1TY8A

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
publication title CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN YMX7
rcsb
source organism Saccharomyces cerevisiae
total genus 78
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1ty8A00
4ZY0A 5DUSA 3SIIA 4KSIA 5AILA 5FSVA 5D8NA 4R7MA 5FSZA 3GQOA 1LCPA 4JCAA 5HOLA 3EWRA 3KQZA 1TY8A 4ETJA 4TU0A 4R76A 3KQXA 4X2TA 2LGRA 3SIGA 2AFCA 2BFQA 1BPMA 1ZR5A 1SPVA 5FSYA 2XD7A 1BLLE 3IJ3A 3Q71A 5FSUA 2FG1A 3H8FA 3H8GA 1GYTA 2ACFA 3EWQA 3EJGA 3KR4A 5CBMA 2DX6A 3KZWA 4JVVA 4ESSA 5E3BA 1TXZA 4ZY1A 3EW5A 4ZYQA 5CB3A 4ABKA 2FXKA 4KYBA 4GVWA 5CB5A 4JGKA 4J5QA 4K0CA 5CMSA 4JLLA 4ZX8A 3EWOA 3Q6ZA 3VFQA 2J9AA 5HIHA 2BFRA 3GPGA 4IQYA 1HJZA 1VHUA 1ZR3A 4ZY2A 1LAMA 4ETKA 3IIFA 4J5RA 3JZTA 3JRUA 5FSXA 3GPQA 1NJRA 2EWBA 1BPNA 2EEEA 3SIHA 1LANA 1LAPA 3PEIA 4R6TA 1YD9A 3EKEA 2VRIA 2FAVA 4GUAA 3H8EA 4ZI6A 4UMLA 4J5SA 2L8RA 4ABLA 3T8WA 4D86A 3GPOA 3V45A 3ETIA 3SIJA 3V2BA 4J4ZA 3IIDA 3KR5A 3EJFA 4K3NA 2X47A 4ZX9A 3EWPA 4GVVA 3GQEA
chains in the Genus database with same CATH superfamily
4ZY0A 5DUSA 3SIIA 4KSIA 5AILA 5FSVA 5D8NA 4R7MA 5FSZA 3GQOA 1LCPA 4JCAA 5HOLA 3EWRA 3KQZA 1TY8A 4ETJA 4TU0A 4R76A 3KQXA 2RNKA 4X2TA 2JZFA 2LGRA 3SIGA 2AFCA 2BFQA 1BPMA 2JZDA 1ZR5A 1SPVA 5FSYA 2XD7A 1BLLE 3IJ3A 3Q71A 5FSUA 2FG1A 3H8FA 3H8GA 1GYTA 2ACFA 3EWQA 2W2GA 3EJGA 3KR4A 5CBMA 2DX6A 3KZWA 4JVVA 4ESSA 5E3BA 1TXZA 4ZY1A 3EW5A 4ZYQA 5CB3A 4ABKA 2FXKA 4KYBA 4GVWA 5CB5A 4JGKA 4J5QA 4K0CA 5CMSA 4JLLA 4ZX8A 3EWOA 3Q6ZA 3VFQA 2J9AA 5HIHA 2BFRA 3GPGA 4IQYA 1HJZA 1VHUA 1ZR3A 4ZY2A 1LAMA 4ETKA 2KQVA 3IIFA 4J5RA 3JZTA 3JRUA 5FSXA 3GPQA 1NJRA 2EWBA 2WCTA 1BPNA 2EEEA 3SIHA 1LANA 1LAPA 3PEIA 4R6TA 1YD9A 3EKEA 2VRIA 2FAVA 4GUAA 3H8EA 4ZI6A 4UMLA 4J5SA 2L8RA 4ABLA 3T8WA 4D86A 3GPOA 3V45A 3ETIA 3SIJA 3V2BA 4J4ZA 2JZEA 3IIDA 3KR5A 3EJFA 4K3NA 2X47A 4ZX9A 3EWPA 4GVVA 3GQEA
chains in the Genus database with same CATH topology
