3H8GA

Bestatin complex structure of leucine aminopeptidase from pseudomonas putida
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
497
structure length
497
Chain Sequence
b'MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
molecule tags Hydrolase
source organism Pseudomonas putida
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
total genus 170
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8gA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8gA02
2OR4A 1YSJA 3EWQA 2PE3A 4GUAA 5CMSA 2FVGA 3KHXA 1LAMA 1ZR5A 3GLJA 3PB6X 3PB7X 2ZOFA 3IIFA 4JGKA 4MCPA 2PIYA 5K8NA 3BI0A 1LOKA 2JEWA 3NH8A 2Q4ZA 2ZEPA 1VHOA 1ZLHA 1VHEA 4R76A 2PRQA 5J1QA 3WT4A 1Z5RA 5FSVA 3KHZA 4MCSA 4JLLA 2VL1A 1Z8LA 4KSIA 2PVWA 1HJZA 2PJCA 4PXCA 5LRKA 3ISXA 1ZG8A 4ETJA 2JBJA 2BFRA 2AFXA 1CX8A 2ABZA 1DE4C 1HEEA 1ELMP 2LGRA 4X8IA 3WABA 1BLLE 3SJGA 3WC7A 5HOLA 1AYEA 2V8GA 4PXBA 5HVHA 1F2PA 2O53A 4OIWA 2PIZA 1XRYA 4Z65A 3EKEA 2POKA 4GM5A 5DUSA 4OP4A 1F57A 3D66A 1Q7LA 2CIJA 1BAVA 2PJ4A 3EJFA 2V8VA 1OBRA 3PFOA 3L2NA 1F2OA 4MRIA 2NYQA 3B7IA 2IMOA 3KL9A 5LYFA 3CPAA 1Y7EA 5JH9A 3NFZA 4IHMA 5CPAA 5ELYA 4KYBA 4JCAA 1TXRA 2JBKA 2ZEOA 2QYVA 2AFCA 4R6TA 4AXVA 3GPOA 1VHUA 1TKFA 3ETIA 4OC5A 4P4JA 4DJLA 1TXZA 2Q51A 3GB0A 4FWUA 4P4BA 3PBEA 1PCAA 5HVGA 1BPNA 2C6GA 5JGFA 2WZNA 1LCPA 3EJGA 4DUKA 4P4EA 2J9AA 2ZELA 2CTCA 3FEDA 3SIJA 2ZEFA 1HDQA 4WJBA 4J5RA 5D8NA 4ZY0A 1NSAA 1CG2A 3QNVA 3RAMA 3MN8A 2AFZA 5E3BA 4NJQA 4UEZA 4GVWA 5JM6A 1QMUA 2Q43A 4OC0A 4ZY2A 4A38A 4ABKA 2CTBA 3FMCA 4P4IA 3IIBA 3BHXA 3B2YA 2FAVA 4W9YA 4X2TA 2ZEMA 3GQOA 1CPSA 2NSMA 2XEIA 4PXEA 3CT9A 2VRIA 1Y0RA 2HB6A 4ZYQA 4MHPA 1IGBA 3EWOA 3FH4A 3IEHA 3NA6A 3PB9X 4UMLA 3S9NA 4MHZA 3VH9A 2PJ8A 3BI1A 3VATA 3FEEA 2BFQA 1AMPA 2PJ7A 3KR4A 3LWUA 4NGNA 4OC2A 3KZWA 3S9MA 2DX6A 3KQZA 1QQ9A 1H8LA 2EK9A 2ANPA 1PYTB 2AFSA 2GREA 1ZG7A 3ISZA 4ZI6A 1DTDA 2ZEGA 4EWTA 2PJAA 1TKHA 4IQYA 1XBUA 2PJBA 3VFQA 1LAPA 4MHNA 1ARMA 1XMBA 4PPZA 3EWPA 3CPXA 3V45A 1ZG9A 5D29A 3TC8A 1Z2LA 2RFHA 3FJUA 3NH4A 4J4ZA 3Q6ZA 3SIGA 2ZENA 2PJ5A 4BD9A 1LFWA 3NH5A 1CPXA 2IQ6A 4NGPA 3KGQA 4RUHA 4EMEA 1LANA 4YU9A 2PVVA 4WWVA 4R7MA 1UWYA 2C6PA 4R8FA 3IC1A 2I3CA 5K8MA 4OMEA 3N5FA 3B3TA 1R3NA 4F9VA 1YMEA 3MRUA 1FNOA 4X3RA 4P4FA 4K0CA 3KQXA 3K2KA 4ZY1A 5FSUA 4NGQA 2PJ2A 4ETKA 1R43A 2EEEA 3JZTA 2IJZA 2RB7A 3DLJA 5LYLA 6CPAA 3FX6A 4J5QA 3V38A 1YW6A 2ZEEA 4NJRA 4P44A 2G9DA 4P6YA 2ZEHA 5FSYA 2C1CA 3B35A 2X47A 5HVFA 4TNUA 1SPVA 2ACFA 2QVPA 4TWEA 2WYRA 3JRUA 2V8DA 3DGVA 4MXUA 3FVLA 5FSXA 4OC3A 3BXMA 3SIIA 4UF4A 1XFOA 3PB4X 3HUVA 1Y0YA 1CBXA 1TKJA 1VIXA 2PJ0A 8CPAA 2C6CA 4JYWA 2PCUA 7CPAA 4NGRA 1YD9A 3SI2A 3VARA 3B3VA 4P4DA 4A94A 4OKOA 4P45A 4TU0A 3B3CA 3SJFA 4FBEA 2XEFA 5THWA 3H8GA 3PFEA 2XEJA 4UIBA 2BOAA 4F8ZA 1NJRA 3D7GA 4K3NA 4PXDA 4FAIA 3D68A 5K8PA 2AFWA 1YW4A 3GUXA 5LYDA 3SJEA 2HC9A 3KASA 4IAVA 4ONWA 3V7ZA 2EK8A 2ZOGA 2ZEDA 4EFDA 4D86A 4P10A 3PEIA 3T8WA 1XJOA 4F9UA 3IWWA 4J5SA 5HIHA 1M4LA 4NGSA 2V8HA 4A39A 2BO9A 3SJXA 2O4HA 3SI0A 1IY7A 5CB3A 4OC1A 5CB5A 1ELLP 5AILA 1TF8A 3GPGA 3Q71A 4H2KA 3K9TA 2CF4A 3PBBA 1RTQA 3S9LA 5LYIA 4MCRA 4CPAA 4ABLA 1GYTA 5DS0A 2GLFA 2PJ6A 3V2BA 2AFUA 3CDXA 