKA 3GPQA 3KR5A 4J4ZA 4ETKA 3GPGA 2BFRA 3IJ3A 5FSVA 4ZY2A 3KR4A 4J5SA 3JRUA 1LAPA 3GQEA 3EW5A 3GQOA 3H8GA 4ABKA 4IQYA 3ETIA 1YD9A 5DUSA 2ACFA 4ZI6A 3EWOA 4ZY1A 2X47A 5FSXA 5CMSA 3IIDA 2FG1A 3EKEA 4JCAA 2EWBA 4R7MA 1GYTA 2VRIA 1VHUA 4R6TA 5CB5A 3KZWA 1NJRA 2DX6A 5AILA 5FSYA 3VFQA 5FSZA 4ABLA 2J9AA 4ETJA 5CBMA 3T8WA 4D86A 4KSIA 3KQXA 3Q6ZA 1BLLE 4ZY0A 3EWRA 2LGRA 4JVVA 2FXKA 4GVVA 4K3NA 5HIHA 4GVWA 1TXZA 4J5QA 3IIFA 4ZYQA 3V2BA
chains in the Genus database with same CATH superfamily
3EJFA 1SPVA 1LAMA 2XD7A 4UMLA 1TY8A 3Q71A 5HOLA 4TU0A 3SIJA 4ZX8A 4JLLA 5FSUA 1LCPA 2BFQA 2EEEA 2FAVA 1HJZA 1ZR5A 4GUAA 4K0CA 3SIIA 2L8RA 3H8FA 3PEIA 1BPMA 3EWPA 4KYBA 3H8EA 3SIGA 4ESSA 5CB3A 2KQVA 3JZTA 5D8NA 3V45A 4R76A 3SIHA 1BPNA 3KQZA 4J5RA 4X2TA 3EJGA 3GPOA 3EWQA 1ZR3A 4ZX9A 1LANA 5E3BA 2AFCA 4JGKA 3GPQA 3KR5A 4J4ZA 4ETKA 3GPGA 2BFRA 3IJ3A 5FSVA 4ZY2A 3KR4A 4J5SA 3JRUA 1LAPA 3GQEA 3EW5A 3GQOA 2WCTA 3H8GA 4ABKA 4IQYA 3ETIA 1YD9A 5DUSA 2ACFA 4ZI6A 3EWOA 4ZY1A 2X47A 5FSXA 5CMSA 3IIDA 2FG1A 3EKEA 4JCAA 2EWBA 4R7MA 1GYTA 2VRIA 2JZFA 1VHUA 4R6TA 5CB5A 3KZWA 1NJRA 2W2GA 2DX6A 5AILA 5FSYA 3VFQA 5FSZA 4ABLA 2JZDA 2J9AA 4ETJA 5CBMA 3T8WA 4D86A 4KSIA 3KQXA 3Q6ZA 2RNKA 1BLLE 4ZY0A 3EWRA 2LGRA 4JVVA 2FXKA 4GVVA 2JZEA 4K3NA 5HIHA 4GVWA 1TXZA 4J5QA 3IIFA 4ZYQA 3V2BA
chains in the Genus database with same CATH topology
3EJFA 1SPVA 1LAMA 2XD7A 4UMLA 1TY8A 3Q71A 5HOLA 4TU0A 3SIJA 4ZX8A 4JLLA 5FSUA 1LCPA 2BFQA 2EEEA 2FAVA 1HJZA 1ZR5A 4GUAA 4K0CA 3SIIA 2L8RA 3H8FA 3PEIA 1BPMA 3EWPA 4KYBA 3H8EA 3SIGA 4ESSA 5CB3A 3JZTA 5D8NA 3V45A 4R76A 3SIHA 1BPNA 3KQZA 4X2TA 4J5RA 3EJGA 3GPOA 3EWQA 1ZR3A 4ZX9A 1LANA 5E3BA 2AFCA 4JGKA 3GPQA 3KR5A 4J4ZA 4ETKA 3GPGA 2BFRA 3IJ3A 5FSVA 4ZY2A 3KR4A 4J5SA 3JRUA 1LAPA 3GQEA 3EW5A 3GQOA 3H8GA 4ABKA 4IQYA 3ETIA 1YD9A 5DUSA 2ACFA 4ZI6A 3EWOA 4ZY1A 2X47A 5FSXA 5CMSA 3IIDA 2FG1A 3EKEA 4JCAA 2EWBA 4R7MA 1GYTA 2VRIA 1VHUA 4R6TA 5CB5A 3KZWA 1NJRA 