1TY8A

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
publication title CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN YMX7
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 78
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1ty8A00
4ABKA 5FSYA 4ZX8A 1TXZA 3EWQA 5D8NA 3GPQA 1GYTA 3V2BA 1LCPA 3Q71A 3H8EA 5CBMA 5CB3A 2FG1A 3SIIA 4JVVA 4ETKA 5FSXA 1LAPA 1VHUA 4UMLA 5FSVA 4J5RA 3Q6ZA 2X47A 4GVVA 4ZY1A 4ESSA 3V45A 3KQXA 5E3BA 2J9AA 3KZWA 1ZR5A 4K3NA 1BPMA 3H8FA 4ETJA 5AILA 2ACFA 2XD7A 1ZR3A 3EW5A 4KSIA 4ZY2A 3EJGA 4J5QA 1LAMA 2LGRA 2DX6A 5HIHA 3KR4A 3IJ3A 4JCAA 3SIHA 3GQOA 4ABLA 5DUSA 2BFQA 5CB5A 2EEEA 3GPGA 3KR5A 2FAVA 3VFQA 4GVWA 3IIDA 4KYBA 4ZYQA 3EWPA 3JRUA 1LANA 3EWOA 4ZI6A 2L8RA 4X2TA 5FSUA 3H8GA 4TU0A 1TY8A 3SIJA 3GQEA 1BPNA 4JLLA 4J5SA 3ETIA 2BFRA 3EJFA 2AFCA 3GPOA 3EWRA 4ZY0A 4J4ZA 4GUAA 3T8WA 2VRIA 3JZTA 1SPVA 2EWBA 3PEIA 4R6TA 2FXKA 4ZX9A 5HOLA 3KQZA 1BLLE 3EKEA 5FSZA 4R76A 3SIGA 4R7MA 3IIFA 4IQYA 1YD9A 4K0CA 1NJRA 1HJZA 4JGKA 5CMSA 4D86A
chains in the Genus database with same CATH superfamily
4ABKA 5FSYA 4ZX8A 1TXZA 3EWQA 5D8NA 3GPQA 1GYTA 3V2BA 1LCPA 3Q71A 3H8EA 5CBMA 5CB3A 2FG1A 3SIIA 4JVVA 4ETKA 5FSXA 1LAPA 1VHUA 4UMLA 5FSVA 4J5RA 3Q6ZA 2X47A 4GVVA 4ZY1A 4ESSA 2RNKA 3V45A 3KQXA 5E3BA 2J9AA 3KZWA 1ZR5A 4K3NA 1BPMA 3H8FA 4ETJA 5AILA 2ACFA 2XD7A 1ZR3A 3EW5A 4KSIA 4ZY2A 2JZEA 3EJGA 4J5QA 2WCTA 1LAMA 2LGRA 2DX6A 5HIHA 3KR4A 3IJ3A 4JCAA 3SIHA 3GQOA 4ABLA 5DUSA 2BFQA 5CB5A 2EEEA 3GPGA 3KR5A 2FAVA 3VFQA 2JZDA 4GVWA 3IIDA 4KYBA 4ZYQA 3EWPA 3JRUA 1LANA 3EWOA 4ZI6A 2L8RA 4X2TA 5FSUA 3H8GA 4TU0A 1TY8A 3SIJA 3GQEA 1BPNA 4JLLA 2KQVA 4J5SA 3ETIA 2BFRA 3EJFA 2JZFA 2AFCA 3GPOA 3EWRA 4ZY0A 4J4ZA 4GUAA 3T8WA 2VRIA 3JZTA 1SPVA 2EWBA 3PEIA 4R6TA 2FXKA 4ZX9A 2W2GA 5HOLA 3KQZA 1BLLE 3EKEA 5FSZA 4R76A 3SIGA 4R7MA 3IIFA 4IQYA 1YD9A 4K0CA 1NJRA 1HJZA 4JGKA 5CMSA 4D86A
chains in the Genus database with same CATH topology