2FXKA 1BPMA 3WC6A 3B3SA 4ESSA 3IO1A 2EWBA 1CP7A 4NGMA 3GQEA 5LRGA 4ZX8A 3HLPA 3KI9A 2F8HA 3LMSA 2AFOA 3D7HA 2BCOA 3D4UA 2XEGA 5IB9A 3KR5A 2QJ8A 4A37A 4B6ZA 1ZR3A 4JZ0A 4IK2A 1TY8A 1YLOA 3IFEA 4DYOA 3IIDA 2GU2A 3SI1A 5K8OA 4MCQA 3B3WA 3GPQA 3FECA 2DEAA 1ARLA 4G1PA 4NGTA 4O23A 3IJ3A 4PQAA 5LRJA 3RZAA 3WC5A 4ZX9A 3D67A 2PJ1A 3D7FA 2XD7A 1HDUA 5FSZA 1KWMA 1JQGA 4OC4A 4UEFA 3H8FA 3TX8A 4NFRA 4Q7AA 3EWRA 3EW5A 1FT7A 2OOTA 4FUUA 2V77A 3SIHA 3FF3A 4UIAA 4GVVA 5HXDA 2F7VA 2PJ3A 4MMOA 3D7DA 4JVVA 4MHYA 4UEEA 3PRTA 1TF9A 3H8EA 5I4MA 4LQGA 2AFMA 2L8RA 2PJ9A 1CP6A 4OIDA 4YWYA 1EE3P 5CBMA 2FG1A 3I1UA 3PB8X 1ZLIA 2GLJA 1VGYA 3RBUA 5F09A
chains in the Genus database with same CATH superfamily
2OR4A 4XPDB 1YSJA 2B4DB 3BJ7A 4UBRA 2BUEA 3EWQA 2P6EA 2PE3A 4M6IA 1S7KA 1Q2YA 4R57A 1A2ZA 2Z3KA 4H89A 4UCMA 2Q4YA 4R87A 4GUAA 1QSTA 5CMSA 2CY2A 5IB0A 1X10A 2W2GA 2FVGA 3KHXA 1LAMA 1ZR5A 5A28A 3GLJA 3PB6X 1BO4A 1RXTA 3PB7X 1I1DA 2ZOFA 3FB3A 3IIFA 2CXAA 3FXTA 4JD6A 4R3KA 4JGKA 3IU1A 4MCPA 2PIYA 2ATRA 3D2PA 5K8NA 1S7FA 3BI0A 1LOKA 3D3SA 3N7ZA 5KTAA 2JEWA 3NH8A 2Q4ZA 2D4PA 2ZEPA 1VHOA 2R7HA 2Z0ZA 3UY5A 1ZLHA 1VHEA 4KOYA 4NEXA 4R76A 2PRQA 5H84A 4CRYB 3WT4A 5J1QA 1Z5RA 1S3ZA 4FD6A 3T9YA 5FSVA 2VXKA 2JZDA 2Q4VA 4JLLA 2VL1A 3KHZA 3LACA 4MFLA 1Z8LA 4MCSA 4KSIA 2PVWA 1CJWA 2I79A 4C2XA 4KVME 1HJZA 2PJCA 4PXCA 3S6GA 4AG9A 4AVCA 3ISXA 5LRKA 1ZG8A 2Z3MA 4KSFA 4ETJA 2FL4A 2JBJA 2BFRA 2AFXA 4UFXA 3P2FA 1CX8A 2ABZA 1DE4C 4A2ZA 1HEEA 2AE6A 3CXPA 1ELMP 5FVJA 2LGRA 2O28A 3F8KA 4X8IA 4ORFA 3CXQA 3VWDA 3WABA 5JPHA 1BLLE 1Q2CA 1Z8TA 5AG5A 2KCWA 2P6GA 1S60A 1WWZA 3SJGA 3WC7A 5HOLA 1AYEA 1KUVA 2V8GA 3TTHA 1R57A 2PR8A 4PXBA 4ZGYB 5HVHA 1F2PA 2O53A 4OIWA 3NE8A 2PIZA 1XRYA 4Z65A 3EKEA 2POKA 2Z11A 4GM5A 5DUSA 4OP4A 1F57A 3D66A 1Q7LA 2CIJA 1BAVA 2PJ4A 3EJFA 1YLEA 2V8VA 4HPSA 4PK3A 4R3LA 1OBRA 3PFOA 3L2NA 1F2OA 4MRIA 2NYQA 4UFVA 1RO5A 3C26A 4L89A 3B7IA 2IMOA 4IF5A 3KL9A 1I21A 5LYFA 3CPAA 2J8MA 1Y7EA 5JH9A 3NFZA 4MFPA 4IHMA 4KOTA 5CPAA 5ELYA 4XNHC 2EVNA 3SXOA 1IYLA 4KYBA 4JCAA 2DPTA 2IL4A 4CAWA 1X12A 1TXRA 2JBKA 2ZEOA 1IOIA 2QYVA 2ZPAA 4H6UA 5EC4A 3TOAA 1U6MA 2AFCA 4R6TA 4AXVA 4B5PB 3GPOA 1Z9UA 3S6KA 4UWJA 4J3GA 1VHUA 1TKFA 3ETIA 1Y9WA 3VWEA 1P0HA 3CXSA 4OC5A 4P4JA 4DJLA 2WSAA 1TXZA 2Q51A 3GB0A 4FWUA 3TO7A 4P4BA 4F6AA 2Z3OA 1VKCA 2FSRA 5KTDA 3PBEA 1PCAA 1V0CA 5HVGA 1BPNA 2C6GA 2G0BA 5JGFA 3SXNA 4QC6A 4EWTA 4Y49C 5DWNA 2WZNA 2VEZA 1LCPA 3EJGA 2Q7BA 4DUKA 2C27A 2VI7A 4P4EA 2J9AA 2HUZA 5J8FA 2Z3NA 2D4OA 2CTCA 2ZELA 2QMLA 3FEDA 3SIJA 2ZEFA 4GXHA 1HDQA 4WJBA 4J5RA 5D8NA 2B4BA 4ZY0A 1NSAA 1CG2A 3E0KA 3FNCA 3QNVA 2EO8A 5G1ZA 3RAMA 4NGSA 3R95A 3MN8A 2AFZA 2GANA 5E3BA 4MFQA 4NJQA 4UEZA 1MK4A 2YNDA 4GVWA 4MFZA 4NXYA 5JM6A 1QMUA 3A9LA 4RI1A 2JZEA 4Q36A 2Q43A 4KOWA 4OC0A 4CGNA 4ZY2A 4B5OA 4A38A 5BWAB 4ABKA 4AVAA 2CTBA 2OZHA 3FMCA 4P4IA 3TO9A 4QBJA 1B87A 2B5GB 2R1IA 1ZO0A 4B10A 3I9SA 2RC4A 3BHXA 3IIBA 4HKFA 3B2YA 1YREA 2FAVA 4GS4A 4JLYA 4PSWA 4W9YA 5HH1A 3B8GA 3G3SA 4X2TA 2ZEMA 3EFAA 3GQOA 1CPSA 4KVOE 3TCVA 5F49A 2NSMA 2XEIA 4PXEA 2Y0MA 3CT9A 2X7BA 1NMTA 2VRIA 4C2ZA 1Y0RA 2HB6A 4ZYQA 4OLLA 5AG6A 4JXQA 4MHPA 2VZZA 4M6HA 1Q2DA 1IGBA 