4ABLA

Human parp14 (artd8, bal2) - macro domain 3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
181
structure length
181
Chain Sequence
FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
total genus 67
structure length 181
sequence length 181
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4ablA00
3IJ3A 4ETJA 3V2BA 1SPVA 3IIDA 4ABKA 3SIGA 3H8FA 4R6TA 3IIFA 5CB3A 4J5SA 2LGRA 5FSZA 2BFQA 5DUSA 3JRUA 3KQXA 5CBMA 4ZY0A 3KR5A 1GYTA 1TY8A 4ZYQA 3JZTA 4GVVA 3V45A 3EWQA 2XD7A 3SIJA 3EW5A 2X47A 3GQOA 1ZR5A 5FSYA 4ESSA 1NJRA 3VFQA 3Q71A 3GPGA 5CB5A 3EWRA 5FSUA 1LANA 5FSXA 4JCAA 5CMSA 3EWOA 2J9AA 5HOLA 2VRIA 2DX6A 3KZWA 4J5QA 1TXZA 3ETIA 1YD9A 3SIHA 4K3NA 3SIIA 2FG1A 4ZX8A 5HIHA 4X2TA 4R76A 4D86A 4JGKA 3H8EA 2FAVA 4GVWA 4KSIA 1BPMA 2FXKA 1LCPA 3KQZA 4TU0A 1ZR3A 3KR4A 4JLLA 5AILA 4R7MA 3EJGA 3T8WA 4J4ZA 2AFCA 2EWBA 1BPNA 1BLLE 5D8NA 4ZY1A 2EEEA 3PEIA 4ZI6A 4ETKA 3Q6ZA 2BFRA 3EWPA 3GPQA 5FSVA 3EJFA 1VHUA 4JVVA 4ZX9A 1LAPA 2L8RA 1HJZA 3GQEA 4IQYA 4GUAA 4UMLA 4ZY2A 3GPOA 4KYBA 4J5RA 5E3BA 3EKEA 2ACFA 4ABLA 4K0CA 1LAMA 3H8GA
chains in the Genus database with same CATH superfamily
3IJ3A 4ETJA 3V2BA 1SPVA 3IIDA 4ABKA 3SIGA 3H8FA 4R6TA 3IIFA 5CB3A 4J5SA 2LGRA 5FSZA 2BFQA 5DUSA 3JRUA 3KQXA 5CBMA 4ZY0A 3KR5A 1GYTA 1TY8A 4ZYQA 3JZTA 4GVVA 3V45A 2KQVA 3EWQA 2XD7A 3SIJA 3EW5A 2X47A 3GQOA 1ZR5A 5FSYA 4ESSA 1NJRA 3VFQA 3Q71A 3GPGA 5CB5A 3EWRA 5FSUA 1LANA 5FSXA 4JCAA 5CMSA 3EWOA 2J9AA 5HOLA 2VRIA 2DX6A 3KZWA 4J5QA 1TXZA 3ETIA 1YD9A 2JZEA 3SIHA 4K3NA 3SIIA 2FG1A 4ZX8A 5HIHA 4X2TA 4R76A 4D86A 4JGKA 3H8EA 2JZFA 2FAVA 4GVWA 4KSIA 1BPMA 2FXKA 1LCPA 3KQZA 4TU0A 1ZR3A 3KR4A 2RNKA 4JLLA 5AILA 4R7MA 3EJGA 3T8WA 4J4ZA 2AFCA 2EWBA 1BPNA 2JZDA 1BLLE 5D8NA 4ZY1A 2EEEA 3PEIA 2W2GA 4ZI6A 2WCTA 4ETKA 3Q6ZA 2BFRA 3EWPA 3GPQA 5FSVA 3EJFA 1VHUA 4JVVA 4ZX9A 1LAPA 2L8RA 1HJZA 3GQEA 4IQYA 4GUAA 4UMLA 4ZY2A 3GPOA 4KYBA 4J5RA 5E3BA 3EKEA 2ACFA 4ABLA 4K0CA 1LAMA 3H8GA
chains in the Genus database with same CATH topology
