1TY8A

Crystal structure of yeast ymx7, an adp-ribose-1''-monophosphatase, complexed with adp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
264
structure length
249
Chain Sequence
KMRIILCDTNEVVTNLWQESIPKYLCIHHGHLQSLMDSMRKGDAHSYAIVSPGNSYGYLGGGFDKALYNYFGGKPFETWFRNQLGGRYHTVGSATVVDLQRCLEECRDGIRYIIHVPTVVAPSAPIFNPQNPLKTGFEPVFNAMWNALMHSPKDIDGLIIPGLCTGYAGVPPIISCKSMAFALRLYMAGDHISKELKNVLIMYYLQYPFEPFFPESCKIECQKLGIDIEMLKSFNVEKDAIELLIPRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN YMX7
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical 32.1 kDa protein in ADH3-RCA1 intergenic region
total genus 78
structure length 249
sequence length 264
ec nomenclature ec 3.1.3.84: ADP-ribose 1''-phosphate phosphatase.
pdb deposition date 2004-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14519 Macro_2 Macro-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1ty8A00
4ZX9A 5CBMA 3V45A 2EEEA 4X2TA 3EKEA 4TU0A 3ETIA 1LAMA 2X47A 3Q71A 4K3NA 3EWOA 3IIDA 4D86A 2EWBA 3EWQA 1TY8A 2VRIA 1LCPA 3SIHA 2FXKA 3KQXA 1TXZA 3EWPA 3Q6ZA 4IQYA 1VHUA 4GUAA 2ACFA 3SIJA 4ABKA 3PEIA 5FSUA 3EJGA 1BPNA 5FSXA 5CMSA 1YD9A 2L8RA 4ETJA 4J5RA 4JLLA 2BFQA 5CB5A 3T8WA 3EW5A 3GPGA 3KQZA 2XD7A 3SIGA 4ZY0A 3VFQA 3EJFA 4GVWA 3IJ3A 4ZYQA 2FG1A 5FSZA 4KYBA 4ZY2A 4R6TA 2DX6A 4JCAA 3IIFA 3JRUA 3KR5A 4JGKA 4K0CA 5E3BA 3SIIA 3GQOA 4ABLA 4UMLA 2LGRA 1ZR3A 5FSVA 3H8GA 4J4ZA 4ESSA 4ZX8A 1NJRA 1HJZA 1LAPA 5FSYA 5D8NA 4ZI6A 5HOLA 4ETKA 1GYTA 1BPMA 4J5SA 1LANA 4GVVA 3GPOA 5AILA 2AFCA 5HIHA 5CB3A 3H8FA 3JZTA 2BFRA 3V2BA 1ZR5A 4KSIA 4R76A 4JVVA 3KR4A 2J9AA 1BLLE 3EWRA 3KZWA 4ZY1A 3GQEA 5DUSA 4J5QA 3GPQA 2FAVA 3H8EA 4R7MA 1SPVA
chains in the Genus database with same CATH superfamily
4ZX9A 5CBMA 3V45A 2JZFA 2EEEA 4X2TA 3EKEA 4TU0A 3ETIA 1LAMA 2X47A 3Q71A 4K3NA 3EWOA 3IIDA 4D86A 2EWBA 3EWQA 1TY8A 2W2GA 2VRIA 1LCPA 3SIHA 2FXKA 3KQXA 1TXZA 3EWPA 3Q6ZA 4IQYA 1VHUA 4GUAA 2ACFA 3SIJA 4ABKA 3PEIA 5FSUA 3EJGA 1BPNA 5FSXA 5CMSA 1YD9A 2RNKA 2JZEA 2L8RA 4ETJA 4J5RA 4JLLA 2BFQA 5CB5A 3T8WA 2JZDA 3EW5A 3GPGA 3KQZA 2XD7A 3SIGA 4ZY0A 3VFQA 3EJFA 4GVWA 3IJ3A 4ZYQA 2FG1A 2WCTA 5FSZA 4KYBA 4ZY2A 4R6TA 2DX6A 4JCAA 3IIFA 3JRUA 3KR5A 4JGKA 4K0CA 5E3BA 3SIIA 3GQOA 4ABLA 4UMLA 2LGRA 1ZR3A 5FSVA 3H8GA 4J4ZA 4ESSA 4ZX8A 1NJRA 1HJZA 1LAPA 5FSYA 5D8NA 4ZI6A 5HOLA 4ETKA 1GYTA 1BPMA 4J5SA 1LANA 4GVVA 3GPOA 5AILA 2KQVA 2AFCA 5HIHA 5CB3A 3H8FA 3JZTA 2BFRA 3V2BA 1ZR5A 4KSIA 4JVVA 4R76A 3KR4A 2J9AA 1BLLE 3EWRA 3KZWA 4ZY1A 3GQEA 5DUSA 4J5QA 3GPQA 2FAVA 3H8EA 4R7MA 1SPVA
