3ETIA

Structure of a cubic crystal form of x (adrp) domain from fcov
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
DLILPFYKAGKVSFYQGDLDVLINFLEPDVLVNAANGDLRHVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFENVLEHLSVMNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIFKVKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the X (ADRP) domain of nsp3 from feline coronavirus
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Rna binding protein
molecule keywords macro domain of Non-structural protein 3
total genus 52
structure length 168
sequence length 168
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3etiA00
4UMLA 1YD9A 4ZX8A 4R6TA 2EEEA 4GVWA 3V2BA 3EWOA 4ESSA 4JVVA 4D86A 1TY8A 1ZR3A 5FSXA 1GYTA 5CB5A 4ZI6A 3JRUA 5AILA 3KR4A 4ZY2A 1SPVA 4K0CA 2FAVA 1TXZA 3GQOA 2EWBA 3H8EA 5DUSA 2AFCA 4X2TA 5FSYA 3EWRA 3GPGA 1LCPA 4ETJA 4J4ZA 3KR5A 3SIJA 4ABLA 1BPNA 4R76A 4J5SA 3SIHA 4J5QA 2VRIA 4R7MA 3VFQA 4ZY0A 1ZR5A 3ETIA 4ZYQA 5FSUA 2ACFA 5FSVA 4IQYA 4ZY1A 3PEIA 1LAPA 3T8WA 5HIHA 2BFRA 3GPQA 1BLLE 3V45A 2DX6A 5CBMA 4KYBA 4J5RA 3IJ3A 4GVVA 3EWQA 1HJZA 3Q6ZA 2X47A 3GPOA 2J9AA 1VHUA 4JCAA 3JZTA 3Q71A 3EJFA 1NJRA 3H8FA 3H8GA 2FG1A 3GQEA 1BPMA 4K3NA 3IIDA 4JGKA 4KSIA 2BFQA 4ETKA 3KZWA 4GUAA 4JLLA 3EKEA 1LAMA 5E3BA 2FXKA 2XD7A 1LANA 3EWPA 4ZX9A 3KQXA 3SIIA 3SIGA 3EJGA 5CMSA 5D8NA 2LGRA 5HOLA 2L8RA 3IIFA 3KQZA 5FSZA 4TU0A 3EW5A 5CB3A 4ABKA
chains in the Genus database with same CATH superfamily
4UMLA 1YD9A 4ZX8A 4R6TA 2EEEA 4GVWA 3V2BA 3EWOA 4ESSA 4JVVA 2WCTA 4D86A 1TY8A 1ZR3A 5FSXA 1GYTA 5CB5A 4ZI6A 3JRUA 5AILA 3KR4A 4ZY2A 1SPVA 4K0CA 2FAVA 1TXZA 3GQOA 2EWBA 3H8EA 5DUSA 2AFCA 4X2TA 5FSYA 3EWRA 3GPGA 2JZEA 1LCPA 4ETJA 4J4ZA 3KR5A 3SIJA 4ABLA 1BPNA 2JZFA 4R76A 4J5SA 3SIHA 4J5QA 2W2GA 2VRIA 4R7MA 3VFQA 4ZY0A 1ZR5A 3ETIA 4ZYQA 5FSUA 2ACFA 5FSVA 4IQYA 4ZY1A 3PEIA 1LAPA 3T8WA 5HIHA 2BFRA 3GPQA 1BLLE 3V45A 2DX6A 5CBMA 4KYBA 4J5RA 3IJ3A 4GVVA 3EWQA 1HJZA 3Q6ZA 2X47A 2KQVA 3GPOA 2RNKA 2J9AA 1VHUA 4JCAA 3JZTA 2JZDA 3Q71A 3EJFA 1NJRA 3H8FA 3H8GA 2FG1A 3GQEA 1BPMA 4K3NA 3IIDA 4JGKA 4KSIA 2BFQA 4ETKA 3KZWA 4GUAA 4JLLA 3EKEA 1LAMA 5E3BA 2FXKA 2XD7A 1LANA 3EWPA 4ZX9A 3KQXA 3SIIA 3SIGA 3EJGA 5CMSA 5D8NA 2LGRA 5HOLA 2L8RA 3IIFA 3KQZA 5FSZA 4TU0A 3EW5A 5CB3A 4ABKA
