4J5SA

Targ1 (c6orf130), terminal adp-ribose glycohydrolase 1 adp-ribose complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
146
structure length
146
Chain Sequence
GSHMGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords O-acetyl-ADP-ribose deacetylase 1
publication title Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4j5sA00
3PEIA 2EWBA 1LCPA 3V2BA 4ZX9A 1LANA 3SIIA 5CMSA 4ZYQA 1NJRA 3SIJA 4R7MA 3KR5A 3H8GA 5FSZA 1TXZA 3KR4A 5AILA 3T8WA 2AFCA 4D86A 3JZTA 4ETKA 3VFQA 1HJZA 1LAPA 3EWPA 4JVVA 3SIHA 5HOLA 5CB5A 5CBMA 4X2TA 2FAVA 3GQOA 5E3BA 4ZY1A 3EKEA 2BFQA 4KYBA 3KQZA 4K3NA 3GPQA 5HIHA 1LAMA 3KZWA 2L8RA 1BPMA 4GUAA 4ZI6A 4ZX8A 4ETJA 4TU0A 3EJFA 3IIDA 2DX6A 3H8EA 3EWQA 3EWRA 4ZY0A 4R6TA 5FSVA 4ZY2A 4K0CA 5FSUA 3KQXA 4KSIA 3Q71A 4R76A 4UMLA 5DUSA 4ABKA 3EW5A 1GYTA 1BPNA 1BLLE 2FG1A 1VHUA 3ETIA 4J5SA 1YD9A 2EEEA 4J4ZA 2VRIA 3SIGA 4JLLA 4J5QA 3Q6ZA 2ACFA 3IJ3A 3GPOA 4JCAA 5D8NA 3V45A 5CB3A 5FSXA 3EJGA 3GQEA 4IQYA 2XD7A 4ESSA 1SPVA 3IIFA 5FSYA 4JGKA 1ZR5A 2BFRA 3H8FA 2J9AA 4ABLA 1TY8A 2LGRA 4GVWA 3JRUA 4J5RA 2FXKA 3GPGA 4GVVA 2X47A 3EWOA 1ZR3A
chains in the Genus database with same CATH superfamily
3PEIA 2EWBA 1LCPA 3V2BA 4ZX9A 1LANA 3SIIA 5CMSA 4ZYQA 1NJRA 2JZEA 3SIJA 4R7MA 3KR5A 3H8GA 5FSZA 1TXZA 3KR4A 5AILA 3T8WA 2AFCA 4D86A 3JZTA 4ETKA 3VFQA 1HJZA 1LAPA 3EWPA 4JVVA 3SIHA 5HOLA 5CB5A 5CBMA 4X2TA 2FAVA 3GQOA 5E3BA 4ZY1A 3EKEA 2BFQA 4KYBA 3KQZA 4K3NA 2WCTA 3GPQA 5HIHA 1LAMA 3KZWA 2L8RA 1BPMA 4GUAA 4ZI6A 4ZX8A 4ETJA 4TU0A 3EJFA 3IIDA 2DX6A 3H8EA 3EWQA 3EWRA 4ZY0A 2W2GA 4R6TA 5FSVA 4ZY2A 4K0CA 5FSUA 3KQXA 4KSIA 3Q71A 4R76A 4UMLA 5DUSA 4ABKA 2KQVA 1GYTA 3EW5A 1BPNA 1BLLE 2JZFA 2FG1A 1VHUA 3ETIA 4J5SA 2JZDA 1YD9A 2EEEA 4J4ZA 2VRIA 3SIGA 4JLLA 4J5QA 2RNKA 3Q6ZA 2ACFA 3IJ3A 3GPOA 4JCAA 5D8NA 3V45A 5CB3A 5FSXA 3EJGA 3GQEA 4IQYA 2XD7A 4ESSA 1SPVA 3IIFA 5FSYA 4JGKA 1ZR5A 2BFRA 3H8FA 2J9AA 4ABLA 1TY8A 2LGRA 4GVWA 3JRUA 4J5RA 2FXKA 3GPGA 4GVVA 2X47A 3EWOA 1ZR3A
chains in the Genus database with same CATH topology