4ABKA 5FSYA 4ZX8A 1TXZA 3EWQA 5D8NA 3GPQA 1GYTA 3V2BA 1LCPA 3Q71A 3H8EA 5CBMA 5CB3A 2FG1A 3SIIA 4JVVA 4ETKA 5FSXA 1LAPA 1VHUA 4UMLA 5FSVA 4J5RA 3Q6ZA 2X47A 4GVVA 4ZY1A 4ESSA 3V45A 3KQXA 5E3BA 2J9AA 3KZWA 1ZR5A 4K3NA 1BPMA 3H8FA 4ETJA 5AILA 2ACFA 2XD7A 1ZR3A 3EW5A 4KSIA 4ZY2A 3EJGA 4J5QA 1LAMA 2LGRA 2DX6A 5HIHA 3KR4A 3IJ3A 4JCAA 3SIHA 3GQOA 4ABLA 5DUSA 2BFQA 5CB5A 2EEEA 3GPGA 3KR5A 2FAVA 3VFQA 4GVWA 3IIDA 4KYBA 4ZYQA 3EWPA 3JRUA 1LANA 3EWOA 4ZI6A 2L8RA 4X2TA 5FSUA 3H8GA 4TU0A 1TY8A 3SIJA 3GQEA 1BPNA 4JLLA 4J5SA 3ETIA 2BFRA 3EJFA 2AFCA 3GPOA 3EWRA 4ZY0A 4J4ZA 4GUAA 3T8WA 2VRIA 3JZTA 1SPVA 2EWBA 3PEIA 4R6TA 2FXKA 4ZX9A 5HOLA 3KQZA 1BLLE 3EKEA 5FSZA 4R76A 3SIGA 4R7MA 3IIFA 4IQYA 1YD9A 4K0CA 1NJRA 1HJZA 4JGKA 5CMSA 4D86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ABK A;  5FSY A;  4ZX8 A;  1TXZ A;  3EWQ A;  5D8N A;  3GPQ A;  1GYT A;  3V2B A;  1LCP A;  3Q71 A;  3H8E A;  5CBM A;  5CB3 A;  2FG1 A;  3SII A;  4JVV A;  4ETK A;  5FSX A;  1LAP A;  1VHU A;  4UML A;  5FSV A;  4J5R A;  3Q6Z A;  2X47 A;  4GVV A;  4ZY1 A;  4ESS A;  3V45 A;  3KQX A;  5E3B A;  2J9A A;  3KZW A;  1ZR5 A;  4K3N A;  1BPM A;  3H8F A;  4ETJ A;  5AIL A;  2ACF A;  2XD7 A;  1ZR3 A;  3EW5 A;  4KSI A;  4ZY2 A;  3EJG A;  4J5Q A;  1LAM A;  2LGR A;  2DX6 A;  5HIH A;  3KR4 A;  3IJ3 A;  4JCA A;  3SIH A;  3GQO A;  4ABL A;  5DUS A;  2BFQ A;  5CB5 A;  2EEE A;  3GPG A;  3KR5 A;  2FAV A;  3VFQ A;  4GVW A;  3IID A;  4KYB A;  4ZYQ A;  3EWP A;  3JRU A;  1LAN A;  3EWO A;  4ZI6 A;  2L8R A;  4X2T A;  5FSU A;  3H8G A;  4TU0 A;  1TY8 A;  3SIJ A;  3GQE A;  1BPN A;  4JLL A;  4J5S A;  3ETI A;  2BFR A;  3EJF A;  2AFC A;  3GPO A;  3EWR A;  4ZY0 A;  4J4Z A;  4GUA A;  3T8W A;  2VRI A;  3JZT A;  1SPV A;  2EWB A;  3PEI A;  4R6T A;  2FXK A;  4ZX9 A;  5HOL A;  3KQZ A;  1BLL E;  3EKE A;  5FSZ A;  4R76 A;  3SIG A;  4R7M A;  3IIF A;  4IQY A;  1YD9 A;  4K0C A;  1NJR A;  1HJZ A;  4JGK A;  5CMS A;  4D86 A; 
#chains in the Genus database with same CATH topology