3EWOA 3FH4A 3IEHA 2AJ6A 3NA6A 3PB9X 4LX9A 3TE4A 4KLVA 4UMLA 1S5KA 4MHZA 3S9NA 3KKWA 3S6FA 2PJ8A 3VH9A 3BI1A 3VATA 3FEEA 3TOBA 2JEVA 4X5KA 2R98A 2BFQA 4L8AA 1AMPA 2PJ7A 4QB9A 3KR4A 3LWUA 2PRBA 4NGNA 4OC2A 3KZWA 2PQ8A 2R8VA 1IIDA 3S9MA 2DX6A 3KQZA 2GFQA 5EMIA 1QQ9A 1H8LA 2EK9A 1Z8WA 2ANPA 2AFSA 1PYTB 1QSMA 4NF1A 4PV6A 2GREA 3D8PA 1ZG7A 3ISZA 4M85A 4ZI6A 1DTDA 3LD2A 4YFJA 2ZEGA 2B5GA 4NSQA 2PJAA 1QSRA 3EO4A 4CGLA 4QVTA 5GCNA 1WK4A 1TKHA 4IQYA 1XBUA 2J8NA 2PJBA 5IX3A 5IV0A 3ZJ0A 5ISVA 3VFQA 1LAPA 3FYNA 4MHNA 4ONUA 2ZW6A 2NMTA 1ARMA 3R9GA 1XMBA 4PPZA 3EWPA 3MGDA 2JLMA 2ODFA 3CPXA 2YNCA 4U5YA 3V45A 4KZTA 5AG7A 1ZG9A 4CYQA 5D29A 1AUGA 3TC8A 2KQVA 1Z2LA 2RFHA 3FJUA 4JJXA 1XF8A 1CM0A 4J4ZA 3NH4A 1MJ9A 3TT2A 4LUAA 3Q6ZA 3SIGA 2ZENA 2PJ5A 4AVBA 3R9FA 4BD9A 1LFWA 5F48A 2WUUA 4ZBGA 1YK3A 2ZW7A 3NH5A 4CGPA 2VZYA 1CPXA 1JWQA 2IQ6A 2REEA 3KGQA 4NGPA 2PSWA 4B11A 1LANA 4KLWA 4YU9A 4B5PA 4EMEA 4MFKA 3IWEA 2Q04A 2PVVA 4KOSA 4WWVA 2EBJA 2HQYA 4CYOA 3GY9A 3FRMA 4R7MA 3S6HA 4E2AA 5A27A 1UWYA 2C6PA 1S7LA 4R8FA 4B13A 3IC1A 4B12A 2I3CA 2PR1A 3BLNA 5K8MA 1TIQA 4E8OA 4OMEA 3N5FA 1IYKA 3B3TA 2G3TA 4BMHA 1R3NA 4F9VA 1YMEA 3MRUA 3CZXA 1FNOA 4X3RA 1B6BA 4P4FA 2JDCA 3IU2A 1NSLA 1Z4RA 4E0AA 4K0CA 4A39A 3KQXA 2OZGA 4ZY1A 2VBQA 3K2KA 5FSUA 5E96A 2OB0A 4RN7A 3F0AA 1VHSA 2FE7A 4CAEA 4H6ZA 1M1DA 2YNCC 3DSBA 4NGQA 4XPKA 2PJ2A 3WR7A 4CAFA 4ETKA 1R43A 4A33A 2EEEA 3JZTA 2IJZA 1IOFA 2RB7A 2QIRA 3DLJA 1GHEA 5LYLA 5C88A 6CPAA 1N71A 3FX6A 4J5QA 4KOUA 4JWPA 3V38A 1YW6A 1UFHA 2ZEEA 4NJRA 4P44A 4A30A 2G9DA 5AG4A 1YR0A 1IU8A 4P6YA 4YGOA 2ZEHA 5FSYA 3ZZIA 2C1CA 3B35A 2X47A 1XEBA 4TNUA 4KOXA 5HVFA 4BINA 1SPVA 4F0YA 1OZPA 5DWMA 2ACFA 2H5MA 2QVPA 2WYRA 4TWEA 3JRUA 3I3GA 2V8DA 2PC1A 3DGVA 4MXUA 3FVLA 1M4DA 5FSXA 4OC3A 3BXMA 3SIIA 4UF4A 1XFOA 3PB4X 3HUVA 4M6GA 1Y0YA 1SQHA 2Z10A 4MJ8A 1CBXA 1TKJA 1VIXA 2PJ0A 3GKRA 8CPAA 3EY5A 1L0CA 1S7NA 2C6CA 2PCUA 4JYWA 4M3SA 7CPAA 2I00A 4NGRA 2P6FA 1YD9A 4I49A 4KUBA 4KSAA 3B3VA 4P4DA 3SI2A 4MY0A 4OKOA 3VARA 4P45A 2FCKA 3GYAA 4A32A 1IICA 3DNSA 2PDOA 4TU0A 4OADA 4IUSA 3B3CA 3SJFA 4FBEA 2XEFA 3IGRA 2GIVA 3FBUA 2DF5A 4KOVA 1FY7A 3H8GA 1YVKA 2XEJA 3PFEA 4UIBA 2BOAA 5THWA 2FT0A 3W91A 2Q44A 4AB7A 5C82A 1J4JA 4F8ZA 1NJRA 3D7GA 4K3NA 2CNMA 2FIAA 2Q7SA 4YRHA 4PXDA 1I12A 2WPXA 4B14A 3H5ZA 4FAIA 3D68A 2FXFA 1KZFA 1P4NA 5K8PA 3EC4A 2AFWA 1QSOA 1YW4A 2RNKA 2B3VA 4FD5A 3GUXA 4CGOA 1YQEA 5LYDA 2QECA 3SJEA 5G22A 2HC9A 3KASA 4HNYB 4IAVA 4ONWA 3V7ZA 4UCNA 2EK8A 2ZOGA 2ZEDA 4EFDA 5HMNA 3T90A 4D86A 4P10A 3GIUA 3PEIA 3T8WA 1XJOA 4A94A 1IB1E 4F9UA 2JDDA 1K4JA 4J5SA 5HIHA 1M4LA 2GE3A 3IWWA 2V8HA 3FIXA 3LODA 2BO9A 3OWCA 3QAYA 4HNXB 2BEIA 4KORA 4UCPA 3SJXA 2CNSA 2O4HA 4XPLA 3SI0A 1IY7A 5CB3A 2B4DA 1NE9A 4OC1A 5CB5A 2Z3LA 1ELLP 2YNEA 2EUIA 2HV2A 4BBHA 5KTCA 4JXRA 5AILA 3QAHA 1TF8A 3GPGA 2FS5A 3Q71A 4H2KA 4CYNA 2P0WA 3K9TA 2CF4A 3PBBA 4R9MA 2Z3PA 3JTKA 1RTQA 3R96A 4QUSA 4CYPA 4MHDA 4UFWA 5LYIA 4MCRA 3S9LA 4CPAA 3R9EA 3DR6A 3PGPA 1YVOA 1XOVA 4ABLA 1GYTA 4XPDC 5DS0A 2GLFA 1Z4EA 4LQ6A 3RO0A 2B58A 2PJ6A 2F5IA 3P2HA 4K30A 3V2BA 5H86A 2OU2A 2AFUA 4PK2A 3CDXA 2FXKA 1BPMA 3WC6A 3B3SA 4ESSA 3IO1A 2G3AA 2EWBA 2JZFA 1CP7A 