4ABLA

Human parp14 (artd8, bal2) - macro domain 3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
181
structure length
181
Chain Sequence
FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 181
sequence length 181
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4ablA00
4JCAA 4ZY2A 3JZTA 2BFQA 3GPGA 3IIDA 4J5RA 4ZYQA 3H8EA 3EWOA 2FXKA 1ZR3A 5E3BA 5FSYA 5CB3A 1LANA 2J9AA 1TY8A 5FSXA 3GPQA 3EWQA 1LAPA 4D86A 4ETJA 3GQEA 2LGRA 4ZY0A 4GVWA 5CBMA 3KQXA 4R6TA 2L8RA 3IJ3A 3PEIA 4ZX8A 4ZI6A 4GVVA 2X47A 3H8GA 2DX6A 5D8NA 3KR4A 4J5QA 1BPMA 1HJZA 2EEEA 3H8FA 1BPNA 5CMSA 4KYBA 3EW5A 3EWPA 4X2TA 3KZWA 3V2BA 4K3NA 5CB5A 3JRUA 4JVVA 2EWBA 4ABKA 5HIHA 3EWRA 1LAMA 3SIJA 4GUAA 4K0CA 3T8WA 3GPOA 2AFCA 5HOLA 3EJFA 4ZY1A 3SIGA 1LCPA 3IIFA 4JLLA 5FSVA 4ZX9A 4J5SA 3SIHA 4ETKA 3V45A 4J4ZA 1SPVA 3KQZA 3GQOA 3VFQA 4R7MA 4JGKA 2XD7A 3EJGA 1BLLE 3EKEA 4R76A 1GYTA 2FAVA 4KSIA 4UMLA 1ZR5A 1VHUA 2BFRA 3ETIA 1YD9A 4ESSA 4ABLA 5DUSA 3Q71A 3Q6ZA 4TU0A 4IQYA 5FSUA 1NJRA 1TXZA 2FG1A 3KR5A 5FSZA 2VRIA 3SIIA 2ACFA 5AILA
chains in the Genus database with same CATH superfamily
4JCAA 4ZY2A 3JZTA 2BFQA 3GPGA 3IIDA 4J5RA 4ZYQA 3H8EA 3EWOA 2FXKA 1ZR3A 5E3BA 5FSYA 5CB3A 1LANA 2J9AA 1TY8A 5FSXA 3GPQA 3EWQA 1LAPA 4D86A 4ETJA 3GQEA 2LGRA 4ZY0A 4GVWA 2JZFA 5CBMA 3KQXA 4R6TA 2L8RA 3IJ3A 3PEIA 4ZX8A 4ZI6A 4GVVA 2X47A 3H8GA 2DX6A 5D8NA 3KR4A 4J5QA 1BPMA 1HJZA 2EEEA 3H8FA 1BPNA 5CMSA 4KYBA 3EW5A 3EWPA 4X2TA 3KZWA 3V2BA 4K3NA 5CB5A 3JRUA 4JVVA 2EWBA 4ABKA 5HIHA 3EWRA 1LAMA 2W2GA 3SIJA 4GUAA 4K0CA 2JZEA 3T8WA 3GPOA 2AFCA 5HOLA 3EJFA 4ZY1A 3SIGA 1LCPA 3IIFA 4JLLA 5FSVA 4ZX9A 4J5SA 3SIHA 4ETKA 3V45A 4J4ZA 1SPVA 3KQZA 2WCTA 2KQVA 3GQOA 3VFQA 4R7MA 4JGKA 2XD7A 3EJGA 1BLLE 3EKEA 4R76A 1GYTA 2FAVA 4KSIA 2RNKA 4UMLA 1ZR5A 1VHUA 2BFRA 3ETIA 1YD9A 4ESSA 4ABLA 5DUSA 3Q71A 3Q6ZA 4TU0A 4IQYA 5FSUA 2JZDA 1NJRA 1TXZA 2FG1A 3KR5A 5FSZA 2VRIA 3SIIA 2ACFA 5AILA
chains in the Genus database with same CATH topology