3IJ3A 4ETJA 3V2BA 1SPVA 3IIDA 4ABKA 3SIGA 3H8FA 4R6TA 3IIFA 5CB3A 4J5SA 2LGRA 5FSZA 2BFQA 5DUSA 3JRUA 3KQXA 5CBMA 4ZY0A 3KR5A 1GYTA 1TY8A 4ZYQA 3JZTA 4GVVA 3V45A 3EWQA 2XD7A 3SIJA 3EW5A 2X47A 3GQOA 1ZR5A 5FSYA 4ESSA 1NJRA 3VFQA 3Q71A 3GPGA 5CB5A 3EWRA 5FSUA 1LANA 5FSXA 4JCAA 5CMSA 3EWOA 2J9AA 5HOLA 2VRIA 2DX6A 3KZWA 4J5QA 1TXZA 3ETIA 1YD9A 3SIHA 4K3NA 3SIIA 2FG1A 4ZX8A 5HIHA 4X2TA 4R76A 4D86A 4JGKA 3H8EA 2FAVA 4GVWA 4KSIA 1BPMA 2FXKA 1LCPA 3KQZA 4TU0A 1ZR3A 3KR4A 4JLLA 5AILA 4R7MA 3EJGA 3T8WA 4J4ZA 2AFCA 2EWBA 1BPNA 1BLLE 5D8NA 4ZY1A 2EEEA 3PEIA 4ZI6A 4ETKA 3Q6ZA 2BFRA 3EWPA 3GPQA 5FSVA 3EJFA 1VHUA 4JVVA 4ZX9A 1LAPA 2L8RA 1HJZA 3GQEA 4IQYA 4GUAA 4UMLA 4ZY2A 3GPOA 4KYBA 4J5RA 5E3BA 3EKEA 2ACFA 4ABLA 4K0CA 1LAMA 3H8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ3 A;  4ETJ A;  3V2B A;  1SPV A;  3IID A;  4ABK A;  3SIG A;  3H8F A;  4R6T A;  3IIF A;  5CB3 A;  4J5S A;  2LGR A;  5FSZ A;  2BFQ A;  5DUS A;  3JRU A;  3KQX A;  5CBM A;  4ZY0 A;  3KR5 A;  1GYT A;  1TY8 A;  4ZYQ A;  3JZT A;  4GVV A;  3V45 A;  3EWQ A;  2XD7 A;  3SIJ A;  3EW5 A;  2X47 A;  3GQO A;  1ZR5 A;  5FSY A;  4ESS A;  1NJR A;  3VFQ A;  3Q71 A;  3GPG A;  5CB5 A;  3EWR A;  5FSU A;  1LAN A;  5FSX A;  4JCA A;  5CMS A;  3EWO A;  2J9A A;  5HOL A;  2VRI A;  2DX6 A;  3KZW A;  4J5Q A;  1TXZ A;  3ETI A;  1YD9 A;  3SIH A;  4K3N A;  3SII A;  2FG1 A;  4ZX8 A;  5HIH A;  4X2T A;  4R76 A;  4D86 A;  4JGK A;  3H8E A;  2FAV A;  4GVW A;  4KSI A;  1BPM A;  2FXK A;  1LCP A;  3KQZ A;  4TU0 A;  1ZR3 A;  3KR4 A;  4JLL A;  5AIL A;  4R7M A;  3EJG A;  3T8W A;  4J4Z A;  2AFC A;  2EWB A;  1BPN A;  1BLL E;  5D8N A;  4ZY1 A;  2EEE A;  3PEI A;  4ZI6 A;  4ETK A;  3Q6Z A;  2BFR A;  3EWP A;  3GPQ A;  5FSV A;  3EJF A;  1VHU A;  4JVV A;  4ZX9 A;  1LAP A;  2L8R A;  1HJZ A;  3GQE A;  4IQY A;  4GUA A;  4UML A;  4ZY2 A;  3GPO A;  4KYB A;  4J5R A;  5E3B A;  3EKE A;  2ACF A;  4ABL A;  4K0C A;  1LAM A;  3H8G A; 
#chains in the Genus database with same CATH topology