chains in the Genus database with same CATH topology
4UMLA 1YD9A 4ZX8A 4R6TA 2EEEA 4GVWA 3V2BA 3EWOA 4ESSA 4JVVA 4D86A 1TY8A 1ZR3A 5FSXA 1GYTA 5CB5A 4ZI6A 3JRUA 5AILA 3KR4A 4ZY2A 1SPVA 4K0CA 2FAVA 1TXZA 3GQOA 2EWBA 3H8EA 5DUSA 2AFCA 4X2TA 5FSYA 3EWRA 3GPGA 1LCPA 4ETJA 4J4ZA 3KR5A 3SIJA 4ABLA 1BPNA 4R76A 4J5SA 3SIHA 4J5QA 2VRIA 4R7MA 3VFQA 4ZY0A 1ZR5A 3ETIA 4ZYQA 5FSUA 2ACFA 5FSVA 4IQYA 4ZY1A 3PEIA 1LAPA 3T8WA 5HIHA 2BFRA 3GPQA 1BLLE 3V45A 2DX6A 5CBMA 4KYBA 4J5RA 3IJ3A 4GVVA 3EWQA 1HJZA 3Q6ZA 2X47A 3GPOA 2J9AA 1VHUA 4JCAA 3JZTA 3Q71A 3EJFA 1NJRA 3H8FA 3H8GA 2FG1A 3GQEA 1BPMA 4K3NA 3IIDA 4JGKA 4KSIA 2BFQA 4ETKA 3KZWA 4GUAA 4JLLA 3EKEA 1LAMA 5E3BA 2FXKA 2XD7A 1LANA 3EWPA 4ZX9A 3KQXA 3SIIA 3SIGA 3EJGA 5CMSA 5D8NA 2LGRA 5HOLA 2L8RA 3IIFA 3KQZA 5FSZA 4TU0A 3EW5A 5CB3A 4ABKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UML A;  1YD9 A;  4ZX8 A;  4R6T A;  2EEE A;  4GVW A;  3V2B A;  3EWO A;  4ESS A;  4JVV A;  4D86 A;  1TY8 A;  1ZR3 A;  5FSX A;  1GYT A;  5CB5 A;  4ZI6 A;  3JRU A;  5AIL A;  3KR4 A;  4ZY2 A;  1SPV A;  4K0C A;  2FAV A;  1TXZ A;  3GQO A;  2EWB A;  3H8E A;  5DUS A;  2AFC A;  4X2T A;  5FSY A;  3EWR A;  3GPG A;  1LCP A;  4ETJ A;  4J4Z A;  3KR5 A;  3SIJ A;  4ABL A;  1BPN A;  4R76 A;  4J5S A;  3SIH A;  4J5Q A;  2VRI A;  4R7M A;  3VFQ A;  4ZY0 A;  1ZR5 A;  3ETI A;  4ZYQ A;  5FSU A;  2ACF A;  5FSV A;  4IQY A;  4ZY1 A;  3PEI A;  1LAP A;  3T8W A;  5HIH A;  2BFR A;  3GPQ A;  1BLL E;  3V45 A;  2DX6 A;  5CBM A;  4KYB A;  4J5R A;  3IJ3 A;  4GVV A;  3EWQ A;  1HJZ A;  3Q6Z A;  2X47 A;  3GPO A;  2J9A A;  1VHU A;  4JCA A;  3JZT A;  3Q71 A;  3EJF A;  1NJR A;  3H8F A;  3H8G A;  2FG1 A;  3GQE A;  1BPM A;  4K3N A;  3IID A;  4JGK A;  4KSI A;  2BFQ A;  4ETK A;  3KZW A;  4GUA A;  4JLL A;  3EKE A;  1LAM A;  5E3B A;  2FXK A;  2XD7 A;  1LAN A;  3EWP A;  4ZX9 A;  3KQX A;  3SII A;  3SIG A;  3EJG A;  5CMS A;  5D8N A;  2LGR A;  5HOL A;  2L8R A;  3IIF A;  3KQZ A;  5FSZ A;  4TU0 A;  3EW5 A;  5CB3 A;  4ABK A; 
#chains in the Genus database with same CATH topology
