3ETIA

Structure of a cubic crystal form of x (adrp) domain from fcov
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
168
structure length
168
Chain Sequence
DLILPFYKAGKVSFYQGDLDVLINFLEPDVLVNAANGDLRHVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFENVLEHLSVMNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIFKVKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords macro domain of Non-structural protein 3
publication title Structure of the X (ADRP) domain of nsp3 from feline coronavirus
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Rna binding protein
total genus 52
structure length 168
sequence length 168
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3etiA00
1TY8A 5D8NA 2LGRA 5FSZA 4ESSA 5CB5A 3IJ3A 1NJRA 1LAMA 3ETIA 5HIHA 3JZTA 3PEIA 4ETKA 1LCPA 2J9AA 3EJFA 4ZY0A 2XD7A 3GPOA 4GVWA 2DX6A 2VRIA 3H8GA 3Q71A 4ABLA 5FSYA 3IIFA 2FG1A 1YD9A 1TXZA 1HJZA 5FSXA 3KR4A 4J5QA 5E3BA 3V45A 4ZY2A 3EJGA 4JGKA 1BLLE 3EWPA 1GYTA 1LANA 4X2TA 3SIGA 5CBMA 4R6TA 3KZWA 3GPQA 3SIJA 4J5RA 3GPGA 4ZY1A 3H8EA 3KQXA 4KSIA 4GVVA 3VFQA 2EEEA 3Q6ZA 4K3NA 4ZX8A 3KR5A 3EWOA 3SIHA 4D86A 2FXKA 2FAVA 4JVVA 3EWQA 3H8FA 3KQZA 4ZI6A 3IIDA 2BFRA 4JCAA 2EWBA 3EKEA 4TU0A 5FSVA 5DUSA 4J4ZA 3GQEA 3V2BA 2X47A 3SIIA 1SPVA 1VHUA 2ACFA 4R76A 5CB3A 3EW5A 4K0CA 4UMLA 4KYBA 4ZX9A 4J5SA 5FSUA 2BFQA 4IQYA 2AFCA 2L8RA 5HOLA 5CMSA 1BPNA 5AILA 3GQOA 4ETJA 4ABKA 1BPMA 4ZYQA 4R7MA 3T8WA 4GUAA 4JLLA 3EWRA 1LAPA 1ZR5A 3JRUA 1ZR3A
chains in the Genus database with same CATH superfamily
1TY8A 5D8NA 2LGRA 5FSZA 4ESSA 5CB5A 3IJ3A 1NJRA 2RNKA 1LAMA 3ETIA 5HIHA 3JZTA 3PEIA 4ETKA 1LCPA 2J9AA 3EJFA 4ZY0A 2XD7A 3GPOA 4GVWA 2DX6A 2VRIA 2W2GA 3H8GA 3Q71A 4ABLA 5FSYA 3IIFA 2FG1A 1YD9A 1TXZA 1HJZA 5FSXA 3KR4A 4J5QA 5E3BA 3V45A 4ZY2A 3EJGA 4JGKA 1BLLE 3EWPA 1GYTA 1LANA 4X2TA 3SIGA 5CBMA 4R6TA 3KZWA 3GPQA 3SIJA 4J5RA 3GPGA 4ZY1A 3H8EA 3KQXA 4KSIA 4GVVA 3VFQA 2EEEA 3Q6ZA 4K3NA 4ZX8A 3KR5A 3EWOA 3SIHA 4D86A 2FXKA 2FAVA 4JVVA 3EWQA 3H8FA 3KQZA 4ZI6A 3IIDA 2BFRA 4JCAA 2EWBA 3EKEA 4TU0A 5FSVA 5DUSA 4J4ZA 3GQEA 3V2BA 2X47A 2JZEA 3SIIA 1SPVA 1VHUA 2KQVA 2ACFA 4R76A 5CB3A 3EW5A 4K0CA 4UMLA 4KYBA 4ZX9A 4J5SA 5FSUA 2BFQA 4IQYA 2AFCA 2L8RA 2JZDA 5HOLA 5CMSA 1BPNA 5AILA 2JZFA 2WCTA 3GQOA 4ETJA 4ABKA 1BPMA 4ZYQA 4R7MA 3T8WA 4GUAA 4JLLA 3EWRA 1LAPA 1ZR5A 3JRUA 1ZR3A
