2DX6A

Crystal structure of conserved hypothetical protein, ttha0132 from thermus thermophilus hb8
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
158
structure length
158
Chain Sequence
ARIRVVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFPLLGTGVGGLPVEAVARVMLEEIKKAPDTLEVTLYGYREEDAEAIRRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein, TTHA0132 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0132
total genus 51
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2dx6A00
3H8FA 5HOLA 2FG1A 3EWOA 4ETJA 2EWBA 4K0CA 1BPMA 1ZR5A 2EEEA 3KZWA 3T8WA 4J5RA 2ACFA 3EWPA 4JGKA 3V2BA 1YD9A 3PEIA 4GVWA 4X2TA 4ESSA 4KSIA 2FAVA 3SIJA 3KR4A 5CB5A 4GUAA 3GPOA 5FSZA 4ABLA 2BFRA 4JVVA 5AILA 1HJZA 3KQXA 5FSXA 1LANA 4IQYA 3IJ3A 3SIIA 3EW5A 1LCPA 4ZI6A 2X47A 3JZTA 3H8EA 1SPVA 3Q6ZA 3SIGA 3H8GA 5HIHA 3VFQA 1LAMA 5CBMA 4R6TA 3IIDA 2DX6A 1VHUA 3GPGA 5CMSA 3Q71A 4J5QA 4D86A 3SIHA 4R76A 4ZY2A 4JLLA 4ZY0A 5FSVA 3GQOA 2L8RA 3KQZA 4ABKA 3EWQA 3KR5A 2XD7A 4K3NA 3IIFA 4GVVA 1NJRA 1BLLE 3V45A 3JRUA 4R7MA 5CB3A 2LGRA 2AFCA 5D8NA 5DUSA 4ETKA 4ZY1A 4JCAA 4J4ZA 1TY8A 1LAPA 1GYTA 3GPQA 2J9AA 3EJFA 2FXKA 4UMLA 4ZX8A 4KYBA 4TU0A 3GQEA 1BPNA 1ZR3A 4J5SA 2VRIA 3EKEA 3EJGA 3EWRA 4ZYQA 4ZX9A 2BFQA 3ETIA 5FSYA 1TXZA 5E3BA 5FSUA
chains in the Genus database with same CATH superfamily
3H8FA 5HOLA 2JZFA 2FG1A 3EWOA 4ETJA 2EWBA 4K0CA 1BPMA 1ZR5A 2EEEA 3KZWA 3T8WA 4J5RA 2ACFA 2W2GA 3EWPA 4JGKA 3V2BA 1YD9A 3PEIA 4GVWA 4X2TA 4ESSA 4KSIA 2FAVA 3SIJA 3KR4A 5CB5A 4GUAA 3GPOA 5FSZA 4ABLA 2BFRA 4JVVA 5AILA 1HJZA 3KQXA 5FSXA 1LANA 4IQYA 3IJ3A 3SIIA 3EW5A 1LCPA 4ZI6A 2X47A 3JZTA 3H8EA 1SPVA 3Q6ZA 3SIGA 2RNKA 3H8GA 5HIHA 3VFQA 1LAMA 5CBMA 4R6TA 3IIDA 2DX6A 1VHUA 3GPGA 5CMSA 3Q71A 4J5QA 4D86A 3SIHA 4R76A 4ZY2A 4JLLA 4ZY0A 5FSVA 3GQOA 2L8RA 3KQZA 4ABKA 3EWQA 3KR5A 2XD7A 4K3NA 3IIFA 4GVVA 1NJRA 1BLLE 3V45A 3JRUA 4R7MA 5CB3A 2LGRA 2AFCA 5D8NA 5DUSA 4ETKA 4ZY1A 4JCAA 4J4ZA 1TY8A 1LAPA 1GYTA 3GPQA 2J9AA 3EJFA 2FXKA 4UMLA 4ZX8A 4KYBA 2JZDA 2KQVA 4TU0A 3GQEA 1BPNA 1ZR3A 4J5SA 2VRIA 3EKEA 3EJGA 3EWRA 4ZYQA 4ZX9A 2WCTA 2BFQA 3ETIA 5FSYA 2JZEA 1TXZA 5E3BA 5FSUA
chains in the Genus database with same CATH topology