2DX6A 5AILA 5FSYA 3VFQA 5FSZA 4ABLA 2J9AA 4ETJA 5CBMA 3T8WA 4D86A 4KSIA 3KQXA 3Q6ZA 1BLLE 4ZY0A 3EWRA 2LGRA 4JVVA 2FXKA 4GVVA 4K3NA 5HIHA 4GVWA 1TXZA 4J5QA 3IIFA 4ZYQA 3V2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJF A;  1SPV A;  1LAM A;  2XD7 A;  4UML A;  1TY8 A;  3Q71 A;  5HOL A;  4TU0 A;  3SIJ A;  4ZX8 A;  4JLL A;  5FSU A;  1LCP A;  2BFQ A;  2EEE A;  2FAV A;  1HJZ A;  1ZR5 A;  4GUA A;  4K0C A;  3SII A;  2L8R A;  3H8F A;  3PEI A;  1BPM A;  3EWP A;  4KYB A;  3H8E A;  3SIG A;  4ESS A;  5CB3 A;  3JZT A;  5D8N A;  3V45 A;  4R76 A;  3SIH A;  1BPN A;  3KQZ A;  4X2T A;  4J5R A;  3EJG A;  3GPO A;  3EWQ A;  1ZR3 A;  4ZX9 A;  1LAN A;  5E3B A;  2AFC A;  4JGK A;  3GPQ A;  3KR5 A;  4J4Z A;  4ETK A;  3GPG A;  2BFR A;  3IJ3 A;  5FSV A;  4ZY2 A;  3KR4 A;  4J5S A;  3JRU A;  1LAP A;  3GQE A;  3EW5 A;  3GQO A;  3H8G A;  4ABK A;  4IQY A;  3ETI A;  1YD9 A;  5DUS A;  2ACF A;  4ZI6 A;  3EWO A;  4ZY1 A;  2X47 A;  5FSX A;  5CMS A;  3IID A;  2FG1 A;  3EKE A;  4JCA A;  2EWB A;  4R7M A;  1GYT A;  2VRI A;  1VHU A;  4R6T A;  5CB5 A;  3KZW A;  1NJR A;  2DX6 A;  5AIL A;  5FSY A;  3VFQ A;  5FSZ A;  4ABL A;  2J9A A;  4ETJ A;  5CBM A;  3T8W A;  4D86 A;  4KSI A;  3KQX A;  3Q6Z A;  1BLL E;  4ZY0 A;  3EWR A;  2LGR A;  4JVV A;  2FXK A;  4GVV A;  4K3N A;  5HIH A;  4GVW A;  1TXZ A;  4J5Q A;  3IIF A;  4ZYQ A;  3V2B A; 
#chains in the Genus database with same CATH topology
 3EJF A;  1SPV A;  1LAM A;  2XD7 A;  4UML A;  1TY8 A;  3Q71 A;  5HOL A;  4TU0 A;  3SIJ A;  4ZX8 A;  4JLL A;  5FSU A;  1LCP A;  2BFQ A;  2EEE A;  2FAV A;  1HJZ A;  1ZR5 A;  4GUA A;  4K0C A;  3SII A;  2L8R A;  3H8F A;  3PEI A;  1BPM A;  3EWP A;  4KYB A;  3H8E A;  3SIG A;  4ESS A;  5CB3 A;  2KQV A;  3JZT A;  5D8N A;  3V45 A;  4R76 A;  3SIH A;  1BPN A;  3KQZ A;  4J5R A;  4X2T A;  3EJG A;  3GPO A;  3EWQ A;  1ZR3 A;  4ZX9 A;  1LAN A;  5E3B A;  2AFC A;  4JGK A;  3GPQ A;  3KR5 A;  4J4Z A;  4ETK