4FD7A 3QB8A 1LRZA 1QSNA 5EBVA 4NGMA 4FD4A 3GQEA 3SHPA 5I0CA 3G8WA 4OAEA 1XE4A 3K9UA 4ZX8A 3HLPA 3KI9A 2F8HA 3LMSA 5LRGA 3PP9A 4F0XA 4A95A 4AG7A 2AFOA 3D7HA 2BCOA 4MBUA 4EVYA 3D4UA 4RUHA 2XEGA 5IB9A 3KR5A 2QJ8A 4A37A 4NCZA 2DXQA 3DDDA 4B6ZA 1ZR3A 4JZ0A 4IK2A 1Y7RA 1TY8A 3H4QA 1KUXA 3RNZA 4A31A 4UWIA 1YLOA 1MJBA 3IFEA 3NE7A 4DYOA 2Q0YA 3IIDA 2A4NA 2GU2A 3BJ8A 4Q38A 3SI1A 5K8OA 4MCQA 4MY3A 4KVXA 3RYOA 3B3WA 3GPQA 2WPWA 3FECA 2DEAA 1ARLA 2K5TA 1MJAA 4G1PA 4DNCA 3PZJA 4NGTA 2VQYA 1XMTA 3IJ3A 4O23A 2BL1A 1M44A 4PQAA 5LRJA 3RZAA 3WC5A 4ZX9A 1M4IA 4CGMA 5F46A 5JQ4A 1PUAA 3D67A 4U9YA 3W6SA 4U9ZA 2PJ1A 3D7FA 4C68A 5F47A 4MFJA 2XD7A 4HNWB 3F5BA 1HDUA 5FSZA 1Z8XA 3JVNA 1KWMA 3IWGA 1JQGA 1BOBA 2ZW5A 4Y49B 1M4GA 2B3UA 1KUYA 2ARHA 4OC4A 4UEFA 4II9A 1PU9A 3H8FA 3TX8A 4NFRA 4UA3A 5G21A 2OZUA 4CAVA 4C7HA 1XIXA 3TFYA 4Q7AA 3EWRA 3EW5A 1FT7A 2OOTA 4CS0B 2YGWA 4FUUA 2V77A 2ZW4A 3SIHA 3FF3A 4KS9A 4RS2A 1YX0A 4KUAA 4MI4A 4GVVA 4UIAA 5HXDA 2OH1A 3TO6A 4C2YA 2F7VA 2PJ3A 4MMOA 3D7DA 4JVVA 4MHYA 4UEEA 3PRTA 4CRZB 1TF9A 3D2MA 3H8EA 2J8RA 4XNHB 1YGHA 4PSXA 5I4MA 2BSWA 5AGEA 1ON0A 4LQGA 3V8IA 4CAXA 3JUWA 2AFMA 2L8RA 2PJ9A 1CP6A 4OIDA 4YWYA 3EXNA 2WCTA 1EE3P 3DR8A 2FIWA 4C7IA 5CBMA 3W6XA 2FG1A 2CNTA 2DPSA 2ZXVA 3I1UA 1ZLIA 2REFA 2GLJA 3PB8X 5CNPA 1Y9KA 5J8CA 1VGYA 5G20A 3RBUA 3R1KA 5F09A
chains in the Genus database with same CATH topology
2OR4A 1YSJA 3EWQA 2PE3A 4GUAA 5CMSA 2FVGA 3KHXA 1LAMA 1ZR5A 3GLJA 3PB6X 3PB7X 2ZOFA 3IIFA 4JGKA 4MCPA 2PIYA 5K8NA 3BI0A 1LOKA 2JEWA 3NH8A 2Q4ZA 2ZEPA 1VHOA 1ZLHA 1VHEA 4R76A 2PRQA 5J1QA 3WT4A 1Z5RA 5FSVA 3KHZA 4MCSA 4JLLA 2VL1A 1Z8LA 4KSIA 2PVWA 1HJZA 2PJCA 4PXCA 5LRKA 3ISXA 1ZG8A 4ETJA 2JBJA 2BFRA 2AFXA 1CX8A 2ABZA 1DE4C 1HEEA 1ELMP 2LGRA 4X8IA 3WABA 1BLLE 3SJGA 3WC7A 5HOLA 1AYEA 2V8GA 4PXBA 5HVHA 1F2PA 2O53A 4OIWA 2PIZA 1XRYA 4Z65A 3EKEA 2POKA 4GM5A 5DUSA 4OP4A 1F57A 3D66A 1Q7LA 2CIJA 1BAVA 2PJ4A 3EJFA 2V8VA 1OBRA 3PFOA 3L2NA 1F2OA 4MRIA 2NYQA 3B7IA 2IMOA 3KL9A 5LYFA 3CPAA 1Y7EA 5JH9A 3NFZA 4IHMA 5CPAA 5ELYA 4KYBA 4JCAA 1TXRA 2JBKA 2ZEOA 2QYVA 2AFCA 4R6TA 4AXVA 3GPOA 1VHUA 1TKFA 3ETIA 4OC5A 4P4JA 4DJLA 1TXZA 2Q51A 3GB0A 4FWUA 4P4BA 3PBEA 1PCAA 5HVGA 1BPNA 2C6GA 5JGFA 2WZNA 1LCPA 3EJGA 4DUKA 4P4EA 2J9AA 2ZELA 2CTCA 3FEDA 3SIJA 2ZEFA 1HDQA 4WJBA 4J5RA 5D8NA 4ZY0A 1NSAA 1CG2A 3QNVA 3RAMA 3MN8A 2AFZA 5E3BA 4NJQA 4UEZA 4GVWA 5JM6A 1QMUA 2Q43A 4OC0A 4ZY2A 4A38A 4ABKA 2CTBA 3FMCA 4P4IA 3IIBA 3BHXA 3B2YA 2FAVA 4W9YA 4X2TA 2ZEMA 3GQOA 1CPSA 2NSMA 2XEIA 4PXEA 3CT9A 2VRIA 1Y0RA 2HB6A 4ZYQA 4MHPA 1IGBA 3EWOA 3FH4A 3IEHA 3NA6A 3PB9X 4UMLA 3S9NA 4MHZA 3VH9A 2PJ8A 3BI1A 3VATA 3FEEA 2BFQA 1AMPA 2PJ7A 3KR4A 3LWUA 4NGNA 4OC2A 3KZWA 3S9MA 2DX6A 3KQZA 1QQ9A 1H8LA 2EK9A 2ANPA 1PYTB 2AFSA 2GREA 1ZG7A 3ISZA 4ZI6A 1DTDA 2ZEGA 4EWTA 2PJAA 1TKHA 4IQYA 1XBUA 2PJBA 3VFQA 1LAPA 4MHNA 1ARMA 1XMBA 4PPZA 3EWPA 3CPXA 3V45A 1ZG9A 5D29A 3TC8A 1Z2LA 2RFHA 3FJUA 3NH4A 4J4ZA 3Q6ZA 3SIGA 2ZENA 2PJ5A 4BD9A 1LFWA 3NH5A 1CPXA 2IQ6A 4NGPA 3KGQA 4RUHA 4EMEA 1LANA 4YU9A 2PVVA 4WWVA 4R7MA 1UWYA 2C6PA 4R8FA 3IC1A 2I3CA 5K8MA 4OMEA 3N5FA 3B3TA 1R3NA 4F9VA 1YMEA 3MRUA 1FNOA 4X3RA 4P4FA 4K0CA 3KQXA 3K2KA 