4JCAA 4ZY2A 3JZTA 2BFQA 3GPGA 3IIDA 4J5RA 4ZYQA 3H8EA 3EWOA 2FXKA 1ZR3A 5E3BA 5FSYA 5CB3A 1LANA 2J9AA 1TY8A 5FSXA 3GPQA 3EWQA 1LAPA 4D86A 4ETJA 3GQEA 2LGRA 4ZY0A 4GVWA 5CBMA 3KQXA 4R6TA 2L8RA 3IJ3A 3PEIA 4ZX8A 4ZI6A 4GVVA 2X47A 3H8GA 2DX6A 5D8NA 3KR4A 4J5QA 1BPMA 1HJZA 2EEEA 3H8FA 1BPNA 5CMSA 4KYBA 3EW5A 3EWPA 4X2TA 3KZWA 3V2BA 4K3NA 5CB5A 3JRUA 4JVVA 2EWBA 4ABKA 5HIHA 3EWRA 1LAMA 3SIJA 4GUAA 4K0CA 3T8WA 3GPOA 2AFCA 5HOLA 3EJFA 4ZY1A 3SIGA 1LCPA 3IIFA 4JLLA 5FSVA 4ZX9A 4J5SA 3SIHA 4ETKA 3V45A 4J4ZA 1SPVA 3KQZA 3GQOA 3VFQA 4R7MA 4JGKA 2XD7A 3EJGA 1BLLE 3EKEA 4R76A 1GYTA 2FAVA 4KSIA 4UMLA 1ZR5A 1VHUA 2BFRA 3ETIA 1YD9A 4ESSA 4ABLA 5DUSA 3Q71A 3Q6ZA 4TU0A 4IQYA 5FSUA 1NJRA 1TXZA 2FG1A 3KR5A 5FSZA 2VRIA 3SIIA 2ACFA 5AILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCA A;  4ZY2 A;  3JZT A;  2BFQ A;  3GPG A;  3IID A;  4J5R A;  4ZYQ A;  3H8E A;  3EWO A;  2FXK A;  1ZR3 A;  5E3B A;  5FSY A;  5CB3 A;  1LAN A;  2J9A A;  1TY8 A;  5FSX A;  3GPQ A;  3EWQ A;  1LAP A;  4D86 A;  4ETJ A;  3GQE A;  2LGR A;  4ZY0 A;  4GVW A;  5CBM A;  3KQX A;  4R6T A;  2L8R A;  3IJ3 A;  3PEI A;  4ZX8 A;  4ZI6 A;  4GVV A;  2X47 A;  3H8G A;  2DX6 A;  5D8N A;  3KR4 A;  4J5Q A;  1BPM A;  1HJZ A;  2EEE A;  3H8F A;  1BPN A;  5CMS A;  4KYB A;  3EW5 A;  3EWP A;  4X2T A;  3KZW A;  3V2B A;  4K3N A;  5CB5 A;  3JRU A;  4JVV A;  2EWB A;  4ABK A;  5HIH A;  3EWR A;  1LAM A;  3SIJ A;  4GUA A;  4K0C A;  3T8W A;  3GPO A;  2AFC A;  5HOL A;  3EJF A;  4ZY1 A;  3SIG A;  1LCP A;  3IIF A;  4JLL A;  5FSV A;  4ZX9 A;  4J5S A;  3SIH A;  4ETK A;  3V45 A;  4J4Z A;  1SPV A;  3KQZ A;  3GQO A;  3VFQ A;  4R7M A;  4JGK A;  2XD7 A;  3EJG A;  1BLL E;  3EKE A;  4R76 A;  1GYT A;  2FAV A;  4KSI A;  4UML A;  1ZR5 A;  1VHU A;  2BFR A;  3ETI A;  1YD9 A;  4ESS A;  4ABL A;  5DUS A;  3Q71 A;  3Q6Z A;  4TU0 A;  4IQY A;  5FSU A;  1NJR A;  1TXZ A;  2FG1 A;  3KR5 A;  5FSZ A;  2VRI A;  3SII A;  2ACF A;  5AIL A; 
#chains in the Genus database with same CATH topology
