3ETIA

Structure of a cubic crystal form of x (adrp) domain from fcov
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
DLILPFYKAGKVSFYQGDLDVLINFLEPDVLVNAANGDLRHVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFENVLEHLSVMNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIFKVKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the X (ADRP) domain of nsp3 from feline coronavirus
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Rna binding protein
molecule keywords macro domain of Non-structural protein 3
total genus 52
structure length 168
sequence length 168
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3etiA00
2EWBA 1NJRA 3GPOA 3KR5A 3IIFA 3V2BA 3KQXA 5CMSA 3IIDA 4UMLA 4R7MA 3KQZA 2BFQA 4J4ZA 3SIJA 3JZTA 4GVWA 4ZYQA 5FSXA 1TXZA 4IQYA 5AILA 1HJZA 5FSUA 3ETIA 2EEEA 1LANA 3IJ3A 4R76A 2L8RA 2FAVA 4J5QA 5D8NA 5FSVA 4ZI6A 3PEIA 1GYTA 5CBMA 4K3NA 2FG1A 1YD9A 3T8WA 2ACFA 5CB3A 2DX6A 3SIGA 2J9AA 4ZY0A 3EJFA 4JLLA 1BLLE 3EJGA 2LGRA 3SIIA 4ETKA 4TU0A 5E3BA 3H8GA 2AFCA 5HOLA 2VRIA 4KYBA 4X2TA 1LAPA 3H8FA 3EWOA 4ABLA 3EWQA 5CB5A 4ZX8A 4ZY1A 4K0CA 4D86A 1VHUA 3KR4A 1ZR3A 1LCPA 1SPVA 3GPGA 1LAMA 1TY8A 3VFQA 3GQOA 4J5RA 4R6TA 5HIHA 3GPQA 3EKEA 3EW5A 5DUSA 3SIHA 4ZX9A 4KSIA 3V45A 3GQEA 3JRUA 3H8EA 4ZY2A 4ABKA 3EWRA 4GUAA 4GVVA 3Q6ZA 2XD7A 4JGKA 5FSZA 2X47A 2FXKA 4JCAA 1BPNA 3KZWA 5FSYA 4JVVA 1ZR5A 3Q71A 4ESSA 4ETJA 2BFRA 3EWPA 4J5SA 1BPMA
chains in the Genus database with same CATH superfamily
2JZEA 2EWBA 2JZDA 1NJRA 3GPOA 3KR5A 3IIFA 3V2BA 3KQXA 5CMSA 3IIDA 2KQVA 4UMLA 4R7MA 3KQZA 2BFQA 4J4ZA 3SIJA 3JZTA 4GVWA 4ZYQA 5FSXA 1TXZA 4IQYA 5AILA 1HJZA 5FSUA 3ETIA 2EEEA 1LANA 3IJ3A 4R76A 2L8RA 2FAVA 4J5QA 5D8NA 5FSVA 4ZI6A 3PEIA 1GYTA 5CBMA 4K3NA 2FG1A 1YD9A 3T8WA 2ACFA 5CB3A 2DX6A 3SIGA 2J9AA 4ZY0A 3EJFA 4JLLA 1BLLE 3EJGA 2LGRA 3SIIA 4ETKA 4TU0A 5E3BA 3H8GA 2AFCA 5HOLA 2VRIA 4KYBA 4X2TA 1LAPA 3H8FA 3EWOA 4ABLA 3EWQA 5CB5A 4ZX8A 4ZY1A 4K0CA 4D86A 1VHUA 3KR4A 1ZR3A 1LCPA 1SPVA 3GPGA 1LAMA 1TY8A 3VFQA 3GQOA 4J5RA 4R6TA 5HIHA 3GPQA 3EKEA 3EW5A 5DUSA 3SIHA 4ZX9A 4KSIA 3V45A 3GQEA 3JRUA 3H8EA 4ZY2A 4ABKA 3EWRA 4GUAA 4GVVA 3Q6ZA 2XD7A 4JGKA 5FSZA 2X47A 2FXKA 2JZFA 2RNKA 4JCAA 1BPNA 3KZWA 5FSYA 2WCTA 4JVVA 1ZR5A 2W2GA 3Q71A 4ESSA 4ETJA 2BFRA 3EWPA 4J5SA 1BPMA