4ZY1A 5FSUA 4NGQA 2PJ2A 4ETKA 1R43A 2EEEA 3JZTA 2IJZA 2RB7A 3DLJA 5LYLA 6CPAA 3FX6A 4J5QA 3V38A 1YW6A 2ZEEA 4NJRA 4P44A 2G9DA 4P6YA 2ZEHA 5FSYA 2C1CA 3B35A 2X47A 5HVFA 4TNUA 1SPVA 2ACFA 2QVPA 4TWEA 2WYRA 3JRUA 2V8DA 3DGVA 4MXUA 3FVLA 5FSXA 4OC3A 3BXMA 3SIIA 4UF4A 1XFOA 3PB4X 3HUVA 1Y0YA 1CBXA 1TKJA 1VIXA 2PJ0A 8CPAA 2C6CA 4JYWA 2PCUA 7CPAA 4NGRA 1YD9A 3SI2A 3VARA 3B3VA 4P4DA 4A94A 4OKOA 4P45A 4TU0A 3B3CA 3SJFA 4FBEA 2XEFA 5THWA 3H8GA 3PFEA 2XEJA 4UIBA 2BOAA 4F8ZA 1NJRA 3D7GA 4K3NA 4PXDA 4FAIA 3D68A 5K8PA 2AFWA 1YW4A 3GUXA 5LYDA 3SJEA 2HC9A 3KASA 4IAVA 4ONWA 3V7ZA 2EK8A 2ZOGA 2ZEDA 4EFDA 4D86A 4P10A 3PEIA 3T8WA 1XJOA 4F9UA 3IWWA 4J5SA 5HIHA 1M4LA 4NGSA 2V8HA 4A39A 2BO9A 3SJXA 2O4HA 3SI0A 1IY7A 5CB3A 4OC1A 5CB5A 1ELLP 5AILA 1TF8A 3GPGA 3Q71A 4H2KA 3K9TA 2CF4A 3PBBA 1RTQA 3S9LA 5LYIA 4MCRA 4CPAA 4ABLA 1GYTA 5DS0A 2GLFA 2PJ6A 3V2BA 2AFUA 3CDXA 2FXKA 1BPMA 3WC6A 3B3SA 4ESSA 3IO1A 2EWBA 1CP7A 4NGMA 3GQEA 5LRGA 4ZX8A 3HLPA 3KI9A 2F8HA 3LMSA 2AFOA 3D7HA 2BCOA 3D4UA 2XEGA 5IB9A 3KR5A 2QJ8A 4A37A 4B6ZA 1ZR3A 4JZ0A 4IK2A 1TY8A 1YLOA 3IFEA 4DYOA 3IIDA 2GU2A 3SI1A 5K8OA 4MCQA 3B3WA 3GPQA 3FECA 2DEAA 1ARLA 4G1PA 4NGTA 4O23A 3IJ3A 4PQAA 5LRJA 3RZAA 3WC5A 4ZX9A 3D67A 2PJ1A 3D7FA 2XD7A 1HDUA 5FSZA 1KWMA 1JQGA 4OC4A 4UEFA 3H8FA 3TX8A 4NFRA 4Q7AA 3EWRA 3EW5A 1FT7A 2OOTA 4FUUA 2V77A 3SIHA 3FF3A 4UIAA 4GVVA 5HXDA 2F7VA 2PJ3A 4MMOA 3D7DA 4JVVA 4MHYA 4UEEA 3PRTA 1TF9A 3H8EA 5I4MA 4LQGA 2AFMA 2L8RA 2PJ9A 1CP6A 4OIDA 4YWYA 1EE3P 5CBMA 2FG1A 3I1UA 3PB8X 1ZLIA 2GLJA 1VGYA 3RBUA 5F09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OR4 A;  1YSJ A;  3EWQ A;  2PE3 A;  4GUA A;  5CMS A;  2FVG A;  3KHX A;  1LAM A;  1ZR5 A;  3GLJ A;  3PB6 X;  3PB7 X;  2ZOF A;  3IIF A;  4JGK A;  4MCP A;  2PIY A;  5K8N A;  3BI0 A;  1LOK A;  2JEW A;  3NH8 A;  2Q4Z A;  2ZEP A;  1VHO A;  1ZLH A;  1VHE A;  4R76 A;  2PRQ A;  5J1Q A;  3WT4 A;  1Z5R A;  5FSV A;  3KHZ A;  4MCS A;  4JLL A;  2VL1 A;  1Z8L A;  4KSI A;  2PVW A;  1HJZ A;  2PJC A;  4PXC A;  5LRK A;  3ISX A;  1ZG8 A;  4ETJ A;  2JBJ A;  2BFR A;  2AFX A;  1CX8 A;  2ABZ A;  1DE4 C;  1HEE A;  1ELM P;  2LGR A;  4X8I A;  3WAB A;  1BLL E;  3SJG A;  3WC7 A;  5HOL A;  1AYE A;  2V8G A;  4PXB A;  5HVH A;  1F2P A;  2O53 A;  4OIW A;  2PIZ A;  1XRY A;  4Z65 A;  3EKE A;  2POK A;  4GM5 A;  5DUS A;  4OP4 A;  1F57 A;  3D66 A;  1Q7L A;  2CIJ A;  1BAV A;  2PJ4 A;  3EJF A;  2V8V A;  1OBR A;  3PFO A;  3L2N A;  1F2O A;  4MRI A;  2NYQ A;  3B7I A;  2IMO A;  3KL9 A;  5LYF A;  3CPA A;  1Y7E A;  5JH9 A;  3NFZ A;  4IHM A;  5CPA A;  5ELY A;  4KYB A;  4JCA A;  1TXR A;  2JBK A;  2ZEO A;  2QYV A;  2AFC A;  4R6T A;  4AXV A;  3GPO A;  1VHU A;  1TKF A;  3ETI A;  4OC5 A;  4P4J A;  4DJL A;  1TXZ A;  2Q51 A;  3GB0 A;  4FWU A;  4P4B A;  3PBE A;  1PCA A;  5HVG A;  1BPN A;  2C6G A;  5JGF A;  2WZN A;  1LCP A;  3EJG A;  4DUK A;  4P4E A;  2J9A A;  2ZEL A;  2CTC A;  3FED A;  3SIJ A;  2ZEF A;  1HDQ A;  4WJB A;  4J5R A;  5D8N A;  4ZY0 A;  1NSA A;  1CG2 A;  3QNV A;  3RAM A;  3MN8 A;  2AFZ A;  5E3B A;  4NJQ A;  4UEZ A;  4GVW A;  5JM6 A;  1QMU A;  2Q43 A;  4OC0 A;  4ZY2 A;  4A38 A;  4ABK A;  2CTB A;  3FMC A;  