chains in the Genus database with same CATH topology
1TY8A 5D8NA 2LGRA 5FSZA 4ESSA 5CB5A 3IJ3A 1NJRA 1LAMA 3ETIA 5HIHA 3JZTA 3PEIA 4ETKA 1LCPA 2J9AA 3EJFA 4ZY0A 2XD7A 3GPOA 4GVWA 2DX6A 2VRIA 3H8GA 3Q71A 4ABLA 5FSYA 3IIFA 2FG1A 1YD9A 1TXZA 1HJZA 5FSXA 3KR4A 4J5QA 5E3BA 3V45A 4ZY2A 3EJGA 4JGKA 1BLLE 3EWPA 1GYTA 1LANA 4X2TA 3SIGA 5CBMA 4R6TA 3KZWA 3GPQA 3SIJA 4J5RA 3GPGA 4ZY1A 3H8EA 3KQXA 4KSIA 4GVVA 3VFQA 2EEEA 3Q6ZA 4K3NA 4ZX8A 3KR5A 3EWOA 3SIHA 4D86A 2FXKA 2FAVA 4JVVA 3EWQA 3H8FA 3KQZA 4ZI6A 3IIDA 2BFRA 4JCAA 2EWBA 3EKEA 4TU0A 5FSVA 5DUSA 4J4ZA 3GQEA 3V2BA 2X47A 3SIIA 1SPVA 1VHUA 2ACFA 4R76A 5CB3A 3EW5A 4K0CA 4UMLA 4KYBA 4ZX9A 4J5SA 5FSUA 2BFQA 4IQYA 2AFCA 2L8RA 5HOLA 5CMSA 1BPNA 5AILA 3GQOA 4ETJA 4ABKA 1BPMA 4ZYQA 4R7MA 3T8WA 4GUAA 4JLLA 3EWRA 1LAPA 1ZR5A 3JRUA 1ZR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TY8 A;  5D8N A;  2LGR A;  5FSZ A;  4ESS A;  5CB5 A;  3IJ3 A;  1NJR A;  1LAM A;  3ETI A;  5HIH A;  3JZT A;  3PEI A;  4ETK A;  1LCP A;  2J9A A;  3EJF A;  4ZY0 A;  2XD7 A;  3GPO A;  4GVW A;  2DX6 A;  2VRI A;  3H8G A;  3Q71 A;  4ABL A;  5FSY A;  3IIF A;  2FG1 A;  1YD9 A;  1TXZ A;  1HJZ A;  5FSX A;  3KR4 A;  4J5Q A;  5E3B A;  3V45 A;  4ZY2 A;  3EJG A;  4JGK A;  1BLL E;  3EWP A;  1GYT A;  1LAN A;  4X2T A;  3SIG A;  5CBM A;  4R6T A;  3KZW A;  3GPQ A;  3SIJ A;  4J5R A;  3GPG A;  4ZY1 A;  3H8E A;  3KQX A;  4KSI A;  4GVV A;  3VFQ A;  2EEE A;  3Q6Z A;  4K3N A;  4ZX8 A;  3KR5 A;  3EWO A;  3SIH A;  4D86 A;  2FXK A;  2FAV A;  4JVV A;  3EWQ A;  3H8F A;  3KQZ A;  4ZI6 A;  3IID A;  2BFR A;  4JCA A;  2EWB A;  3EKE A;  4TU0 A;  5FSV A;  5DUS A;  4J4Z A;  3GQE A;  3V2B A;  2X47 A;  3SII A;  1SPV A;  1VHU A;  2ACF A;  4R76 A;  5CB3 A;  3EW5 A;  4K0C A;  4UML A;  4KYB A;  4ZX9 A;  4J5S A;  5FSU A;  2BFQ A;  4IQY A;  2AFC A;  2L8R A;  5HOL A;  5CMS A;  1BPN A;  5AIL A;  3GQO A;  4ETJ A;  4ABK A;  1BPM A;  4ZYQ A;  4R7M A;  3T8W A;  4GUA A;  4JLL A;  3EWR A;  1LAP A;  1ZR5 A;  3JRU A;  1ZR3 A; 
#chains in the Genus database with same CATH topology