4ZY0A 5DUSA 3SIIA 4KSIA 5AILA 5FSVA 5D8NA 4R7MA 5FSZA 3GQOA 1LCPA 4JCAA 5HOLA 3EWRA 3KQZA 1TY8A 4ETJA 4TU0A 4R76A 3KQXA 4X2TA 2LGRA 3SIGA 2AFCA 2BFQA 1BPMA 1ZR5A 1SPVA 5FSYA 2XD7A 1BLLE 3IJ3A 3Q71A 5FSUA 2FG1A 3H8FA 3H8GA 1GYTA 2ACFA 3EWQA 3EJGA 3KR4A 5CBMA 2DX6A 3KZWA 4JVVA 4ESSA 5E3BA 1TXZA 4ZY1A 3EW5A 4ZYQA 5CB3A 4ABKA 2FXKA 4KYBA 4GVWA 5CB5A 4JGKA 4J5QA 4K0CA 5CMSA 4JLLA 4ZX8A 3EWOA 3Q6ZA 3VFQA 2J9AA 5HIHA 2BFRA 3GPGA 4IQYA 1HJZA 1VHUA 1ZR3A 4ZY2A 1LAMA 4ETKA 3IIFA 4J5RA 3JZTA 3JRUA 5FSXA 3GPQA 1NJRA 2EWBA 1BPNA 2EEEA 3SIHA 1LANA 1LAPA 3PEIA 4R6TA 1YD9A 3EKEA 2VRIA 2FAVA 4GUAA 3H8EA 4ZI6A 4UMLA 4J5SA 2L8RA 4ABLA 3T8WA 4D86A 3GPOA 3V45A 3ETIA 3SIJA 3V2BA 4J4ZA 3IIDA 3KR5A 3EJFA 4K3NA 2X47A 4ZX9A 3EWPA 4GVVA 3GQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZY0 A;  5DUS A;  3SII A;  4KSI A;  5AIL A;  5FSV A;  5D8N A;  4R7M A;  5FSZ A;  3GQO A;  1LCP A;  4JCA A;  5HOL A;  3EWR A;  3KQZ A;  1TY8 A;  4ETJ A;  4TU0 A;  4R76 A;  3KQX A;  4X2T A;  2LGR A;  3SIG A;  2AFC A;  2BFQ A;  1BPM A;  1ZR5 A;  1SPV A;  5FSY A;  2XD7 A;  1BLL E;  3IJ3 A;  3Q71 A;  5FSU A;  2FG1 A;  3H8F A;  3H8G A;  1GYT A;  2ACF A;  3EWQ A;  3EJG A;  3KR4 A;  5CBM A;  2DX6 A;  3KZW A;  4JVV A;  4ESS A;  5E3B A;  1TXZ A;  4ZY1 A;  3EW5 A;  4ZYQ A;  5CB3 A;  4ABK A;  2FXK A;  4KYB A;  4GVW A;  5CB5 A;  4JGK A;  4J5Q A;  4K0C A;  5CMS A;  4JLL A;  4ZX8 A;  3EWO A;  3Q6Z A;  3VFQ A;  2J9A A;  5HIH A;  2BFR A;  3GPG A;  4IQY A;  1HJZ A;  1VHU A;  1ZR3 A;  4ZY2 A;  1LAM A;  4ETK A;  3IIF A;  4J5R A;  3JZT A;  3JRU A;  5FSX A;  3GPQ A;  1NJR A;  2EWB A;  1BPN A;  2EEE A;  3SIH A;  1LAN A;  1LAP A;  3PEI A;  4R6T A;  1YD9 A;  3EKE A;  2VRI A;  2FAV A;  4GUA A;  3H8E A;  4ZI6 A;  4UML A;  4J5S A;  2L8R A;  4ABL A;  3T8W A;  4D86 A;  3GPO A;  3V45 A;  3ETI A;  3SIJ A;  3V2B A;  4J4Z A;  3IID A;  3KR5 A;  3EJF A;  4K3N A;  2X47 A;  4ZX9 A;  3EWP A;  4GVV A;  3GQE A; 
#chains in the Genus database with same CATH topology
