2BFRA

The macro domain is an adp-ribose binding module
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
191
structure length
191
Chain Sequence
EVLFEAKVGDITLKLAQGDITQYPAKAIVNAANKRLEHGGGVAYAIAKACAGDAGLYTEISKKAMREQFGRDYIDHGEVVVTPAMNLEERGIKYVFHTVGPICSGMWSEELKEKLYKAFLGPLEKAEEMGVESIAFPAVSAGIYGCDLEKVVETFLEAVKNFKGSAVKEVALVIYDRKSAEVALKVFERSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN AF1521
publication title The Macro Domain is an Adp-Ribose Binding Module.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Macro_h2a domain/hydrolase
total genus 68
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2004-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2bfrA00
3JRUA 3V45A 2BFQA 2EEEA 3EKEA 1NJRA 2VRIA 2J9AA 4X2TA 3V2BA 4ABLA 4ZX8A 1LCPA 4JLLA 2L8RA 4R7MA 3KR5A 2FG1A 3T8WA 3EJFA 2AFCA 3EJGA 4KYBA 4J5QA 4ZI6A 5FSUA 4ETKA 4GVVA 3KR4A 5CB5A 3IIDA 3Q6ZA 1BPMA 4IQYA 3GPOA 4UMLA 5FSYA 1BPNA 3H8GA 3GPGA 1GYTA 3EWPA 5CBMA 4ZYQA 3KQXA 2FXKA 4TU0A 3VFQA 3EWRA 5AILA 5HOLA 3EW5A 3EWOA 4ZY0A 1LAPA 3PEIA 1LANA 1LAMA 3H8FA 1HJZA 2X47A 4GVWA 4GUAA 4K0CA 2DX6A 2ACFA 4ZY1A 3SIJA 3IJ3A 3SIHA 4D86A 2EWBA 1ZR3A 4R76A 3SIGA 3EWQA 5D8NA 4J5RA 1VHUA 3GQEA 3IIFA 4ESSA 3SIIA 5DUSA 1TY8A 5CMSA 3Q71A 1SPVA 5FSVA 4R6TA 5CB3A 3JZTA 4J5SA 4JGKA 3KQZA 4ETJA 2FAVA 4JVVA 4J4ZA 5E3BA 3GQOA 1YD9A 2BFRA 4ABKA 4ZY2A 1BLLE 4K3NA 4JCAA 5HIHA 3KZWA 3ETIA 4ZX9A 1TXZA 2LGRA 2XD7A 3GPQA 3H8EA 4KSIA 5FSZA 5FSXA 1ZR5A
chains in the Genus database with same CATH superfamily
3JRUA 3V45A 2BFQA 2EEEA 3EKEA 1NJRA 2VRIA 2J9AA 2RNKA 4X2TA 3V2BA 4ABLA 4ZX8A 1LCPA 2KQVA 4JLLA 2L8RA 4R7MA 3KR5A 2FG1A 3T8WA 3EJFA 2AFCA 3EJGA 4KYBA 4J5QA 4ZI6A 5FSUA 4ETKA 4GVVA 3KR4A 5CB5A 3IIDA 3Q6ZA 1BPMA 4IQYA 3GPOA 2JZEA 4UMLA 1BPNA 5FSYA 3H8GA 3GPGA 1GYTA 3EWPA 5CBMA 4ZYQA 3KQXA 2FXKA 4TU0A 3VFQA 2W2GA 3EWRA 5AILA 5HOLA 3EW5A 3EWOA 4ZY0A 1LAPA 3PEIA 3H8FA 1LANA 1LAMA 2WCTA 1HJZA 2X47A 4GVWA 4GUAA 4K0CA 2DX6A 2ACFA 4ZY1A 3SIJA 3IJ3A 3SIHA 4D86A 2EWBA 1ZR3A 4R76A 3SIGA 3EWQA 5D8NA 4J5RA 1VHUA 3GQEA 3IIFA 4ESSA 3SIIA 5DUSA 1TY8A 5CMSA 3Q71A 1SPVA 5FSVA 4R6TA 5CB3A 3JZTA 4J5SA 4JGKA 2JZDA 3KQZA 4ETJA 2FAVA 4JVVA 4J4ZA 5E3BA 3GQOA 1YD9A 2BFRA 4ABKA 2JZFA 4ZY2A 1BLLE 4K3NA 4JCAA 5HIHA 3KZWA 3ETIA 4ZX9A 1TXZA 2LGRA 2XD7A 3GPQA 3H8EA 4KSIA 5FSZA 5FSXA 1ZR5A