chains in the Genus database with same CATH topology
2EWBA 1NJRA 3GPOA 3KR5A 3IIFA 3V2BA 3KQXA 5CMSA 3IIDA 4UMLA 4R7MA 3KQZA 2BFQA 4J4ZA 3SIJA 3JZTA 4GVWA 4ZYQA 5FSXA 1TXZA 4IQYA 5AILA 1HJZA 5FSUA 3ETIA 2EEEA 1LANA 3IJ3A 4R76A 2L8RA 2FAVA 4J5QA 5D8NA 5FSVA 4ZI6A 3PEIA 1GYTA 5CBMA 4K3NA 2FG1A 1YD9A 3T8WA 2ACFA 5CB3A 2DX6A 3SIGA 2J9AA 4ZY0A 3EJFA 4JLLA 1BLLE 3EJGA 2LGRA 3SIIA 4ETKA 4TU0A 5E3BA 3H8GA 2AFCA 5HOLA 2VRIA 4KYBA 4X2TA 1LAPA 3H8FA 3EWOA 4ABLA 3EWQA 5CB5A 4ZX8A 4ZY1A 4K0CA 4D86A 1VHUA 3KR4A 1ZR3A 1LCPA 1SPVA 3GPGA 1LAMA 1TY8A 3VFQA 3GQOA 4J5RA 4R6TA 5HIHA 3GPQA 3EKEA 3EW5A 5DUSA 3SIHA 4ZX9A 4KSIA 3V45A 3GQEA 3JRUA 3H8EA 4ZY2A 4ABKA 3EWRA 4GUAA 4GVVA 3Q6ZA 2XD7A 4JGKA 5FSZA 2X47A 2FXKA 4JCAA 1BPNA 3KZWA 5FSYA 4JVVA 1ZR5A 3Q71A 4ESSA 4ETJA 2BFRA 3EWPA 4J5SA 1BPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWB A;  1NJR A;  3GPO A;  3KR5 A;  3IIF A;  3V2B A;  3KQX A;  5CMS A;  3IID A;  4UML A;  4R7M A;  3KQZ A;  2BFQ A;  4J4Z A;  3SIJ A;  3JZT A;  4GVW A;  4ZYQ A;  5FSX A;  1TXZ A;  4IQY A;  5AIL A;  1HJZ A;  5FSU A;  3ETI A;  2EEE A;  1LAN A;  3IJ3 A;  4R76 A;  2L8R A;  2FAV A;  4J5Q A;  5D8N A;  5FSV A;  4ZI6 A;  3PEI A;  1GYT A;  5CBM A;  4K3N A;  2FG1 A;  1YD9 A;  3T8W A;  2ACF A;  5CB3 A;  2DX6 A;  3SIG A;  2J9A A;  4ZY0 A;  3EJF A;  4JLL A;  1BLL E;  3EJG A;  2LGR A;  3SII A;  4ETK A;  4TU0 A;  5E3B A;  3H8G A;  2AFC A;  5HOL A;  2VRI A;  4KYB A;  4X2T A;  1LAP A;  3H8F A;  3EWO A;  4ABL A;  3EWQ A;  5CB5 A;  4ZX8 A;  4ZY1 A;  4K0C A;  4D86 A;  1VHU A;  3KR4 A;  1ZR3 A;  1LCP A;  1SPV A;  3GPG A;  1LAM A;  1TY8 A;  3VFQ A;  3GQO A;  4J5R A;  4R6T A;  5HIH A;  3GPQ A;  3EKE A;  3EW5 A;  5DUS A;  3SIH A;  4ZX9 A;  4KSI A;  3V45 A;  3GQE A;  3JRU A;  3H8E A;  4ZY2 A;  4ABK A;  3EWR A;  4GUA A;  4GVV A;  3Q6Z A;  2XD7 A;  4JGK A;  5FSZ A;  2X47 A;  2FXK A;  4JCA A;  1BPN A;  3KZW A;  5FSY A;  4JVV A;  1ZR5 A;  3Q71 A;  4ESS A;  4ETJ A;  2BFR A;  3EWP A;  4J5S A;  1BPM A; 
#chains in the Genus database with same CATH topology
