4ABLA

Human parp14 (artd8, bal2) - macro domain 3
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
181
structure length
181
Chain Sequence
FYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSKAILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPAIGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords POLY [ADP-RIBOSE] POLYMERASE 14
publication title Recognition of Mono-Adp-Ribosylated Artd10 Substrates by Artd8 Macrodomains
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 181
sequence length 181
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4ablA00
5E3BA 3KQZA 5CB5A 3GQOA 1NJRA 2FG1A 4J5QA 5FSZA 3IIDA 5FSXA 5HIHA 3T8WA 4JCAA 4ABLA 4ZX9A 4ESSA 4D86A 3IIFA 3H8FA 1TXZA 2LGRA 3IJ3A 3PEIA 3EKEA 4GVVA 4ZX8A 3GQEA 4K3NA 1BLLE 1LAMA 4KSIA 5CBMA 4ETKA 3JRUA 3EW5A 1SPVA 1BPMA 3EWRA 1ZR5A 2XD7A 3EJFA 2X47A 1LCPA 1TY8A 2J9AA 4R76A 2L8RA 4ETJA 1GYTA 5D8NA 1HJZA 3SIJA 3Q71A 5HOLA 4TU0A 3GPGA 4K0CA 5FSVA 4IQYA 1VHUA 4R6TA 4J4ZA 3V2BA 1LANA 5AILA 3SIIA 4KYBA 4ZY0A 4ZI6A 4JLLA 3V45A 4J5SA 4ZY1A 4X2TA 2FXKA 3EWOA 4UMLA 5DUSA 3GPOA 4ABKA 3H8GA 3KQXA 1LAPA 2EWBA 4JVVA 1BPNA 3EWPA 3VFQA 2DX6A 3KR4A 4ZY2A 3Q6ZA 3ETIA 3SIHA 1ZR3A 2VRIA 1YD9A 3JZTA 3EWQA 4R7MA 3SIGA 4J5RA 3H8EA 2AFCA 4GUAA 5FSYA 2BFQA 2BFRA 5CB3A 2ACFA 3KZWA 4ZYQA 5CMSA 4GVWA 3GPQA 2FAVA 3EJGA 4JGKA 3KR5A 5FSUA 2EEEA
chains in the Genus database with same CATH superfamily
5E3BA 3KQZA 5CB5A 3GQOA 1NJRA 2FG1A 4J5QA 5FSZA 3IIDA 5FSXA 5HIHA 3T8WA 4JCAA 4ABLA 4ZX9A 4ESSA 4D86A 3IIFA 3H8FA 2RNKA 1TXZA 2LGRA 3IJ3A 3PEIA 3EKEA 4GVVA 4ZX8A 3GQEA 4K3NA 1BLLE 1LAMA 4KSIA 5CBMA 4ETKA 3JRUA 3EW5A 1SPVA 1BPMA 3EWRA 1ZR5A 2W2GA 2XD7A 3EJFA 2X47A 2JZDA 1LCPA 1TY8A 2J9AA 4R76A 2L8RA 4ETJA 1GYTA 5D8NA 1HJZA 3SIJA 3Q71A 5HOLA 4TU0A 3GPGA 4K0CA 5FSVA 4IQYA 1VHUA 4R6TA 4J4ZA 2JZFA 3V2BA 1LANA 5AILA 3SIIA 4KYBA 4ZY0A 4ZI6A 4JLLA 3V45A 4J5SA 4ZY1A 2JZEA 4X2TA 2FXKA 3EWOA 4UMLA 5DUSA 3GPOA 4ABKA 3H8GA 3KQXA 1LAPA 2EWBA 2KQVA 4JVVA 1BPNA 3EWPA 3VFQA 2DX6A 3KR4A 4ZY2A 3Q6ZA 3ETIA 3SIHA 1ZR3A 2VRIA 1YD9A 3JZTA 2WCTA 3EWQA 4R7MA 3SIGA 4J5RA 3H8EA 2AFCA 4GUAA 5FSYA 2BFQA 2BFRA 5CB3A 2ACFA 3KZWA 4ZYQA 5CMSA 4GVWA 3GPQA 2FAVA 3EJGA 4JGKA 3KR5A 5FSUA 2EEEA