3PEIA 2EWBA 1LCPA 3V2BA 4ZX9A 1LANA 3SIIA 5CMSA 4ZYQA 1NJRA 3SIJA 4R7MA 3KR5A 3H8GA 5FSZA 1TXZA 3KR4A 5AILA 3T8WA 2AFCA 4D86A 3JZTA 4ETKA 3VFQA 1HJZA 1LAPA 3EWPA 4JVVA 3SIHA 5HOLA 5CB5A 5CBMA 4X2TA 2FAVA 3GQOA 5E3BA 4ZY1A 3EKEA 2BFQA 4KYBA 3KQZA 4K3NA 3GPQA 5HIHA 1LAMA 3KZWA 2L8RA 1BPMA 4GUAA 4ZI6A 4ZX8A 4ETJA 4TU0A 3EJFA 3IIDA 2DX6A 3H8EA 3EWQA 3EWRA 4ZY0A 4R6TA 5FSVA 4ZY2A 4K0CA 5FSUA 3KQXA 4KSIA 3Q71A 4R76A 4UMLA 5DUSA 4ABKA 3EW5A 1GYTA 1BPNA 1BLLE 2FG1A 1VHUA 3ETIA 4J5SA 1YD9A 2EEEA 4J4ZA 2VRIA 3SIGA 4JLLA 4J5QA 3Q6ZA 2ACFA 3IJ3A 3GPOA 4JCAA 5D8NA 3V45A 5CB3A 5FSXA 3EJGA 3GQEA 4IQYA 2XD7A 4ESSA 1SPVA 3IIFA 5FSYA 4JGKA 1ZR5A 2BFRA 3H8FA 2J9AA 4ABLA 1TY8A 2LGRA 4GVWA 3JRUA 4J5RA 2FXKA 3GPGA 4GVVA 2X47A 3EWOA 1ZR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PEI A;  2EWB A;  1LCP A;  3V2B A;  4ZX9 A;  1LAN A;  3SII A;  5CMS A;  4ZYQ A;  1NJR A;  3SIJ A;  4R7M A;  3KR5 A;  3H8G A;  5FSZ A;  1TXZ A;  3KR4 A;  5AIL A;  3T8W A;  2AFC A;  4D86 A;  3JZT A;  4ETK A;  3VFQ A;  1HJZ A;  1LAP A;  3EWP A;  4JVV A;  3SIH A;  5HOL A;  5CB5 A;  5CBM A;  4X2T A;  2FAV A;  3GQO A;  5E3B A;  4ZY1 A;  3EKE A;  2BFQ A;  4KYB A;  3KQZ A;  4K3N A;  3GPQ A;  5HIH A;  1LAM A;  3KZW A;  2L8R A;  1BPM A;  4GUA A;  4ZI6 A;  4ZX8 A;  4ETJ A;  4TU0 A;  3EJF A;  3IID A;  2DX6 A;  3H8E A;  3EWQ A;  3EWR A;  4ZY0 A;  4R6T A;  5FSV A;  4ZY2 A;  4K0C A;  5FSU A;  3KQX A;  4KSI A;  3Q71 A;  4R76 A;  4UML A;  5DUS A;  4ABK A;  3EW5 A;  1GYT A;  1BPN A;  1BLL E;  2FG1 A;  1VHU A;  3ETI A;  4J5S A;  1YD9 A;  2EEE A;  4J4Z A;  2VRI A;  3SIG A;  4JLL A;  4J5Q A;  3Q6Z A;  2ACF A;  3IJ3 A;  3GPO A;  4JCA A;  5D8N A;  3V45 A;  5CB3 A;  5FSX A;  3EJG A;  3GQE A;  4IQY A;  2XD7 A;  4ESS A;  1SPV A;  3IIF A;  5FSY A;  4JGK A;  1ZR5 A;  2BFR A;  3H8F A;  2J9A A;  4ABL A;  1TY8 A;  2LGR A;  4GVW A;  3JRU A;  4J5R A;  2FXK A;  3GPG A;  4GVV A;  2X47 A;  3EWO A;  1ZR3 A; 
#chains in the Genus database with same CATH topology