4P4I A;  3IIB A;  3BHX A;  3B2Y A;  2FAV A;  4W9Y A;  4X2T A;  2ZEM A;  3GQO A;  1CPS A;  2NSM A;  2XEI A;  4PXE A;  3CT9 A;  2VRI A;  1Y0R A;  2HB6 A;  4ZYQ A;  4MHP A;  1IGB A;  3EWO A;  3FH4 A;  3IEH A;  3NA6 A;  3PB9 X;  4UML A;  3S9N A;  4MHZ A;  3VH9 A;  2PJ8 A;  3BI1 A;  3VAT A;  3FEE A;  2BFQ A;  1AMP A;  2PJ7 A;  3KR4 A;  3LWU A;  4NGN A;  4OC2 A;  3KZW A;  3S9M A;  2DX6 A;  3KQZ A;  1QQ9 A;  1H8L A;  2EK9 A;  2ANP A;  1PYT B;  2AFS A;  2GRE A;  1ZG7 A;  3ISZ A;  4ZI6 A;  1DTD A;  2ZEG A;  4EWT A;  2PJA A;  1TKH A;  4IQY A;  1XBU A;  2PJB A;  3VFQ A;  1LAP A;  4MHN A;  1ARM A;  1XMB A;  4PPZ A;  3EWP A;  3CPX A;  3V45 A;  1ZG9 A;  5D29 A;  3TC8 A;  1Z2L A;  2RFH A;  3FJU A;  3NH4 A;  4J4Z A;  3Q6Z A;  3SIG A;  2ZEN A;  2PJ5 A;  4BD9 A;  1LFW A;  3NH5 A;  1CPX A;  2IQ6 A;  4NGP A;  3KGQ A;  4RUH A;  4EME A;  1LAN A;  4YU9 A;  2PVV A;  4WWV A;  4R7M A;  1UWY A;  2C6P A;  4R8F A;  3IC1 A;  2I3C A;  5K8M A;  4OME A;  3N5F A;  3B3T A;  1R3N A;  4F9V A;  1YME A;  3MRU A;  1FNO A;  4X3R A;  4P4F A;  4K0C A;  3KQX A;  3K2K A;  4ZY1 A;  5FSU A;  4NGQ A;  2PJ2 A;  4ETK A;  1R43 A;  2EEE A;  3JZT A;  2IJZ A;  2RB7 A;  3DLJ A;  5LYL A;  6CPA A;  3FX6 A;  4J5Q A;  3V38 A;  1YW6 A;  2ZEE A;  4NJR A;  4P44 A;  2G9D A;  4P6Y A;  2ZEH A;  5FSY A;  2C1C A;  3B35 A;  2X47 A;  5HVF A;  4TNU A;  1SPV A;  2ACF A;  2QVP A;  4TWE A;  2WYR A;  3JRU A;  2V8D A;  3DGV A;  4MXU A;  3FVL A;  5FSX A;  4OC3 A;  3BXM A;  3SII A;  4UF4 A;  1XFO A;  3PB4 X;  3HUV A;  1Y0Y A;  1CBX A;  1TKJ A;  1VIX A;  2PJ0 A;  8CPA A;  2C6C A;  4JYW A;  2PCU A;  7CPA A;  4NGR A;  1YD9 A;  3SI2 A;  3VAR A;  3B3V A;  4P4D A;  4A94 A;  4OKO A;  4P45 A;  4TU0 A;  3B3C A;  3SJF A;  4FBE A;  2XEF A;  5THW A;  3H8G A;  3PFE A;  2XEJ A;  4UIB A;  2BOA A;  4F8Z A;  1NJR A;  3D7G A;  4K3N A;  4PXD A;  4FAI A;  3D68 A;  5K8P A;  2AFW A;  1YW4 A;  3GUX A;  5LYD A;  3SJE A;  2HC9 A;  3KAS A;  4IAV A;  4ONW A;  3V7Z A;  2EK8 A;  2ZOG A;  2ZED A;  4EFD A;  4D86 A;  4P10 A;  3PEI A;  3T8W A;  1XJO A;  4F9U A;  3IWW A;  4J5S A;  5HIH A;  1M4L A;  4NGS A;  2V8H A;  4A39 A;  2BO9 A;  3SJX A;  2O4H A;  3SI0 A;  1IY7 A;  5CB3 A;  4OC1 A;  5CB5 A;  1ELL P;  5AIL A;  1TF8 A;  3GPG A;  3Q71 A;  4H2K A;  3K9T A;  2CF4 A;  3PBB A;  1RTQ A;  3S9L A;  5LYI A;  4MCR A;  4CPA A;  4ABL A;  1GYT A;  5DS0 A;  2GLF A;  2PJ6 A;  3V2B A;  2AFU A;  3CDX A;  2FXK A;  1BPM A;  3WC6 A;  3B3S A;  4ESS A;  3IO1 A;  2EWB A;  1CP7 A;  4NGM A;  3GQE A;  5LRG A;  4ZX8 A;  3HLP A;  3KI9 A;  2F8H A;  3LMS A;  2AFO A;  3D7H A;  2BCO A;  3D4U A;  2XEG A;  5IB9 A;  3KR5 A;  2QJ8 A;  4A37 A;  4B6Z A;  1ZR3 A;  4JZ0 A;  4IK2 A;  1TY8 A;  1YLO A;  3IFE A;  4DYO A;  3IID A;  2GU2 A;  3SI1 A;  5K8O A;  4MCQ A;  3B3W A;  3GPQ A;  3FEC A;  2DEA A;  1ARL A;  4G1P A;  4NGT A;  4O23 A;  3IJ3 A;  4PQA A;  5LRJ A;  3RZA A;  3WC5 A;  4ZX9 A;  3D67 A;  2PJ1 A;  3D7F A;  2XD7 A;  1HDU A;  5FSZ A;  1KWM A;  1JQG A;  4OC4 A;  4UEF A;  3H8F A;  3TX8 A;  4NFR A;  4Q7A A;  3EWR A;  3EW5 A;  1FT7 A;  2OOT A;  4FUU A;  2V77 A;  3SIH A;  3FF3 A;  4UIA A;  4GVV A;  5HXD A;  2F7V A;  2PJ3 A;  4MMO A;  3D7D A;  4JVV A;  4MHY A;  4UEE A;  3PRT A;  1TF9 A;  3H8E A;  5I4M A;  4LQG A;  2AFM A;  2L8R A;  2PJ9 A;  1CP6 A;  4OID A;  4YWY A;  1EE3 P;  5CBM A;  2FG1 A;  3I1U A;  3PB8 X;  1ZLI A;  2GLJ A;  1VGY A;  3RBU A;  5F09 A; 
