1TY8A

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN YMX7
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
total genus 78
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1ty8A00
3EWQA 4IQYA 4ABLA 1HJZA 3SIHA 4R76A 1LCPA 1LAMA 5FSUA 2X47A 3Q6ZA 1TXZA 3V45A 3IIFA 4ZYQA 4K0CA 2XD7A 3GQOA 4ESSA 5DUSA 3KQZA 4JCAA 3H8GA 3KZWA 4ZX8A 5CB3A 1BLLE 4R7MA 1VHUA 2DX6A 4J5QA 4J5SA 5CB5A 3KR5A 4KYBA 3EWRA 3EJGA 4ETKA 3SIGA 4K3NA 4R6TA 5E3BA 1NJRA 2EEEA 4D86A 4J4ZA 1BPMA 3JRUA 1SPVA 2EWBA 2J9AA 3JZTA 1LANA 4GVWA 2FG1A 3EW5A 3SIIA 3VFQA 3KR4A 3EWOA 4J5RA 4UMLA 4ABKA 1YD9A 2BFQA 2FXKA 3EWPA 5CBMA 3Q71A 1ZR3A 4GUAA 4ZY0A 1ZR5A 4ZX9A 3KQXA 4JGKA 3H8FA 1TY8A 3GPOA 4GVVA 4ZY2A 5HIHA 3IIDA 4JVVA 2BFRA 2L8RA 5CMSA 1LAPA 4ZI6A 4JLLA 2AFCA 4TU0A 1BPNA 4X2TA 4ZY1A 2ACFA 2LGRA 5FSXA 3GPQA 3PEIA 3EKEA 2VRIA 5FSZA 5FSYA 5AILA 5D8NA 5FSVA 4ETJA 3SIJA 3ETIA 3EJFA 1GYTA 3IJ3A 3GQEA 3T8WA 3H8EA 4KSIA 3GPGA 5HOLA 2FAVA 3V2BA
chains in the Genus database with same CATH superfamily
3EWQA 4IQYA 4ABLA 1HJZA 3SIHA 4R76A 1LCPA 1LAMA 5FSUA 2X47A 3Q6ZA 1TXZA 3V45A 3IIFA 4ZYQA 4K0CA 2XD7A 3GQOA 4ESSA 5DUSA 3KQZA 4JCAA 3H8GA 3KZWA 4ZX8A 5CB3A 1BLLE 4R7MA 1VHUA 2DX6A 4J5QA 4J5SA 5CB5A 2KQVA 3KR5A 4KYBA 3EWRA 3EJGA 4ETKA 3SIGA 4K3NA 4R6TA 5E3BA 1NJRA 2EEEA 4D86A 4J4ZA 1BPMA 3JRUA 1SPVA 2EWBA 2J9AA 3JZTA 1LANA 4GVWA 2FG1A 3EW5A 3SIIA 3VFQA 3KR4A 3EWOA 4J5RA 4UMLA 4ABKA 1YD9A 2BFQA 2FXKA 3EWPA 5CBMA 2WCTA 3Q71A 1ZR3A 4GUAA 4ZY0A 1ZR5A 4ZX9A 3KQXA 4JGKA 3H8FA 1TY8A 3GPOA 4GVVA 4ZY2A 5HIHA 3IIDA 4JVVA 2BFRA 2JZDA 2L8RA 5CMSA 1LAPA 4ZI6A 4JLLA 2AFCA 4TU0A 1BPNA 4X2TA 4ZY1A 2ACFA 2LGRA 2JZFA 2W2GA 5FSXA 2JZEA 3GPQA 3PEIA 3EKEA 2VRIA 5FSZA 5FSYA 5AILA 5D8NA 5FSVA 4ETJA 3SIJA 3ETIA 3EJFA 1GYTA 3IJ3A 3GQEA 3T8WA 3H8EA 4KSIA 3GPGA 2RNKA 5HOLA 2FAVA 3V2BA
chains in the Genus database with same CATH topology