 4JCA A;  4ZY2 A;  3JZT A;  2BFQ A;  3GPG A;  3IID A;  4J5R A;  4ZYQ A;  3H8E A;  3EWO A;  2FXK A;  1ZR3 A;  5E3B A;  5FSY A;  5CB3 A;  1LAN A;  2J9A A;  1TY8 A;  5FSX A;  3GPQ A;  3EWQ A;  1LAP A;  4D86 A;  4ETJ A;  3GQE A;  2LGR A;  4ZY0 A;  4GVW A;  2JZF A;  5CBM A;  3KQX A;  4R6T A;  2L8R A;  3IJ3 A;  3PEI A;  4ZX8 A;  4ZI6 A;  4GVV A;  2X47 A;  3H8G A;  2DX6 A;  5D8N A;  3KR4 A;  4J5Q A;  1BPM A;  1HJZ A;  2EEE A;  3H8F A;  1BPN A;  5CMS A;  4KYB A;  3EW5 A;  3EWP A;  4X2T A;  3KZW A;  3V2B A;  4K3N A;  5CB5 A;  3JRU A;  4JVV A;  2EWB A;  4ABK A;  5HIH A;  3EWR A;  1LAM A;  2W2G A;  3SIJ A;  4GUA A;  4K0C A;  2JZE A;  3T8W A;  3GPO A;  2AFC A;  5HOL A;  3EJF A;  4ZY1 A;  3SIG A;  1LCP A;  3IIF A;  4JLL A;  5FSV A;  4ZX9 A;  4J5S A;  3SIH A;  4ETK A;  3V45 A;  4J4Z A;  1SPV A;  3KQZ A;  2WCT A;  2KQV A;  3GQO A;  3VFQ A;  4R7M A;  4JGK A;  2XD7 A;  3EJG A;  1BLL E;  3EKE A;  4R76 A;  1GYT A;  2FAV A;  4KSI A;  2RNK A;  4UML A;  1ZR5 A;  1VHU A;  2BFR A;  3ETI A;  1YD9 A;  4ESS A;  4ABL A;  5DUS A;  3Q71 A;  3Q6Z A;  4TU0 A;  4IQY A;  5FSU A;  2JZD A;  1NJR A;  1TXZ A;  2FG1 A;  3KR5 A;  5FSZ A;  2VRI A;  3SII A;  2ACF A;  5AIL A; 
#chains in the Genus database with same CATH homology
 4JCA A;  4ZY2 A;  3JZT A;  2BFQ A;  3GPG A;  3IID A;  4J5R A;  4ZYQ A;  3H8E A;  3EWO A;  2FXK A;  1ZR3 A;  5E3B A;  5FSY A;  5CB3 A;  1LAN A;  2J9A A;  1TY8 A;  5FSX A;  3GPQ A;  3EWQ A;  1LAP A;  4D86 A;  4ETJ A;  3GQE A;  2LGR A;  4ZY0 A;  4GVW A;  5CBM A;  3KQX A;  4R6T A;  2L8R A;  3IJ3 A;  3PEI A;  4ZX8 A;  4ZI6 A;  4GVV A;  2X47 A;  3H8G A;  2DX6 A;  5D8N A;  3KR4 A;  4J5Q A;  1BPM A;  1HJZ A;  2EEE A;  3H8F A;  1BPN A;  5CMS A;  4KYB A;  3EW5 A;  3EWP A;  4X2T A;  3KZW A;  3V2B A;  4K3N A;  5CB5 A;  3JRU A;  4JVV A;  2EWB A;  4ABK A;  5HIH A;  3EWR A;  1LAM A;  3SIJ A;  4GUA A;  4K0C A;  3T8W A;  3GPO A;  2AFC A;  5HOL A;  3EJF A;  4ZY1 A;  3SIG A;  1LCP A;  3IIF A;  4JLL A;  5FSV A;  4ZX9 A;  4J5S A;  3SIH A;  4ETK A;  3V45 A;  4J4Z A;  1SPV A;  3KQZ A;  3GQO A;  3VFQ A;  4R7M A;  4JGK A;  2XD7 A;  3EJG A;  1BLL E;  3EKE A;  4R76 A;  1GYT A;  2FAV A;  4KSI A;  4UML A;  1ZR5 A;  1VHU A;  2BFR A;  3ETI A;  1YD9 A;  4ESS A;  4ABL A;  5DUS A;  3Q71 A;  3Q6Z A;  4TU0 A;  4IQY A;  5FSU A;  1NJR A;  1TXZ A;  2FG1 A;  3KR5 A;  5FSZ A;  2VRI A;  3SII A;  2ACF A;  5AIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...