chains in the Genus database with same CATH topology
4ZX9A 5CBMA 3V45A 2EEEA 4X2TA 3EKEA 4TU0A 3ETIA 1LAMA 2X47A 3Q71A 4K3NA 3EWOA 3IIDA 4D86A 2EWBA 3EWQA 1TY8A 2VRIA 1LCPA 3SIHA 2FXKA 3KQXA 1TXZA 3EWPA 3Q6ZA 4IQYA 1VHUA 4GUAA 2ACFA 3SIJA 4ABKA 3PEIA 5FSUA 3EJGA 1BPNA 5FSXA 5CMSA 1YD9A 2L8RA 4ETJA 4J5RA 4JLLA 2BFQA 5CB5A 3T8WA 3EW5A 3GPGA 3KQZA 2XD7A 3SIGA 4ZY0A 3VFQA 3EJFA 4GVWA 3IJ3A 4ZYQA 2FG1A 5FSZA 4KYBA 4ZY2A 4R6TA 2DX6A 4JCAA 3IIFA 3JRUA 3KR5A 4JGKA 4K0CA 5E3BA 3SIIA 3GQOA 4ABLA 4UMLA 2LGRA 1ZR3A 5FSVA 3H8GA 4J4ZA 4ESSA 4ZX8A 1NJRA 1HJZA 1LAPA 5FSYA 5D8NA 4ZI6A 5HOLA 4ETKA 1GYTA 1BPMA 4J5SA 1LANA 4GVVA 3GPOA 5AILA 2AFCA 5HIHA 5CB3A 3H8FA 3JZTA 2BFRA 3V2BA 1ZR5A 4KSIA 4R76A 4JVVA 3KR4A 2J9AA 1BLLE 3EWRA 3KZWA 4ZY1A 3GQEA 5DUSA 4J5QA 3GPQA 2FAVA 3H8EA 4R7MA 1SPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZX9 A;  5CBM A;  3V45 A;  2EEE A;  4X2T A;  3EKE A;  4TU0 A;  3ETI A;  1LAM A;  2X47 A;  3Q71 A;  4K3N A;  3EWO A;  3IID A;  4D86 A;  2EWB A;  3EWQ A;  1TY8 A;  2VRI A;  1LCP A;  3SIH A;  2FXK A;  3KQX A;  1TXZ A;  3EWP A;  3Q6Z A;  4IQY A;  1VHU A;  4GUA A;  2ACF A;  3SIJ A;  4ABK A;  3PEI A;  5FSU A;  3EJG A;  1BPN A;  5FSX A;  5CMS A;  1YD9 A;  2L8R A;  4ETJ A;  4J5R A;  4JLL A;  2BFQ A;  5CB5 A;  3T8W A;  3EW5 A;  3GPG A;  3KQZ A;  2XD7 A;  3SIG A;  4ZY0 A;  3VFQ A;  3EJF A;  4GVW A;  3IJ3 A;  4ZYQ A;  2FG1 A;  5FSZ A;  4KYB A;  4ZY2 A;  4R6T A;  2DX6 A;  4JCA A;  3IIF A;  3JRU A;  3KR5 A;  4JGK A;  4K0C A;  5E3B A;  3SII A;  3GQO A;  4ABL A;  4UML A;  2LGR A;  1ZR3 A;  5FSV A;  3H8G A;  4J4Z A;  4ESS A;  4ZX8 A;  1NJR A;  1HJZ A;  1LAP A;  5FSY A;  5D8N A;  4ZI6 A;  5HOL A;  4ETK A;  1GYT A;  1BPM A;  4J5S A;  1LAN A;  4GVV A;  3GPO A;  5AIL A;  2AFC A;  5HIH A;  5CB3 A;  3H8F A;  3JZT A;  2BFR A;  3V2B A;  1ZR5 A;  4KSI A;  4R76 A;  4JVV A;  3KR4 A;  2J9A A;  1BLL E;  3EWR A;  3KZW A;  4ZY1 A;  3GQE A;  5DUS A;  4J5Q A;  3GPQ A;  2FAV A;  3H8E A;  4R7M A;  1SPV A; 
#chains in the Genus database with same CATH topology