 4UML A;  1YD9 A;  4ZX8 A;  4R6T A;  2EEE A;  4GVW A;  3V2B A;  3EWO A;  4ESS A;  4JVV A;  2WCT A;  4D86 A;  1TY8 A;  1ZR3 A;  5FSX A;  1GYT A;  5CB5 A;  4ZI6 A;  3JRU A;  5AIL A;  3KR4 A;  4ZY2 A;  1SPV A;  4K0C A;  2FAV A;  1TXZ A;  3GQO A;  2EWB A;  3H8E A;  5DUS A;  2AFC A;  4X2T A;  5FSY A;  3EWR A;  3GPG A;  2JZE A;  1LCP A;  4ETJ A;  4J4Z A;  3KR5 A;  3SIJ A;  4ABL A;  1BPN A;  2JZF A;  4R76 A;  4J5S A;  3SIH A;  4J5Q A;  2W2G A;  2VRI A;  4R7M A;  3VFQ A;  4ZY0 A;  1ZR5 A;  3ETI A;  4ZYQ A;  5FSU A;  2ACF A;  5FSV A;  4IQY A;  4ZY1 A;  3PEI A;  1LAP A;  3T8W A;  5HIH A;  2BFR A;  3GPQ A;  1BLL E;  3V45 A;  2DX6 A;  5CBM A;  4KYB A;  4J5R A;  3IJ3 A;  4GVV A;  3EWQ A;  1HJZ A;  3Q6Z A;  2X47 A;  2KQV A;  3GPO A;  2RNK A;  2J9A A;  1VHU A;  4JCA A;  3JZT A;  2JZD A;  3Q71 A;  3EJF A;  1NJR A;  3H8F A;  3H8G A;  2FG1 A;  3GQE A;  1BPM A;  4K3N A;  3IID A;  4JGK A;  4KSI A;  2BFQ A;  4ETK A;  3KZW A;  4GUA A;  4JLL A;  3EKE A;  1LAM A;  5E3B A;  2FXK A;  2XD7 A;  1LAN A;  3EWP A;  4ZX9 A;  3KQX A;  3SII A;  3SIG A;  3EJG A;  5CMS A;  5D8N A;  2LGR A;  5HOL A;  2L8R A;  3IIF A;  3KQZ A;  5FSZ A;  4TU0 A;  3EW5 A;  5CB3 A;  4ABK A; 
#chains in the Genus database with same CATH homology
 4UML A;  1YD9 A;  4ZX8 A;  4R6T A;  2EEE A;  4GVW A;  3V2B A;  3EWO A;  4ESS A;  4JVV A;  4D86 A;  1TY8 A;  1ZR3 A;  5FSX A;  1GYT A;  5CB5 A;  4ZI6 A;  3JRU A;  5AIL A;  3KR4 A;  4ZY2 A;  1SPV A;  4K0C A;  2FAV A;  1TXZ A;  3GQO A;  2EWB A;  3H8E A;  5DUS A;  2AFC A;  4X2T A;  5FSY A;  3EWR A;  3GPG A;  1LCP A;  4ETJ A;  4J4Z A;  3KR5 A;  3SIJ A;  4ABL A;  1BPN A;  4R76 A;  4J5S A;  3SIH A;  4J5Q A;  2VRI A;  4R7M A;  3VFQ A;  4ZY0 A;  1ZR5 A;  3ETI A;  4ZYQ A;  5FSU A;  2ACF A;  5FSV A;  4IQY A;  4ZY1 A;  3PEI A;  1LAP A;  3T8W A;  5HIH A;  2BFR A;  3GPQ A;  1BLL E;  3V45 A;  2DX6 A;  5CBM A;  4KYB A;  4J5R A;  3IJ3 A;  4GVV A;  3EWQ A;  1HJZ A;  3Q6Z A;  2X47 A;  3GPO A;  2J9A A;  1VHU A;  4JCA A;  3JZT A;  3Q71 A;  3EJF A;  1NJR A;  3H8F A;  3H8G A;  2FG1 A;  3GQE A;  1BPM A;  4K3N A;  3IID A;  4JGK A;  4KSI A;  2BFQ A;  4ETK A;  3KZW A;  4GUA A;  4JLL A;  3EKE A;  1LAM A;  5E3B A;  2FXK A;  2XD7 A;  1LAN A;  3EWP A;  4ZX9 A;  3KQX A;  3SII A;  3SIG A;  3EJG A;  5CMS A;  5D8N A;  2LGR A;  5HOL A;  2L8R A;  3IIF A;  3KQZ A;  5FSZ A;  4TU0 A;  3EW5 A;  5CB3 A;  4ABK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...