3H8FA 5HOLA 2FG1A 3EWOA 4ETJA 2EWBA 4K0CA 1BPMA 1ZR5A 2EEEA 3KZWA 3T8WA 4J5RA 2ACFA 3EWPA 4JGKA 3V2BA 1YD9A 3PEIA 4GVWA 4X2TA 4ESSA 4KSIA 2FAVA 3SIJA 3KR4A 5CB5A 4GUAA 3GPOA 5FSZA 4ABLA 2BFRA 4JVVA 5AILA 1HJZA 3KQXA 5FSXA 1LANA 4IQYA 3IJ3A 3SIIA 3EW5A 1LCPA 4ZI6A 2X47A 3JZTA 3H8EA 1SPVA 3Q6ZA 3SIGA 3H8GA 5HIHA 3VFQA 1LAMA 5CBMA 4R6TA 3IIDA 2DX6A 1VHUA 3GPGA 5CMSA 3Q71A 4J5QA 4D86A 3SIHA 4R76A 4ZY2A 4JLLA 4ZY0A 5FSVA 3GQOA 2L8RA 3KQZA 4ABKA 3EWQA 3KR5A 2XD7A 4K3NA 3IIFA 4GVVA 1NJRA 1BLLE 3V45A 3JRUA 4R7MA 5CB3A 2LGRA 2AFCA 5D8NA 5DUSA 4ETKA 4ZY1A 4JCAA 4J4ZA 1TY8A 1LAPA 1GYTA 3GPQA 2J9AA 3EJFA 2FXKA 4UMLA 4ZX8A 4KYBA 4TU0A 3GQEA 1BPNA 1ZR3A 4J5SA 2VRIA 3EKEA 3EJGA 3EWRA 4ZYQA 4ZX9A 2BFQA 3ETIA 5FSYA 1TXZA 5E3BA 5FSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8F A;  5HOL A;  2FG1 A;  3EWO A;  4ETJ A;  2EWB A;  4K0C A;  1BPM A;  1ZR5 A;  2EEE A;  3KZW A;  3T8W A;  4J5R A;  2ACF A;  3EWP A;  4JGK A;  3V2B A;  1YD9 A;  3PEI A;  4GVW A;  4X2T A;  4ESS A;  4KSI A;  2FAV A;  3SIJ A;  3KR4 A;  5CB5 A;  4GUA A;  3GPO A;  5FSZ A;  4ABL A;  2BFR A;  4JVV A;  5AIL A;  1HJZ A;  3KQX A;  5FSX A;  1LAN A;  4IQY A;  3IJ3 A;  3SII A;  3EW5 A;  1LCP A;  4ZI6 A;  2X47 A;  3JZT A;  3H8E A;  1SPV A;  3Q6Z A;  3SIG A;  3H8G A;  5HIH A;  3VFQ A;  1LAM A;  5CBM A;  4R6T A;  3IID A;  2DX6 A;  1VHU A;  3GPG A;  5CMS A;  3Q71 A;  4J5Q A;  4D86 A;  3SIH A;  4R76 A;  4ZY2 A;  4JLL A;  4ZY0 A;  5FSV A;  3GQO A;  2L8R A;  3KQZ A;  4ABK A;  3EWQ A;  3KR5 A;  2XD7 A;  4K3N A;  3IIF A;  4GVV A;  1NJR A;  1BLL E;  3V45 A;  3JRU A;  4R7M A;  5CB3 A;  2LGR A;  2AFC A;  5D8N A;  5DUS A;  4ETK A;  4ZY1 A;  4JCA A;  4J4Z A;  1TY8 A;  1LAP A;  1GYT A;  3GPQ A;  2J9A A;  3EJF A;  2FXK A;  4UML A;  4ZX8 A;  4KYB A;  4TU0 A;  3GQE A;  1BPN A;  1ZR3 A;  4J5S A;  2VRI A;  3EKE A;  3EJG A;  3EWR A;  4ZYQ A;  4ZX9 A;  2BFQ A;  3ETI A;  5FSY A;  1TXZ A;  5E3B A;  5FSU A; 
#chains in the Genus database with same CATH topology