3EWQA 4IQYA 4ABLA 1HJZA 3SIHA 4R76A 1LCPA 1LAMA 5FSUA 2X47A 3Q6ZA 1TXZA 3V45A 3IIFA 4ZYQA 4K0CA 2XD7A 3GQOA 4ESSA 5DUSA 3KQZA 4JCAA 3H8GA 3KZWA 4ZX8A 5CB3A 1BLLE 4R7MA 1VHUA 2DX6A 4J5QA 4J5SA 5CB5A 3KR5A 4KYBA 3EWRA 3EJGA 4ETKA 3SIGA 4K3NA 4R6TA 5E3BA 1NJRA 2EEEA 4D86A 4J4ZA 1BPMA 3JRUA 1SPVA 2EWBA 2J9AA 3JZTA 1LANA 4GVWA 2FG1A 3EW5A 3SIIA 3VFQA 3KR4A 3EWOA 4J5RA 4UMLA 4ABKA 1YD9A 2BFQA 2FXKA 3EWPA 5CBMA 3Q71A 1ZR3A 4GUAA 4ZY0A 1ZR5A 4ZX9A 3KQXA 4JGKA 3H8FA 1TY8A 3GPOA 4GVVA 4ZY2A 5HIHA 3IIDA 4JVVA 2BFRA 2L8RA 5CMSA 1LAPA 4ZI6A 4JLLA 2AFCA 4TU0A 1BPNA 4X2TA 4ZY1A 2ACFA 2LGRA 5FSXA 3GPQA 3PEIA 3EKEA 2VRIA 5FSZA 5FSYA 5AILA 5D8NA 5FSVA 4ETJA 3SIJA 3ETIA 3EJFA 1GYTA 3IJ3A 3GQEA 3T8WA 3H8EA 4KSIA 3GPGA 5HOLA 2FAVA 3V2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWQ A;  4IQY A;  4ABL A;  1HJZ A;  3SIH A;  4R76 A;  1LCP A;  1LAM A;  5FSU A;  2X47 A;  3Q6Z A;  1TXZ A;  3V45 A;  3IIF A;  4ZYQ A;  4K0C A;  2XD7 A;  3GQO A;  4ESS A;  5DUS A;  3KQZ A;  4JCA A;  3H8G A;  3KZW A;  4ZX8 A;  5CB3 A;  1BLL E;  4R7M A;  1VHU A;  2DX6 A;  4J5Q A;  4J5S A;  5CB5 A;  3KR5 A;  4KYB A;  3EWR A;  3EJG A;  4ETK A;  3SIG A;  4K3N A;  4R6T A;  5E3B A;  1NJR A;  2EEE A;  4D86 A;  4J4Z A;  1BPM A;  3JRU A;  1SPV A;  2EWB A;  2J9A A;  3JZT A;  1LAN A;  4GVW A;  2FG1 A;  3EW5 A;  3SII A;  3VFQ A;  3KR4 A;  3EWO A;  4J5R A;  4UML A;  4ABK A;  1YD9 A;  2BFQ A;  2FXK A;  3EWP A;  5CBM A;  3Q71 A;  1ZR3 A;  4GUA A;  4ZY0 A;  1ZR5 A;  4ZX9 A;  3KQX A;  4JGK A;  3H8F A;  1TY8 A;  3GPO A;  4GVV A;  4ZY2 A;  5HIH A;  3IID A;  4JVV A;  2BFR A;  2L8R A;  5CMS A;  1LAP A;  4ZI6 A;  4JLL A;  2AFC A;  4TU0 A;  1BPN A;  4X2T A;  4ZY1 A;  2ACF A;  2LGR A;  5FSX A;  3GPQ A;  3PEI A;  3EKE A;  2VRI A;  5FSZ A;  5FSY A;  5AIL A;  5D8N A;  5FSV A;  4ETJ A;  3SIJ A;  3ETI A;  3EJF A;  1GYT A;  3IJ3 A;  3GQE A;  3T8W A;  3H8E A;  4KSI A;  3GPG A;  5HOL A;  2FAV A;  3V2B A; 
#chains in the Genus database with same CATH topology
 3EWQ A;  4IQY A;  4ABL A;  1HJZ A;  3SIH A;  4R76 A;  1LCP A;  1LAM A;  5FSU A;  2X47 A;  3Q6Z A;  1TXZ A;  3V45 A;  3IIF A;  4ZYQ A;  4K0C A;  2XD7 A;  3GQO A;  4ESS A;  5DUS A;  3KQZ A;  4JCA A;  3H8G A;  3KZW A;  4ZX8 A;  5CB3 A;  1BLL E;  4R7M A;  1VHU A;  2DX6 A;  4J5Q A;  4J5S A;  5CB5 A;  2KQV A;  3KR5 A;  4KYB A;  