 2JZE A;  2EWB A;  2JZD A;  1NJR A;  3GPO A;  3KR5 A;  3IIF A;  3V2B A;  3KQX A;  5CMS A;  3IID A;  2KQV A;  4UML A;  4R7M A;  3KQZ A;  2BFQ A;  4J4Z A;  3SIJ A;  3JZT A;  4GVW A;  4ZYQ A;  5FSX A;  1TXZ A;  4IQY A;  5AIL A;  1HJZ A;  5FSU A;  3ETI A;  2EEE A;  1LAN A;  3IJ3 A;  4R76 A;  2L8R A;  2FAV A;  4J5Q A;  5D8N A;  5FSV A;  4ZI6 A;  3PEI A;  1GYT A;  5CBM A;  4K3N A;  2FG1 A;  1YD9 A;  3T8W A;  2ACF A;  5CB3 A;  2DX6 A;  3SIG A;  2J9A A;  4ZY0 A;  3EJF A;  4JLL A;  1BLL E;  3EJG A;  2LGR A;  3SII A;  4ETK A;  4TU0 A;  5E3B A;  3H8G A;  2AFC A;  5HOL A;  2VRI A;  4KYB A;  4X2T A;  1LAP A;  3H8F A;  3EWO A;  4ABL A;  3EWQ A;  5CB5 A;  4ZX8 A;  4ZY1 A;  4K0C A;  4D86 A;  1VHU A;  3KR4 A;  1ZR3 A;  1LCP A;  1SPV A;  3GPG A;  1LAM A;  1TY8 A;  3VFQ A;  3GQO A;  4J5R A;  4R6T A;  5HIH A;  3GPQ A;  3EKE A;  3EW5 A;  5DUS A;  3SIH A;  4ZX9 A;  4KSI A;  3V45 A;  3GQE A;  3JRU A;  3H8E A;  4ZY2 A;  4ABK A;  3EWR A;  4GUA A;  4GVV A;  3Q6Z A;  2XD7 A;  4JGK A;  5FSZ A;  2X47 A;  2FXK A;  2JZF A;  2RNK A;  4JCA A;  1BPN A;  3KZW A;  5FSY A;  2WCT A;  4JVV A;  1ZR5 A;  2W2G A;  3Q71 A;  4ESS A;  4ETJ A;  2BFR A;  3EWP A;  4J5S A;  1BPM A; 
#chains in the Genus database with same CATH homology
 2EWB A;  1NJR A;  3GPO A;  3KR5 A;  3IIF A;  3V2B A;  3KQX A;  5CMS A;  3IID A;  4UML A;  4R7M A;  3KQZ A;  2BFQ A;  4J4Z A;  3SIJ A;  3JZT A;  4GVW A;  4ZYQ A;  5FSX A;  1TXZ A;  4IQY A;  5AIL A;  1HJZ A;  5FSU A;  3ETI A;  2EEE A;  1LAN A;  3IJ3 A;  4R76 A;  2L8R A;  2FAV A;  4J5Q A;  5D8N A;  5FSV A;  4ZI6 A;  3PEI A;  1GYT A;  5CBM A;  4K3N A;  2FG1 A;  1YD9 A;  3T8W A;  2ACF A;  5CB3 A;  2DX6 A;  3SIG A;  2J9A A;  4ZY0 A;  3EJF A;  4JLL A;  1BLL E;  3EJG A;  2LGR A;  3SII A;  4ETK A;  4TU0 A;  5E3B A;  3H8G A;  2AFC A;  5HOL A;  2VRI A;  4KYB A;  4X2T A;  1LAP A;  3H8F A;  3EWO A;  4ABL A;  3EWQ A;  5CB5 A;  4ZX8 A;  4ZY1 A;  4K0C A;  4D86 A;  1VHU A;  3KR4 A;  1ZR3 A;  1LCP A;  1SPV A;  3GPG A;  1LAM A;  1TY8 A;  3VFQ A;  3GQO A;  4J5R A;  4R6T A;  5HIH A;  3GPQ A;  3EKE A;  3EW5 A;  5DUS A;  3SIH A;  4ZX9 A;  4KSI A;  3V45 A;  3GQE A;  3JRU A;  3H8E A;  4ZY2 A;  4ABK A;  3EWR A;  4GUA A;  4GVV A;  3Q6Z A;  2XD7 A;  4JGK A;  5FSZ A;  2X47 A;  2FXK A;  4JCA A;  1BPN A;  3KZW A;  5FSY A;  4JVV A;  1ZR5 A;  3Q71 A;  4ESS A;  4ETJ A;  2BFR A;  3EWP A;  4J5S A;  1BPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...