chains in the Genus database with same CATH topology
3JRUA 3V45A 2BFQA 2EEEA 3EKEA 1NJRA 2VRIA 2J9AA 4X2TA 3V2BA 4ABLA 4ZX8A 1LCPA 4JLLA 2L8RA 4R7MA 3KR5A 2FG1A 3T8WA 3EJFA 2AFCA 3EJGA 4KYBA 4J5QA 4ZI6A 5FSUA 4ETKA 4GVVA 3KR4A 5CB5A 3IIDA 3Q6ZA 1BPMA 4IQYA 3GPOA 4UMLA 5FSYA 1BPNA 3H8GA 3GPGA 1GYTA 3EWPA 5CBMA 4ZYQA 3KQXA 2FXKA 4TU0A 3VFQA 3EWRA 5AILA 5HOLA 3EW5A 3EWOA 4ZY0A 1LAPA 3PEIA 1LANA 1LAMA 3H8FA 1HJZA 2X47A 4GVWA 4GUAA 4K0CA 2DX6A 2ACFA 4ZY1A 3SIJA 3IJ3A 3SIHA 4D86A 2EWBA 1ZR3A 4R76A 3SIGA 3EWQA 5D8NA 4J5RA 1VHUA 3GQEA 3IIFA 4ESSA 3SIIA 5DUSA 1TY8A 5CMSA 3Q71A 1SPVA 5FSVA 4R6TA 5CB3A 3JZTA 4J5SA 4JGKA 3KQZA 4ETJA 2FAVA 4JVVA 4J4ZA 5E3BA 3GQOA 1YD9A 2BFRA 4ABKA 4ZY2A 1BLLE 4K3NA 4JCAA 5HIHA 3KZWA 3ETIA 4ZX9A 1TXZA 2LGRA 2XD7A 3GPQA 3H8EA 4KSIA 5FSZA 5FSXA 1ZR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRU A;  3V45 A;  2BFQ A;  2EEE A;  3EKE A;  1NJR A;  2VRI A;  2J9A A;  4X2T A;  3V2B A;  4ABL A;  4ZX8 A;  1LCP A;  4JLL A;  2L8R A;  4R7M A;  3KR5 A;  2FG1 A;  3T8W A;  3EJF A;  2AFC A;  3EJG A;  4KYB A;  4J5Q A;  4ZI6 A;  5FSU A;  4ETK A;  4GVV A;  3KR4 A;  5CB5 A;  3IID A;  3Q6Z A;  1BPM A;  4IQY A;  3GPO A;  4UML A;  5FSY A;  1BPN A;  3H8G A;  3GPG A;  1GYT A;  3EWP A;  5CBM A;  4ZYQ A;  3KQX A;  2FXK A;  4TU0 A;  3VFQ A;  3EWR A;  5AIL A;  5HOL A;  3EW5 A;  3EWO A;  4ZY0 A;  1LAP A;  3PEI A;  1LAN A;  1LAM A;  3H8F A;  1HJZ A;  2X47 A;  4GVW A;  4GUA A;  4K0C A;  2DX6 A;  2ACF A;  4ZY1 A;  3SIJ A;  3IJ3 A;  3SIH A;  4D86 A;  2EWB A;  1ZR3 A;  4R76 A;  3SIG A;  3EWQ A;  5D8N A;  4J5R A;  1VHU A;  3GQE A;  3IIF A;  4ESS A;  3SII A;  5DUS A;  1TY8 A;  5CMS A;  3Q71 A;  1SPV A;  5FSV A;  4R6T A;  5CB3 A;  3JZT A;  4J5S A;  4JGK A;  3KQZ A;  4ETJ A;  2FAV A;  4JVV A;  4J4Z A;  5E3B A;  3GQO A;  1YD9 A;  2BFR A;  4ABK A;  4ZY2 A;  1BLL E;  4K3N A;  4JCA A;  5HIH A;  3KZW A;  3ETI A;  4ZX9 A;  1TXZ A;  2LGR A;  2XD7 A;  3GPQ A;  3H8E A;  4KSI A;  5FSZ A;  5FSX A;  1ZR5 A; 
#chains in the Genus database with same CATH topology