3EWR A;  3EJG A;  4ETK A;  3SIG A;  4K3N A;  4R6T A;  5E3B A;  1NJR A;  2EEE A;  4D86 A;  4J4Z A;  1BPM A;  3JRU A;  1SPV A;  2EWB A;  2J9A A;  3JZT A;  1LAN A;  4GVW A;  2FG1 A;  3EW5 A;  3SII A;  3VFQ A;  3KR4 A;  3EWO A;  4J5R A;  4UML A;  4ABK A;  1YD9 A;  2BFQ A;  2FXK A;  3EWP A;  5CBM A;  2WCT A;  3Q71 A;  1ZR3 A;  4GUA A;  4ZY0 A;  1ZR5 A;  4ZX9 A;  3KQX A;  4JGK A;  3H8F A;  1TY8 A;  3GPO A;  4GVV A;  4ZY2 A;  5HIH A;  3IID A;  4JVV A;  2BFR A;  2JZD A;  2L8R A;  5CMS A;  1LAP A;  4ZI6 A;  4JLL A;  2AFC A;  4TU0 A;  1BPN A;  4X2T A;  4ZY1 A;  2ACF A;  2LGR A;  2JZF A;  2W2G A;  5FSX A;  2JZE A;  3GPQ A;  3PEI A;  3EKE A;  2VRI A;  5FSZ A;  5FSY A;  5AIL A;  5D8N A;  5FSV A;  4ETJ A;  3SIJ A;  3ETI A;  3EJF A;  1GYT A;  3IJ3 A;  3GQE A;  3T8W A;  3H8E A;  4KSI A;  3GPG A;  2RNK A;  5HOL A;  2FAV A;  3V2B A; 
#chains in the Genus database with same CATH homology
 3EWQ A;  4IQY A;  4ABL A;  1HJZ A;  3SIH A;  4R76 A;  1LCP A;  1LAM A;  5FSU A;  2X47 A;  3Q6Z A;  1TXZ A;  3V45 A;  3IIF A;  4ZYQ A;  4K0C A;  2XD7 A;  3GQO A;  4ESS A;  5DUS A;  3KQZ A;  4JCA A;  3H8G A;  3KZW A;  4ZX8 A;  5CB3 A;  1BLL E;  4R7M A;  1VHU A;  2DX6 A;  4J5Q A;  4J5S A;  5CB5 A;  3KR5 A;  4KYB A;  3EWR A;  3EJG A;  4ETK A;  3SIG A;  4K3N A;  4R6T A;  5E3B A;  1NJR A;  2EEE A;  4D86 A;  4J4Z A;  1BPM A;  3JRU A;  1SPV A;  2EWB A;  2J9A A;  3JZT A;  1LAN A;  4GVW A;  2FG1 A;  3EW5 A;  3SII A;  3VFQ A;  3KR4 A;  3EWO A;  4J5R A;  4UML A;  4ABK A;  1YD9 A;  2BFQ A;  2FXK A;  3EWP A;  5CBM A;  3Q71 A;  1ZR3 A;  4GUA A;  4ZY0 A;  1ZR5 A;  4ZX9 A;  3KQX A;  4JGK A;  3H8F A;  1TY8 A;  3GPO A;  4GVV A;  4ZY2 A;  5HIH A;  3IID A;  4JVV A;  2BFR A;  2L8R A;  5CMS A;  1LAP A;  4ZI6 A;  4JLL A;  2AFC A;  4TU0 A;  1BPN A;  4X2T A;  4ZY1 A;  2ACF A;  2LGR A;  5FSX A;  3GPQ A;  3PEI A;  3EKE A;  2VRI A;  5FSZ A;  5FSY A;  5AIL A;  5D8N A;  5FSV A;  4ETJ A;  3SIJ A;  3ETI A;  3EJF A;  1GYT A;  3IJ3 A;  3GQE A;  3T8W A;  3H8E A;  4KSI A;  3GPG A;  5HOL A;  2FAV A;  3V2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...