 4ZX9 A;  5CBM A;  3V45 A;  2JZF A;  2EEE A;  4X2T A;  3EKE A;  4TU0 A;  3ETI A;  1LAM A;  2X47 A;  3Q71 A;  4K3N A;  3EWO A;  3IID A;  4D86 A;  2EWB A;  3EWQ A;  1TY8 A;  2W2G A;  2VRI A;  1LCP A;  3SIH A;  2FXK A;  3KQX A;  1TXZ A;  3EWP A;  3Q6Z A;  4IQY A;  1VHU A;  4GUA A;  2ACF A;  3SIJ A;  4ABK A;  3PEI A;  5FSU A;  3EJG A;  1BPN A;  5FSX A;  5CMS A;  1YD9 A;  2RNK A;  2JZE A;  2L8R A;  4ETJ A;  4J5R A;  4JLL A;  2BFQ A;  5CB5 A;  3T8W A;  2JZD A;  3EW5 A;  3GPG A;  3KQZ A;  2XD7 A;  3SIG A;  4ZY0 A;  3VFQ A;  3EJF A;  4GVW A;  3IJ3 A;  4ZYQ A;  2FG1 A;  2WCT A;  5FSZ A;  4KYB A;  4ZY2 A;  4R6T A;  2DX6 A;  4JCA A;  3IIF A;  3JRU A;  3KR5 A;  4JGK A;  4K0C A;  5E3B A;  3SII A;  3GQO A;  4ABL A;  4UML A;  2LGR A;  1ZR3 A;  5FSV A;  3H8G A;  4J4Z A;  4ESS A;  4ZX8 A;  1NJR A;  1HJZ A;  1LAP A;  5FSY A;  5D8N A;  4ZI6 A;  5HOL A;  4ETK A;  1GYT A;  1BPM A;  4J5S A;  1LAN A;  4GVV A;  3GPO A;  5AIL A;  2KQV A;  2AFC A;  5HIH A;  5CB3 A;  3H8F A;  3JZT A;  2BFR A;  3V2B A;  1ZR5 A;  4KSI A;  4JVV A;  4R76 A;  3KR4 A;  2J9A A;  1BLL E;  3EWR A;  3KZW A;  4ZY1 A;  3GQE A;  5DUS A;  4J5Q A;  3GPQ A;  2FAV A;  3H8E A;  4R7M A;  1SPV A; 
#chains in the Genus database with same CATH homology
 4ZX9 A;  5CBM A;  3V45 A;  2EEE A;  4X2T A;  3EKE A;  4TU0 A;  3ETI A;  1LAM A;  2X47 A;  3Q71 A;  4K3N A;  3EWO A;  3IID A;  4D86 A;  2EWB A;  3EWQ A;  1TY8 A;  2VRI A;  1LCP A;  3SIH A;  2FXK A;  3KQX A;  1TXZ A;  3EWP A;  3Q6Z A;  4IQY A;  1VHU A;  4GUA A;  2ACF A;  3SIJ A;  4ABK A;  3PEI A;  5FSU A;  3EJG A;  1BPN A;  5FSX A;  5CMS A;  1YD9 A;  2L8R A;  4ETJ A;  4J5R A;  4JLL A;  2BFQ A;  5CB5 A;  3T8W A;  3EW5 A;  3GPG A;  3KQZ A;  2XD7 A;  3SIG A;  4ZY0 A;  3VFQ A;  3EJF A;  4GVW A;  3IJ3 A;  4ZYQ A;  2FG1 A;  5FSZ A;  4KYB A;  4ZY2 A;  4R6T A;  2DX6 A;  4JCA A;  3IIF A;  3JRU A;  3KR5 A;  4JGK A;  4K0C A;  5E3B A;  3SII A;  3GQO A;  4ABL A;  4UML A;  2LGR A;  1ZR3 A;  5FSV A;  3H8G A;  4J4Z A;  4ESS A;  4ZX8 A;  1NJR A;  1HJZ A;  1LAP A;  5FSY A;  5D8N A;  4ZI6 A;  5HOL A;  4ETK A;  1GYT A;  1BPM A;  4J5S A;  1LAN A;  4GVV A;  3GPO A;  5AIL A;  2AFC A;  5HIH A;  5CB3 A;  3H8F A;  3JZT A;  2BFR A;  3V2B A;  1ZR5 A;  4KSI A;  4R76 A;  4JVV A;  3KR4 A;  2J9A A;  1BLL E;  3EWR A;  3KZW A;  4ZY1 A;  3GQE A;  5DUS A;  4J5Q A;  3GPQ A;  2FAV A;  3H8E A;  4R7M A;  1SPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...