#chains in the Genus database with same CATH topology
 2OR4 A;  4XPD B;  1YSJ A;  2B4D B;  3BJ7 A;  4UBR A;  2BUE A;  3EWQ A;  2P6E A;  2PE3 A;  4M6I A;  1S7K A;  1Q2Y A;  4R57 A;  1A2Z A;  2Z3K A;  4H89 A;  4UCM A;  2Q4Y A;  4R87 A;  4GUA A;  1QST A;  5CMS A;  2CY2 A;  5IB0 A;  1X10 A;  2W2G A;  2FVG A;  3KHX A;  1LAM A;  1ZR5 A;  5A28 A;  3GLJ A;  3PB6 X;  1BO4 A;  1RXT A;  3PB7 X;  1I1D A;  2ZOF A;  3FB3 A;  3IIF A;  2CXA A;  3FXT A;  4JD6 A;  4R3K A;  4JGK A;  3IU1 A;  4MCP A;  2PIY A;  2ATR A;  3D2P A;  5K8N A;  1S7F A;  3BI0 A;  1LOK A;  3D3S A;  3N7Z A;  5KTA A;  2JEW A;  3NH8 A;  2Q4Z A;  2D4P A;  2ZEP A;  1VHO A;  2R7H A;  2Z0Z A;  3UY5 A;  1ZLH A;  1VHE A;  4KOY A;  4NEX A;  4R76 A;  2PRQ A;  5H84 A;  4CRY B;  3WT4 A;  5J1Q A;  1Z5R A;  1S3Z A;  4FD6 A;  3T9Y A;  5FSV A;  2VXK A;  2JZD A;  2Q4V A;  4JLL A;  2VL1 A;  3KHZ A;  3LAC A;  4MFL A;  1Z8L A;  4MCS A;  4KSI A;  2PVW A;  1CJW A;  2I79 A;  4C2X A;  4KVM E;  1HJZ A;  2PJC A;  4PXC A;  3S6G A;  4AG9 A;  4AVC A;  3ISX A;  5LRK A;  1ZG8 A;  2Z3M A;  4KSF A;  4ETJ A;  2FL4 A;  2JBJ A;  2BFR A;  2AFX A;  4UFX A;  3P2F A;  1CX8 A;  2ABZ A;  1DE4 C;  4A2Z A;  1HEE A;  2AE6 A;  3CXP A;  1ELM P;  5FVJ A;  2LGR A;  2O28 A;  3F8K A;  4X8I A;  4ORF A;  3CXQ A;  3VWD A;  3WAB A;  5JPH A;  1BLL E;  1Q2C A;  1Z8T A;  5AG5 A;  2KCW A;  2P6G A;  1S60 A;  1WWZ A;  3SJG A;  3WC7 A;  5HOL A;  1AYE A;  1KUV A;  2V8G A;  3TTH A;  1R57 A;  2PR8 A;  4PXB A;  4ZGY B;  5HVH A;  1F2P A;  2O53 A;  4OIW A;  3NE8 A;  2PIZ A;  1XRY A;  4Z65 A;  3EKE A;  2POK A;  2Z11 A;  4GM5 A;  5DUS A;  4OP4 A;  1F57 A;  3D66 A;  1Q7L A;  2CIJ A;  1BAV A;  2PJ4 A;  3EJF A;  1YLE A;  2V8V A;  4HPS A;  4PK3 A;  4R3L A;  1OBR A;  3PFO A;  3L2N A;  1F2O A;  4MRI A;  2NYQ A;  4UFV A;  1RO5 A;  3C26 A;  4L89 A;  3B7I A;  2IMO A;  4IF5 A;  3KL9 A;  1I21 A;  5LYF A;  3CPA A;  2J8M A;  1Y7E A;  5JH9 A;  3NFZ A;  4MFP A;  4IHM A;  4KOT A;  5CPA A;  5ELY A;  4XNH C;  2EVN A;  3SXO A;  1IYL A;  4KYB A;  4JCA A;  2DPT A;  2IL4 A;  4CAW A;  1X12 A;  1TXR A;  2JBK A;  2ZEO A;  1IOI A;  2QYV A;  2ZPA A;  4H6U A;  5EC4 A;  3TOA A;  1U6M A;  2AFC A;  4R6T A;  4AXV A;  4B5P B;  3GPO A;  1Z9U A;  3S6K A;  4UWJ A;  4J3G A;  1VHU A;  1TKF A;  3ETI A;  1Y9W A;  3VWE A;  1P0H A;  3CXS A;  4OC5 A;  4P4J A;  4DJL A;  2WSA A;  1TXZ A;  2Q51 A;  3GB0 A;  4FWU A;  3TO7 A;  4P4B A;  4F6A A;  2Z3O A;  1VKC A;  2FSR A;  5KTD A;  3PBE A;  1PCA A;  1V0C A;  5HVG A;  1BPN A;  2C6G A;  2G0B A;  5JGF A;  3SXN A;  4QC6 A;  4EWT A;  4Y49 C;  5DWN A;  2WZN A;  2VEZ A;  1LCP A;  3EJG A;  2Q7B A;  4DUK A;  2C27 A;  2VI7 A;  4P4E A;  2J9A A;  2HUZ A;  5J8F A;  2Z3N A;  2D4O A;  2CTC A;  2ZEL A;  2QML A;  3FED A;  3SIJ A;  2ZEF A;  4GXH A;  1HDQ A;  4WJB A;  4J5R A;  5D8N A;  2B4B A;  4ZY0 A;  1NSA A;  1CG2 A;  3E0K A;  3FNC A;  3QNV A;  2EO8 