 4ABK A;  5FSY A;  4ZX8 A;  1TXZ A;  3EWQ A;  5D8N A;  3GPQ A;  1GYT A;  3V2B A;  1LCP A;  3Q71 A;  3H8E A;  5CBM A;  5CB3 A;  2FG1 A;  3SII A;  4JVV A;  4ETK A;  5FSX A;  1LAP A;  1VHU A;  4UML A;  5FSV A;  4J5R A;  3Q6Z A;  2X47 A;  4GVV A;  4ZY1 A;  4ESS A;  2RNK A;  3V45 A;  3KQX A;  5E3B A;  2J9A A;  3KZW A;  1ZR5 A;  4K3N A;  1BPM A;  3H8F A;  4ETJ A;  5AIL A;  2ACF A;  2XD7 A;  1ZR3 A;  3EW5 A;  4KSI A;  4ZY2 A;  2JZE A;  3EJG A;  4J5Q A;  2WCT A;  1LAM A;  2LGR A;  2DX6 A;  5HIH A;  3KR4 A;  3IJ3 A;  4JCA A;  3SIH A;  3GQO A;  4ABL A;  5DUS A;  2BFQ A;  5CB5 A;  2EEE A;  3GPG A;  3KR5 A;  2FAV A;  3VFQ A;  2JZD A;  4GVW A;  3IID A;  4KYB A;  4ZYQ A;  3EWP A;  3JRU A;  1LAN A;  3EWO A;  4ZI6 A;  2L8R A;  4X2T A;  5FSU A;  3H8G A;  4TU0 A;  1TY8 A;  3SIJ A;  3GQE A;  1BPN A;  4JLL A;  2KQV A;  4J5S A;  3ETI A;  2BFR A;  3EJF A;  2JZF A;  2AFC A;  3GPO A;  3EWR A;  4ZY0 A;  4J4Z A;  4GUA A;  3T8W A;  2VRI A;  3JZT A;  1SPV A;  2EWB A;  3PEI A;  4R6T A;  2FXK A;  4ZX9 A;  2W2G A;  5HOL A;  3KQZ A;  1BLL E;  3EKE A;  5FSZ A;  4R76 A;  3SIG A;  4R7M A;  3IIF A;  4IQY A;  1YD9 A;  4K0C A;  1NJR A;  1HJZ A;  4JGK A;  5CMS A;  4D86 A; 
#chains in the Genus database with same CATH homology
 4ABK A;  5FSY A;  4ZX8 A;  1TXZ A;  3EWQ A;  5D8N A;  3GPQ A;  1GYT A;  3V2B A;  1LCP A;  3Q71 A;  3H8E A;  5CBM A;  5CB3 A;  2FG1 A;  3SII A;  4JVV A;  4ETK A;  5FSX A;  1LAP A;  1VHU A;  4UML A;  5FSV A;  4J5R A;  3Q6Z A;  2X47 A;  4GVV A;  4ZY1 A;  4ESS A;  3V45 A;  3KQX A;  5E3B A;  2J9A A;  3KZW A;  1ZR5 A;  4K3N A;  1BPM A;  3H8F A;  4ETJ A;  5AIL A;  2ACF A;  2XD7 A;  1ZR3 A;  3EW5 A;  4KSI A;  4ZY2 A;  3EJG A;  4J5Q A;  1LAM A;  2LGR A;  2DX6 A;  5HIH A;  3KR4 A;  3IJ3 A;  4JCA A;  3SIH A;  3GQO A;  4ABL A;  5DUS A;  2BFQ A;  5CB5 A;  2EEE A;  3GPG A;  3KR5 A;  2FAV A;  3VFQ A;  4GVW A;  3IID A;  4KYB A;  4ZYQ A;  3EWP A;  3JRU A;  1LAN A;  3EWO A;  4ZI6 A;  2L8R A;  4X2T A;  5FSU A;  3H8G A;  4TU0 A;  1TY8 A;  3SIJ A;  3GQE A;  1BPN A;  4JLL A;  4J5S A;  3ETI A;  2BFR A;  3EJF A;  2AFC A;  3GPO A;  3EWR A;  4ZY0 A;  4J4Z A;  4GUA A;  3T8W A;  2VRI A;  3JZT A;  1SPV A;  2EWB A;  3PEI A;  4R6T A;  2FXK A;  4ZX9 A;  5HOL A;  3KQZ A;  1BLL E;  3EKE A;  5FSZ A;  4R76 A;  3SIG A;  4R7M A;  3IIF A;  4IQY A;  1YD9 A;  4K0C A;  1NJR A;  1HJZ A;  4JGK A;  5CMS A;  4D86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...