chains in the Genus database with same CATH topology
5E3BA 3KQZA 5CB5A 3GQOA 1NJRA 2FG1A 4J5QA 5FSZA 3IIDA 5FSXA 5HIHA 3T8WA 4JCAA 4ABLA 4ZX9A 4ESSA 4D86A 3IIFA 3H8FA 1TXZA 2LGRA 3IJ3A 3PEIA 3EKEA 4GVVA 4ZX8A 3GQEA 4K3NA 1BLLE 1LAMA 4KSIA 5CBMA 4ETKA 3JRUA 3EW5A 1SPVA 1BPMA 3EWRA 1ZR5A 2XD7A 3EJFA 2X47A 1LCPA 1TY8A 2J9AA 4R76A 2L8RA 4ETJA 1GYTA 5D8NA 1HJZA 3SIJA 3Q71A 5HOLA 4TU0A 3GPGA 4K0CA 5FSVA 4IQYA 1VHUA 4R6TA 4J4ZA 3V2BA 1LANA 5AILA 3SIIA 4KYBA 4ZY0A 4ZI6A 4JLLA 3V45A 4J5SA 4ZY1A 4X2TA 2FXKA 3EWOA 4UMLA 5DUSA 3GPOA 4ABKA 3H8GA 3KQXA 1LAPA 2EWBA 4JVVA 1BPNA 3EWPA 3VFQA 2DX6A 3KR4A 4ZY2A 3Q6ZA 3ETIA 3SIHA 1ZR3A 2VRIA 1YD9A 3JZTA 3EWQA 4R7MA 3SIGA 4J5RA 3H8EA 2AFCA 4GUAA 5FSYA 2BFQA 2BFRA 5CB3A 2ACFA 3KZWA 4ZYQA 5CMSA 4GVWA 3GPQA 2FAVA 3EJGA 4JGKA 3KR5A 5FSUA 2EEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3B A;  3KQZ A;  5CB5 A;  3GQO A;  1NJR A;  2FG1 A;  4J5Q A;  5FSZ A;  3IID A;  5FSX A;  5HIH A;  3T8W A;  4JCA A;  4ABL A;  4ZX9 A;  4ESS A;  4D86 A;  3IIF A;  3H8F A;  1TXZ A;  2LGR A;  3IJ3 A;  3PEI A;  3EKE A;  4GVV A;  4ZX8 A;  3GQE A;  4K3N A;  1BLL E;  1LAM A;  4KSI A;  5CBM A;  4ETK A;  3JRU A;  3EW5 A;  1SPV A;  1BPM A;  3EWR A;  1ZR5 A;  2XD7 A;  3EJF A;  2X47 A;  1LCP A;  1TY8 A;  2J9A A;  4R76 A;  2L8R A;  4ETJ A;  1GYT A;  5D8N A;  1HJZ A;  3SIJ A;  3Q71 A;  5HOL A;  4TU0 A;  3GPG A;  4K0C A;  5FSV A;  4IQY A;  1VHU A;  4R6T A;  4J4Z A;  3V2B A;  1LAN A;  5AIL A;  3SII A;  4KYB A;  4ZY0 A;  4ZI6 A;  4JLL A;  3V45 A;  4J5S A;  4ZY1 A;  4X2T A;  2FXK A;  3EWO A;  4UML A;  5DUS A;  3GPO A;  4ABK A;  3H8G A;  3KQX A;  1LAP A;  2EWB A;  4JVV A;  1BPN A;  3EWP A;  3VFQ A;  2DX6 A;  3KR4 A;  4ZY2 A;  3Q6Z A;  3ETI A;  3SIH A;  1ZR3 A;  2VRI A;  1YD9 A;  3JZT A;  3EWQ A;  4R7M A;  3SIG A;  4J5R A;  3H8E A;  2AFC A;  4GUA A;  5FSY A;  2BFQ A;  2BFR A;  5CB3 A;  2ACF A;  3KZW A;  4ZYQ A;  5CMS A;  4GVW A;  3GPQ A;  2FAV A;  3EJG A;  4JGK A;  3KR5 A;  5FSU A;  2EEE A; 
#chains in the Genus database with same CATH topology