A;  3GPG A;  2BFR A;  3IJ3 A;  5FSV A;  4ZY2 A;  3KR4 A;  4J5S A;  3JRU A;  1LAP A;  3GQE A;  3EW5 A;  3GQO A;  2WCT A;  3H8G A;  4ABK A;  4IQY A;  3ETI A;  1YD9 A;  5DUS A;  2ACF A;  4ZI6 A;  3EWO A;  4ZY1 A;  2X47 A;  5FSX A;  5CMS A;  3IID A;  2FG1 A;  3EKE A;  4JCA A;  2EWB A;  4R7M A;  1GYT A;  2VRI A;  2JZF A;  1VHU A;  4R6T A;  5CB5 A;  3KZW A;  1NJR A;  2W2G A;  2DX6 A;  5AIL A;  5FSY A;  3VFQ A;  5FSZ A;  4ABL A;  2JZD A;  2J9A A;  4ETJ A;  5CBM A;  3T8W A;  4D86 A;  4KSI A;  3KQX A;  3Q6Z A;  2RNK A;  1BLL E;  4ZY0 A;  3EWR A;  2LGR A;  4JVV A;  2FXK A;  4GVV A;  2JZE A;  4K3N A;  5HIH A;  4GVW A;  1TXZ A;  4J5Q A;  3IIF A;  4ZYQ A;  3V2B A; 
#chains in the Genus database with same CATH homology
 3EJF A;  1SPV A;  1LAM A;  2XD7 A;  4UML A;  1TY8 A;  3Q71 A;  5HOL A;  4TU0 A;  3SIJ A;  4ZX8 A;  4JLL A;  5FSU A;  1LCP A;  2BFQ A;  2EEE A;  2FAV A;  1HJZ A;  1ZR5 A;  4GUA A;  4K0C A;  3SII A;  2L8R A;  3H8F A;  3PEI A;  1BPM A;  3EWP A;  4KYB A;  3H8E A;  3SIG A;  4ESS A;  5CB3 A;  3JZT A;  5D8N A;  3V45 A;  4R76 A;  3SIH A;  1BPN A;  3KQZ A;  4X2T A;  4J5R A;  3EJG A;  3GPO A;  3EWQ A;  1ZR3 A;  4ZX9 A;  1LAN A;  5E3B A;  2AFC A;  4JGK A;  3GPQ A;  3KR5 A;  4J4Z A;  4ETK A;  3GPG A;  2BFR A;  3IJ3 A;  5FSV A;  4ZY2 A;  3KR4 A;  4J5S A;  3JRU A;  1LAP A;  3GQE A;  3EW5 A;  3GQO A;  3H8G A;  4ABK A;  4IQY A;  3ETI A;  1YD9 A;  5DUS A;  2ACF A;  4ZI6 A;  3EWO A;  4ZY1 A;  2X47 A;  5FSX A;  5CMS A;  3IID A;  2FG1 A;  3EKE A;  4JCA A;  2EWB A;  4R7M A;  1GYT A;  2VRI A;  1VHU A;  4R6T A;  5CB5 A;  3KZW A;  1NJR A;  2DX6 A;  5AIL A;  5FSY A;  3VFQ A;  5FSZ A;  4ABL A;  2J9A A;  4ETJ A;  5CBM A;  3T8W A;  4D86 A;  4KSI A;  3KQX A;  3Q6Z A;  1BLL E;  4ZY0 A;  3EWR A;  2LGR A;  4JVV A;  2FXK A;  4GVV A;  4K3N A;  5HIH A;  4GVW A;  1TXZ A;  4J5Q A;  3IIF A;  4ZYQ A;  3V2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...