 3JRU A;  3V45 A;  2BFQ A;  2EEE A;  3EKE A;  1NJR A;  2VRI A;  2J9A A;  2RNK A;  4X2T A;  3V2B A;  4ABL A;  4ZX8 A;  1LCP A;  2KQV A;  4JLL A;  2L8R A;  4R7M A;  3KR5 A;  2FG1 A;  3T8W A;  3EJF A;  2AFC A;  3EJG A;  4KYB A;  4J5Q A;  4ZI6 A;  5FSU A;  4ETK A;  4GVV A;  3KR4 A;  5CB5 A;  3IID A;  3Q6Z A;  1BPM A;  4IQY A;  3GPO A;  2JZE A;  4UML A;  1BPN A;  5FSY A;  3H8G A;  3GPG A;  1GYT A;  3EWP A;  5CBM A;  4ZYQ A;  3KQX A;  2FXK A;  4TU0 A;  3VFQ A;  2W2G A;  3EWR A;  5AIL A;  5HOL A;  3EW5 A;  3EWO A;  4ZY0 A;  1LAP A;  3PEI A;  3H8F A;  1LAN A;  1LAM A;  2WCT A;  1HJZ A;  2X47 A;  4GVW A;  4GUA A;  4K0C A;  2DX6 A;  2ACF A;  4ZY1 A;  3SIJ A;  3IJ3 A;  3SIH A;  4D86 A;  2EWB A;  1ZR3 A;  4R76 A;  3SIG A;  3EWQ A;  5D8N A;  4J5R A;  1VHU A;  3GQE A;  3IIF A;  4ESS A;  3SII A;  5DUS A;  1TY8 A;  5CMS A;  3Q71 A;  1SPV A;  5FSV A;  4R6T A;  5CB3 A;  3JZT A;  4J5S A;  4JGK A;  2JZD A;  3KQZ A;  4ETJ A;  2FAV A;  4JVV A;  4J4Z A;  5E3B A;  3GQO A;  1YD9 A;  2BFR A;  4ABK A;  2JZF A;  4ZY2 A;  1BLL E;  4K3N A;  4JCA A;  5HIH A;  3KZW A;  3ETI A;  4ZX9 A;  1TXZ A;  2LGR A;  2XD7 A;  3GPQ A;  3H8E A;  4KSI A;  5FSZ A;  5FSX A;  1ZR5 A; 
#chains in the Genus database with same CATH homology
 3JRU A;  3V45 A;  2BFQ A;  2EEE A;  3EKE A;  1NJR A;  2VRI A;  2J9A A;  4X2T A;  3V2B A;  4ABL A;  4ZX8 A;  1LCP A;  4JLL A;  2L8R A;  4R7M A;  3KR5 A;  2FG1 A;  3T8W A;  3EJF A;  2AFC A;  3EJG A;  4KYB A;  4J5Q A;  4ZI6 A;  5FSU A;  4ETK A;  4GVV A;  3KR4 A;  5CB5 A;  3IID A;  3Q6Z A;  1BPM A;  4IQY A;  3GPO A;  4UML A;  5FSY A;  1BPN A;  3H8G A;  3GPG A;  1GYT A;  3EWP A;  5CBM A;  4ZYQ A;  3KQX A;  2FXK A;  4TU0 A;  3VFQ A;  3EWR A;  5AIL A;  5HOL A;  3EW5 A;  3EWO A;  4ZY0 A;  1LAP A;  3PEI A;  1LAN A;  1LAM A;  3H8F A;  1HJZ A;  2X47 A;  4GVW A;  4GUA A;  4K0C A;  2DX6 A;  2ACF A;  4ZY1 A;  3SIJ A;  3IJ3 A;  3SIH A;  4D86 A;  2EWB A;  1ZR3 A;  4R76 A;  3SIG A;  3EWQ A;  5D8N A;  4J5R A;  1VHU A;  3GQE A;  3IIF A;  4ESS A;  3SII A;  5DUS A;  1TY8 A;  5CMS A;  3Q71 A;  1SPV A;  5FSV A;  4R6T A;  5CB3 A;  3JZT A;  4J5S A;  4JGK A;  3KQZ A;  4ETJ A;  2FAV A;  4JVV A;  4J4Z A;  5E3B A;  3GQO A;  1YD9 A;  2BFR A;  4ABK A;  4ZY2 A;  1BLL E;  4K3N A;  4JCA A;  5HIH A;  3KZW A;  3ETI A;  4ZX9 A;  1TXZ A;  2LGR A;  2XD7 A;  3GPQ A;  3H8E A;  4KSI A;  5FSZ A;  5FSX A;  1ZR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...