 5E3B A;  3KQZ A;  5CB5 A;  3GQO A;  1NJR A;  2FG1 A;  4J5Q A;  5FSZ A;  3IID A;  5FSX A;  5HIH A;  3T8W A;  4JCA A;  4ABL A;  4ZX9 A;  4ESS A;  4D86 A;  3IIF A;  3H8F A;  2RNK A;  1TXZ A;  2LGR A;  3IJ3 A;  3PEI A;  3EKE A;  4GVV A;  4ZX8 A;  3GQE A;  4K3N A;  1BLL E;  1LAM A;  4KSI A;  5CBM A;  4ETK A;  3JRU A;  3EW5 A;  1SPV A;  1BPM A;  3EWR A;  1ZR5 A;  2W2G A;  2XD7 A;  3EJF A;  2X47 A;  2JZD A;  1LCP A;  1TY8 A;  2J9A A;  4R76 A;  2L8R A;  4ETJ A;  1GYT A;  5D8N A;  1HJZ A;  3SIJ A;  3Q71 A;  5HOL A;  4TU0 A;  3GPG A;  4K0C A;  5FSV A;  4IQY A;  1VHU A;  4R6T A;  4J4Z A;  2JZF A;  3V2B A;  1LAN A;  5AIL A;  3SII A;  4KYB A;  4ZY0 A;  4ZI6 A;  4JLL A;  3V45 A;  4J5S A;  4ZY1 A;  2JZE A;  4X2T A;  2FXK A;  3EWO A;  4UML A;  5DUS A;  3GPO A;  4ABK A;  3H8G A;  3KQX A;  1LAP A;  2EWB A;  2KQV A;  4JVV A;  1BPN A;  3EWP A;  3VFQ A;  2DX6 A;  3KR4 A;  4ZY2 A;  3Q6Z A;  3ETI A;  3SIH A;  1ZR3 A;  2VRI A;  1YD9 A;  3JZT A;  2WCT A;  3EWQ A;  4R7M A;  3SIG A;  4J5R A;  3H8E A;  2AFC A;  4GUA A;  5FSY A;  2BFQ A;  2BFR A;  5CB3 A;  2ACF A;  3KZW A;  4ZYQ A;  5CMS A;  4GVW A;  3GPQ A;  2FAV A;  3EJG A;  4JGK A;  3KR5 A;  5FSU A;  2EEE A; 
#chains in the Genus database with same CATH homology
 5E3B A;  3KQZ A;  5CB5 A;  3GQO A;  1NJR A;  2FG1 A;  4J5Q A;  5FSZ A;  3IID A;  5FSX A;  5HIH A;  3T8W A;  4JCA A;  4ABL A;  4ZX9 A;  4ESS A;  4D86 A;  3IIF A;  3H8F A;  1TXZ A;  2LGR A;  3IJ3 A;  3PEI A;  3EKE A;  4GVV A;  4ZX8 A;  3GQE A;  4K3N A;  1BLL E;  1LAM A;  4KSI A;  5CBM A;  4ETK A;  3JRU A;  3EW5 A;  1SPV A;  1BPM A;  3EWR A;  1ZR5 A;  2XD7 A;  3EJF A;  2X47 A;  1LCP A;  1TY8 A;  2J9A A;  4R76 A;  2L8R A;  4ETJ A;  1GYT A;  5D8N A;  1HJZ A;  3SIJ A;  3Q71 A;  5HOL A;  4TU0 A;  3GPG A;  4K0C A;  5FSV A;  4IQY A;  1VHU A;  4R6T A;  4J4Z A;  3V2B A;  1LAN A;  5AIL A;  3SII A;  4KYB A;  4ZY0 A;  4ZI6 A;  4JLL A;  3V45 A;  4J5S A;  4ZY1 A;  4X2T A;  2FXK A;  3EWO A;  4UML A;  5DUS A;  3GPO A;  4ABK A;  3H8G A;  3KQX A;  1LAP A;  2EWB A;  4JVV A;  1BPN A;  3EWP A;  3VFQ A;  2DX6 A;  3KR4 A;  4ZY2 A;  3Q6Z A;  3ETI A;  3SIH A;  1ZR3 A;  2VRI A;  1YD9 A;  3JZT A;  3EWQ A;  4R7M A;  3SIG A;  4J5R A;  3H8E A;  2AFC A;  4GUA A;  5FSY A;  2BFQ A;  2BFR A;  5CB3 A;  2ACF A;  3KZW A;  4ZYQ A;  5CMS A;  4GVW A;  3GPQ A;  2FAV A;  3EJG A;  4JGK A;  3KR5 A;  5FSU A;  2EEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...