 3IJ3 A;  4ETJ A;  3V2B A;  1SPV A;  3IID A;  4ABK A;  3SIG A;  3H8F A;  4R6T A;  3IIF A;  5CB3 A;  4J5S A;  2LGR A;  5FSZ A;  2BFQ A;  5DUS A;  3JRU A;  3KQX A;  5CBM A;  4ZY0 A;  3KR5 A;  1GYT A;  1TY8 A;  4ZYQ A;  3JZT A;  4GVV A;  3V45 A;  2KQV A;  3EWQ A;  2XD7 A;  3SIJ A;  3EW5 A;  2X47 A;  3GQO A;  1ZR5 A;  5FSY A;  4ESS A;  1NJR A;  3VFQ A;  3Q71 A;  3GPG A;  5CB5 A;  3EWR A;  5FSU A;  1LAN A;  5FSX A;  4JCA A;  5CMS A;  3EWO A;  2J9A A;  5HOL A;  2VRI A;  2DX6 A;  3KZW A;  4J5Q A;  1TXZ A;  3ETI A;  1YD9 A;  2JZE A;  3SIH A;  4K3N A;  3SII A;  2FG1 A;  4ZX8 A;  5HIH A;  4X2T A;  4R76 A;  4D86 A;  4JGK A;  3H8E A;  2JZF A;  2FAV A;  4GVW A;  4KSI A;  1BPM A;  2FXK A;  1LCP A;  3KQZ A;  4TU0 A;  1ZR3 A;  3KR4 A;  2RNK A;  4JLL A;  5AIL A;  4R7M A;  3EJG A;  3T8W A;  4J4Z A;  2AFC A;  2EWB A;  1BPN A;  2JZD A;  1BLL E;  5D8N A;  4ZY1 A;  2EEE A;  3PEI A;  2W2G A;  4ZI6 A;  2WCT A;  4ETK A;  3Q6Z A;  2BFR A;  3EWP A;  3GPQ A;  5FSV A;  3EJF A;  1VHU A;  4JVV A;  4ZX9 A;  1LAP A;  2L8R A;  1HJZ A;  3GQE A;  4IQY A;  4GUA A;  4UML A;  4ZY2 A;  3GPO A;  4KYB A;  4J5R A;  5E3B A;  3EKE A;  2ACF A;  4ABL A;  4K0C A;  1LAM A;  3H8G A; 
#chains in the Genus database with same CATH homology
 3IJ3 A;  4ETJ A;  3V2B A;  1SPV A;  3IID A;  4ABK A;  3SIG A;  3H8F A;  4R6T A;  3IIF A;  5CB3 A;  4J5S A;  2LGR A;  5FSZ A;  2BFQ A;  5DUS A;  3JRU A;  3KQX A;  5CBM A;  4ZY0 A;  3KR5 A;  1GYT A;  1TY8 A;  4ZYQ A;  3JZT A;  4GVV A;  3V45 A;  3EWQ A;  2XD7 A;  3SIJ A;  3EW5 A;  2X47 A;  3GQO A;  1ZR5 A;  5FSY A;  4ESS A;  1NJR A;  3VFQ A;  3Q71 A;  3GPG A;  5CB5 A;  3EWR A;  5FSU A;  1LAN A;  5FSX A;  4JCA A;  5CMS A;  3EWO A;  2J9A A;  5HOL A;  2VRI A;  2DX6 A;  3KZW A;  4J5Q A;  1TXZ A;  3ETI A;  1YD9 A;  3SIH A;  4K3N A;  3SII A;  2FG1 A;  4ZX8 A;  5HIH A;  4X2T A;  4R76 A;  4D86 A;  4JGK A;  3H8E A;  2FAV A;  4GVW A;  4KSI A;  1BPM A;  2FXK A;  1LCP A;  3KQZ A;  4TU0 A;  1ZR3 A;  3KR4 A;  4JLL A;  5AIL A;  4R7M A;  3EJG A;  3T8W A;  4J4Z A;  2AFC A;  2EWB A;  1BPN A;  1BLL E;  5D8N A;  4ZY1 A;  2EEE A;  3PEI A;  4ZI6 A;  4ETK A;  3Q6Z A;  2BFR A;  3EWP A;  3GPQ A;  5FSV A;  3EJF A;  1VHU A;  4JVV A;  4ZX9 A;  1LAP A;  2L8R A;  1HJZ A;  3GQE A;  4IQY A;  4GUA A;  4UML A;  4ZY2 A;  3GPO A;  4KYB A;  4J5R A;  5E3B A;  3EKE A;  2ACF A;  4ABL A;  4K0C A;  1LAM A;  3H8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...