 3H8F A;  5HOL A;  2JZF A;  2FG1 A;  3EWO A;  4ETJ A;  2EWB A;  4K0C A;  1BPM A;  1ZR5 A;  2EEE A;  3KZW A;  3T8W A;  4J5R A;  2ACF A;  2W2G A;  3EWP A;  4JGK A;  3V2B A;  1YD9 A;  3PEI A;  4GVW A;  4X2T A;  4ESS A;  4KSI A;  2FAV A;  3SIJ A;  3KR4 A;  5CB5 A;  4GUA A;  3GPO A;  5FSZ A;  4ABL A;  2BFR A;  4JVV A;  5AIL A;  1HJZ A;  3KQX A;  5FSX A;  1LAN A;  4IQY A;  3IJ3 A;  3SII A;  3EW5 A;  1LCP A;  4ZI6 A;  2X47 A;  3JZT A;  3H8E A;  1SPV A;  3Q6Z A;  3SIG A;  2RNK A;  3H8G A;  5HIH A;  3VFQ A;  1LAM A;  5CBM A;  4R6T A;  3IID A;  2DX6 A;  1VHU A;  3GPG A;  5CMS A;  3Q71 A;  4J5Q A;  4D86 A;  3SIH A;  4R76 A;  4ZY2 A;  4JLL A;  4ZY0 A;  5FSV A;  3GQO A;  2L8R A;  3KQZ A;  4ABK A;  3EWQ A;  3KR5 A;  2XD7 A;  4K3N A;  3IIF A;  4GVV A;  1NJR A;  1BLL E;  3V45 A;  3JRU A;  4R7M A;  5CB3 A;  2LGR A;  2AFC A;  5D8N A;  5DUS A;  4ETK A;  4ZY1 A;  4JCA A;  4J4Z A;  1TY8 A;  1LAP A;  1GYT A;  3GPQ A;  2J9A A;  3EJF A;  2FXK A;  4UML A;  4ZX8 A;  4KYB A;  2JZD A;  2KQV A;  4TU0 A;  3GQE A;  1BPN A;  1ZR3 A;  4J5S A;  2VRI A;  3EKE A;  3EJG A;  3EWR A;  4ZYQ A;  4ZX9 A;  2WCT A;  2BFQ A;  3ETI A;  5FSY A;  2JZE A;  1TXZ A;  5E3B A;  5FSU A; 
#chains in the Genus database with same CATH homology
 3H8F A;  5HOL A;  2FG1 A;  3EWO A;  4ETJ A;  2EWB A;  4K0C A;  1BPM A;  1ZR5 A;  2EEE A;  3KZW A;  3T8W A;  4J5R A;  2ACF A;  3EWP A;  4JGK A;  3V2B A;  1YD9 A;  3PEI A;  4GVW A;  4X2T A;  4ESS A;  4KSI A;  2FAV A;  3SIJ A;  3KR4 A;  5CB5 A;  4GUA A;  3GPO A;  5FSZ A;  4ABL A;  2BFR A;  4JVV A;  5AIL A;  1HJZ A;  3KQX A;  5FSX A;  1LAN A;  4IQY A;  3IJ3 A;  3SII A;  3EW5 A;  1LCP A;  4ZI6 A;  2X47 A;  3JZT A;  3H8E A;  1SPV A;  3Q6Z A;  3SIG A;  3H8G A;  5HIH A;  3VFQ A;  1LAM A;  5CBM A;  4R6T A;  3IID A;  2DX6 A;  1VHU A;  3GPG A;  5CMS A;  3Q71 A;  4J5Q A;  4D86 A;  3SIH A;  4R76 A;  4ZY2 A;  4JLL A;  4ZY0 A;  5FSV A;  3GQO A;  2L8R A;  3KQZ A;  4ABK A;  3EWQ A;  3KR5 A;  2XD7 A;  4K3N A;  3IIF A;  4GVV A;  1NJR A;  1BLL E;  3V45 A;  3JRU A;  4R7M A;  5CB3 A;  2LGR A;  2AFC A;  5D8N A;  5DUS A;  4ETK A;  4ZY1 A;  4JCA A;  4J4Z A;  1TY8 A;  1LAP A;  1GYT A;  3GPQ A;  2J9A A;  3EJF A;  2FXK A;  4UML A;  4ZX8 A;  4KYB A;  4TU0 A;  3GQE A;  1BPN A;  1ZR3 A;  4J5S A;  2VRI A;  3EKE A;  3EJG A;  3EWR A;  4ZYQ A;  4ZX9 A;  2BFQ A;  3ETI A;  5FSY A;  1TXZ A;  5E3B A;  5FSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...