 4ZY0 A;  5DUS A;  3SII A;  4KSI A;  5AIL A;  5FSV A;  5D8N A;  4R7M A;  5FSZ A;  3GQO A;  1LCP A;  4JCA A;  5HOL A;  3EWR A;  3KQZ A;  1TY8 A;  4ETJ A;  4TU0 A;  4R76 A;  3KQX A;  2RNK A;  4X2T A;  2JZF A;  2LGR A;  3SIG A;  2AFC A;  2BFQ A;  1BPM A;  2JZD A;  1ZR5 A;  1SPV A;  5FSY A;  2XD7 A;  1BLL E;  3IJ3 A;  3Q71 A;  5FSU A;  2FG1 A;  3H8F A;  3H8G A;  1GYT A;  2ACF A;  3EWQ A;  2W2G A;  3EJG A;  3KR4 A;  5CBM A;  2DX6 A;  3KZW A;  4JVV A;  4ESS A;  5E3B A;  1TXZ A;  4ZY1 A;  3EW5 A;  4ZYQ A;  5CB3 A;  4ABK A;  2FXK A;  4KYB A;  4GVW A;  5CB5 A;  4JGK A;  4J5Q A;  4K0C A;  5CMS A;  4JLL A;  4ZX8 A;  3EWO A;  3Q6Z A;  3VFQ A;  2J9A A;  5HIH A;  2BFR A;  3GPG A;  4IQY A;  1HJZ A;  1VHU A;  1ZR3 A;  4ZY2 A;  1LAM A;  4ETK A;  2KQV A;  3IIF A;  4J5R A;  3JZT A;  3JRU A;  5FSX A;  3GPQ A;  1NJR A;  2EWB A;  2WCT A;  1BPN A;  2EEE A;  3SIH A;  1LAN A;  1LAP A;  3PEI A;  4R6T A;  1YD9 A;  3EKE A;  2VRI A;  2FAV A;  4GUA A;  3H8E A;  4ZI6 A;  4UML A;  4J5S A;  2L8R A;  4ABL A;  3T8W A;  4D86 A;  3GPO A;  3V45 A;  3ETI A;  3SIJ A;  3V2B A;  4J4Z A;  2JZE A;  3IID A;  3KR5 A;  3EJF A;  4K3N A;  2X47 A;  4ZX9 A;  3EWP A;  4GVV A;  3GQE A; 
#chains in the Genus database with same CATH homology
 4ZY0 A;  5DUS A;  3SII A;  4KSI A;  5AIL A;  5FSV A;  5D8N A;  4R7M A;  5FSZ A;  3GQO A;  1LCP A;  4JCA A;  5HOL A;  3EWR A;  3KQZ A;  1TY8 A;  4ETJ A;  4TU0 A;  4R76 A;  3KQX A;  4X2T A;  2LGR A;  3SIG A;  2AFC A;  2BFQ A;  1BPM A;  1ZR5 A;  1SPV A;  5FSY A;  2XD7 A;  1BLL E;  3IJ3 A;  3Q71 A;  5FSU A;  2FG1 A;  3H8F A;  3H8G A;  1GYT A;  2ACF A;  3EWQ A;  3EJG A;  3KR4 A;  5CBM A;  2DX6 A;  3KZW A;  4JVV A;  4ESS A;  5E3B A;  1TXZ A;  4ZY1 A;  3EW5 A;  4ZYQ A;  5CB3 A;  4ABK A;  2FXK A;  4KYB A;  4GVW A;  5CB5 A;  4JGK A;  4J5Q A;  4K0C A;  5CMS A;  4JLL A;  4ZX8 A;  3EWO A;  3Q6Z A;  3VFQ A;  2J9A A;  5HIH A;  2BFR A;  3GPG A;  4IQY A;  1HJZ A;  1VHU A;  1ZR3 A;  4ZY2 A;  1LAM A;  4ETK A;  3IIF A;  4J5R A;  3JZT A;  3JRU A;  5FSX A;  3GPQ A;  1NJR A;  2EWB A;  1BPN A;  2EEE A;  3SIH A;  1LAN A;  1LAP A;  3PEI A;  4R6T A;  1YD9 A;  3EKE A;  2VRI A;  2FAV A;  4GUA A;  3H8E A;  4ZI6 A;  4UML A;  4J5S A;  2L8R A;  4ABL A;  3T8W A;  4D86 A;  3GPO A;  3V45 A;  3ETI A;  3SIJ A;  3V2B A;  4J4Z A;  3IID A;  3KR5 A;  3EJF A;  4K3N A;  2X47 A;  4ZX9 A;  3EWP A;  4GVV A;  3GQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...