 3PEI A;  2EWB A;  1LCP A;  3V2B A;  4ZX9 A;  1LAN A;  3SII A;  5CMS A;  4ZYQ A;  1NJR A;  2JZE A;  3SIJ A;  4R7M A;  3KR5 A;  3H8G A;  5FSZ A;  1TXZ A;  3KR4 A;  5AIL A;  3T8W A;  2AFC A;  4D86 A;  3JZT A;  4ETK A;  3VFQ A;  1HJZ A;  1LAP A;  3EWP A;  4JVV A;  3SIH A;  5HOL A;  5CB5 A;  5CBM A;  4X2T A;  2FAV A;  3GQO A;  5E3B A;  4ZY1 A;  3EKE A;  2BFQ A;  4KYB A;  3KQZ A;  4K3N A;  2WCT A;  3GPQ A;  5HIH A;  1LAM A;  3KZW A;  2L8R A;  1BPM A;  4GUA A;  4ZI6 A;  4ZX8 A;  4ETJ A;  4TU0 A;  3EJF A;  3IID A;  2DX6 A;  3H8E A;  3EWQ A;  3EWR A;  4ZY0 A;  2W2G A;  4R6T A;  5FSV A;  4ZY2 A;  4K0C A;  5FSU A;  3KQX A;  4KSI A;  3Q71 A;  4R76 A;  4UML A;  5DUS A;  4ABK A;  2KQV A;  1GYT A;  3EW5 A;  1BPN A;  1BLL E;  2JZF A;  2FG1 A;  1VHU A;  3ETI A;  4J5S A;  2JZD A;  1YD9 A;  2EEE A;  4J4Z A;  2VRI A;  3SIG A;  4JLL A;  4J5Q A;  2RNK A;  3Q6Z A;  2ACF A;  3IJ3 A;  3GPO A;  4JCA A;  5D8N A;  3V45 A;  5CB3 A;  5FSX A;  3EJG A;  3GQE A;  4IQY A;  2XD7 A;  4ESS A;  1SPV A;  3IIF A;  5FSY A;  4JGK A;  1ZR5 A;  2BFR A;  3H8F A;  2J9A A;  4ABL A;  1TY8 A;  2LGR A;  4GVW A;  3JRU A;  4J5R A;  2FXK A;  3GPG A;  4GVV A;  2X47 A;  3EWO A;  1ZR3 A; 
#chains in the Genus database with same CATH homology
 3PEI A;  2EWB A;  1LCP A;  3V2B A;  4ZX9 A;  1LAN A;  3SII A;  5CMS A;  4ZYQ A;  1NJR A;  3SIJ A;  4R7M A;  3KR5 A;  3H8G A;  5FSZ A;  1TXZ A;  3KR4 A;  5AIL A;  3T8W A;  2AFC A;  4D86 A;  3JZT A;  4ETK A;  3VFQ A;  1HJZ A;  1LAP A;  3EWP A;  4JVV A;  3SIH A;  5HOL A;  5CB5 A;  5CBM A;  4X2T A;  2FAV A;  3GQO A;  5E3B A;  4ZY1 A;  3EKE A;  2BFQ A;  4KYB A;  3KQZ A;  4K3N A;  3GPQ A;  5HIH A;  1LAM A;  3KZW A;  2L8R A;  1BPM A;  4GUA A;  4ZI6 A;  4ZX8 A;  4ETJ A;  4TU0 A;  3EJF A;  3IID A;  2DX6 A;  3H8E A;  3EWQ A;  3EWR A;  4ZY0 A;  4R6T A;  5FSV A;  4ZY2 A;  4K0C A;  5FSU A;  3KQX A;  4KSI A;  3Q71 A;  4R76 A;  4UML A;  5DUS A;  4ABK A;  3EW5 A;  1GYT A;  1BPN A;  1BLL E;  2FG1 A;  1VHU A;  3ETI A;  4J5S A;  1YD9 A;  2EEE A;  4J4Z A;  2VRI A;  3SIG A;  4JLL A;  4J5Q A;  3Q6Z A;  2ACF A;  3IJ3 A;  3GPO A;  4JCA A;  5D8N A;  3V45 A;  5CB3 A;  5FSX A;  3EJG A;  3GQE A;  4IQY A;  2XD7 A;  4ESS A;  1SPV A;  3IIF A;  5FSY A;  4JGK A;  1ZR5 A;  2BFR A;  3H8F A;  2J9A A;  4ABL A;  1TY8 A;  2LGR A;  4GVW A;  3JRU A;  4J5R A;  2FXK A;  3GPG A;  4GVV A;  2X47 A;  3EWO A;  1ZR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...