 1TY8 A;  5D8N A;  2LGR A;  5FSZ A;  4ESS A;  5CB5 A;  3IJ3 A;  1NJR A;  2RNK A;  1LAM A;  3ETI A;  5HIH A;  3JZT A;  3PEI A;  4ETK A;  1LCP A;  2J9A A;  3EJF A;  4ZY0 A;  2XD7 A;  3GPO A;  4GVW A;  2DX6 A;  2VRI A;  2W2G A;  3H8G A;  3Q71 A;  4ABL A;  5FSY A;  3IIF A;  2FG1 A;  1YD9 A;  1TXZ A;  1HJZ A;  5FSX A;  3KR4 A;  4J5Q A;  5E3B A;  3V45 A;  4ZY2 A;  3EJG A;  4JGK A;  1BLL E;  3EWP A;  1GYT A;  1LAN A;  4X2T A;  3SIG A;  5CBM A;  4R6T A;  3KZW A;  3GPQ A;  3SIJ A;  4J5R A;  3GPG A;  4ZY1 A;  3H8E A;  3KQX A;  4KSI A;  4GVV A;  3VFQ A;  2EEE A;  3Q6Z A;  4K3N A;  4ZX8 A;  3KR5 A;  3EWO A;  3SIH A;  4D86 A;  2FXK A;  2FAV A;  4JVV A;  3EWQ A;  3H8F A;  3KQZ A;  4ZI6 A;  3IID A;  2BFR A;  4JCA A;  2EWB A;  3EKE A;  4TU0 A;  5FSV A;  5DUS A;  4J4Z A;  3GQE A;  3V2B A;  2X47 A;  2JZE A;  3SII A;  1SPV A;  1VHU A;  2KQV A;  2ACF A;  4R76 A;  5CB3 A;  3EW5 A;  4K0C A;  4UML A;  4KYB A;  4ZX9 A;  4J5S A;  5FSU A;  2BFQ A;  4IQY A;  2AFC A;  2L8R A;  2JZD A;  5HOL A;  5CMS A;  1BPN A;  5AIL A;  2JZF A;  2WCT A;  3GQO A;  4ETJ A;  4ABK A;  1BPM A;  4ZYQ A;  4R7M A;  3T8W A;  4GUA A;  4JLL A;  3EWR A;  1LAP A;  1ZR5 A;  3JRU A;  1ZR3 A; 
#chains in the Genus database with same CATH homology
 1TY8 A;  5D8N A;  2LGR A;  5FSZ A;  4ESS A;  5CB5 A;  3IJ3 A;  1NJR A;  1LAM A;  3ETI A;  5HIH A;  3JZT A;  3PEI A;  4ETK A;  1LCP A;  2J9A A;  3EJF A;  4ZY0 A;  2XD7 A;  3GPO A;  4GVW A;  2DX6 A;  2VRI A;  3H8G A;  3Q71 A;  4ABL A;  5FSY A;  3IIF A;  2FG1 A;  1YD9 A;  1TXZ A;  1HJZ A;  5FSX A;  3KR4 A;  4J5Q A;  5E3B A;  3V45 A;  4ZY2 A;  3EJG A;  4JGK A;  1BLL E;  3EWP A;  1GYT A;  1LAN A;  4X2T A;  3SIG A;  5CBM A;  4R6T A;  3KZW A;  3GPQ A;  3SIJ A;  4J5R A;  3GPG A;  4ZY1 A;  3H8E A;  3KQX A;  4KSI A;  4GVV A;  3VFQ A;  2EEE A;  3Q6Z A;  4K3N A;  4ZX8 A;  3KR5 A;  3EWO A;  3SIH A;  4D86 A;  2FXK A;  2FAV A;  4JVV A;  3EWQ A;  3H8F A;  3KQZ A;  4ZI6 A;  3IID A;  2BFR A;  4JCA A;  2EWB A;  3EKE A;  4TU0 A;  5FSV A;  5DUS A;  4J4Z A;  3GQE A;  3V2B A;  2X47 A;  3SII A;  1SPV A;  1VHU A;  2ACF A;  4R76 A;  5CB3 A;  3EW5 A;  4K0C A;  4UML A;  4KYB A;  4ZX9 A;  4J5S A;  5FSU A;  2BFQ A;  4IQY A;  2AFC A;  2L8R A;  5HOL A;  5CMS A;  1BPN A;  5AIL A;  3GQO A;  4ETJ A;  4ABK A;  1BPM A;  4ZYQ A;  4R7M A;  3T8W A;  4GUA A;  4JLL A;  3EWR A;  1LAP A;  1ZR5 A;  3JRU A;  1ZR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...