A;  5G1Z A;  3RAM A;  4NGS A;  3R95 A;  3MN8 A;  2AFZ A;  2GAN A;  5E3B A;  4MFQ A;  4NJQ A;  4UEZ A;  1MK4 A;  2YND A;  4GVW A;  4MFZ A;  4NXY A;  5JM6 A;  1QMU A;  3A9L A;  4RI1 A;  2JZE A;  4Q36 A;  2Q43 A;  4KOW A;  4OC0 A;  4CGN A;  4ZY2 A;  4B5O A;  4A38 A;  5BWA B;  4ABK A;  4AVA A;  2CTB A;  2OZH A;  3FMC A;  4P4I A;  3TO9 A;  4QBJ A;  1B87 A;  2B5G B;  2R1I A;  1ZO0 A;  4B10 A;  3I9S A;  2RC4 A;  3BHX A;  3IIB A;  4HKF A;  3B2Y A;  1YRE A;  2FAV A;  4GS4 A;  4JLY A;  4PSW A;  4W9Y A;  5HH1 A;  3B8G A;  3G3S A;  4X2T A;  2ZEM A;  3EFA A;  3GQO A;  1CPS A;  4KVO E;  3TCV A;  5F49 A;  2NSM A;  2XEI A;  4PXE A;  2Y0M A;  3CT9 A;  2X7B A;  1NMT A;  2VRI A;  4C2Z A;  1Y0R A;  2HB6 A;  4ZYQ A;  4OLL A;  5AG6 A;  4JXQ A;  4MHP A;  2VZZ A;  4M6H A;  1Q2D A;  1IGB A;  3EWO A;  3FH4 A;  3IEH A;  2AJ6 A;  3NA6 A;  3PB9 X;  4LX9 A;  3TE4 A;  4KLV A;  4UML A;  1S5K A;  4MHZ A;  3S9N A;  3KKW A;  3S6F A;  2PJ8 A;  3VH9 A;  3BI1 A;  3VAT A;  3FEE A;  3TOB A;  2JEV A;  4X5K A;  2R98 A;  2BFQ A;  4L8A A;  1AMP A;  2PJ7 A;  4QB9 A;  3KR4 A;  3LWU A;  2PRB A;  4NGN A;  4OC2 A;  3KZW A;  2PQ8 A;  2R8V A;  1IID A;  3S9M A;  2DX6 A;  3KQZ A;  2GFQ A;  5EMI A;  1QQ9 A;  1H8L A;  2EK9 A;  1Z8W A;  2ANP A;  2AFS A;  1PYT B;  1QSM A;  4NF1 A;  4PV6 A;  2GRE A;  3D8P A;  1ZG7 A;  3ISZ A;  4M85 A;  4ZI6 A;  1DTD A;  3LD2 A;  4YFJ A;  2ZEG A;  2B5G A;  4NSQ A;  2PJA A;  1QSR A;  3EO4 A;  4CGL A;  4QVT A;  5GCN A;  1WK4 A;  1TKH A;  4IQY A;  1XBU A;  2J8N A;  2PJB A;  5IX3 A;  5IV0 A;  3ZJ0 A;  5ISV A;  3VFQ A;  1LAP A;  3FYN A;  4MHN A;  4ONU A;  2ZW6 A;  2NMT A;  1ARM A;  3R9G A;  1XMB A;  4PPZ A;  3EWP A;  3MGD A;  2JLM A;  2ODF A;  3CPX A;  2YNC A;  4U5Y A;  3V45 A;  4KZT A;  5AG7 A;  1ZG9 A;  4CYQ A;  5D29 A;  1AUG A;  3TC8 A;  2KQV A;  1Z2L A;  2RFH A;  3FJU A;  4JJX A;  1XF8 A;  1CM0 A;  4J4Z A;  3NH4 A;  1MJ9 A;  3TT2 A;  4LUA A;  3Q6Z A;  3SIG A;  2ZEN A;  2PJ5 A;  4AVB A;  3R9F A;  4BD9 A;  1LFW A;  5F48 A;  2WUU A;  4ZBG A;  1YK3 A;  2ZW7 A;  3NH5 A;  4CGP A;  2VZY A;  1CPX A;  1JWQ A;  2IQ6 A;  2REE A;  3KGQ A;  4NGP A;  2PSW A;  4B11 A;  1LAN A;  4KLW A;  4YU9 A;  4B5P A;  4EME A;  4MFK A;  3IWE A;  2Q04 A;  2PVV A;  4KOS A;  4WWV A;  2EBJ A;  2HQY A;  4CYO A;  3GY9 A;  3FRM A;  4R7M A;  3S6H A;  4E2A A;  5A27 A;  1UWY A;  2C6P A;  1S7L A;  4R8F A;  4B13 A;  3IC1 A;  4B12 A;  2I3C A;  2PR1 A;  3BLN A;  5K8M A;  1TIQ A;  4E8O A;  4OME A;  3N5F A;  1IYK A;  3B3T A;  2G3T A;  4BMH A;  1R3N A;  4F9V A;  1YME A;  3MRU A;  3CZX A;  1FNO A;  4X3R A;  1B6B A;  4P4F A;  2JDC A;  3IU2 A;  1NSL A;  1Z4R A;  4E0A A;  4K0C A;  4A39 A;  3KQX A;  2OZG A;  4ZY1 A;  2VBQ A;  3K2K A;  5FSU A;  5E96 A;  2OB0 A;  4RN7 A;  3F0A A;  1VHS A;  2FE7 A;  4CAE A;  4H6Z A;  1M1D A;  2YNC C;  3DSB A;  4NGQ A;  4XPK A;  2PJ2 A;  3WR7 A;  4CAF A;  4ETK A;  1R43 A;  4A33 A;  2EEE A;  3JZT A;  2IJZ A;  1IOF A;  2RB7 A;  2QIR A;  3DLJ A;  1GHE A;  5LYL A;  5C88 A;  6CPA A;  1N71 A;  3FX6 A;  4J5Q A;  4KOU A;  4JWP A;  3V38 A;  1YW6 A;  1UFH A;  2ZEE A;  4NJR A;  4P44 A;  4A30 A;  2G9D A;  5AG4 A;  1YR0 A;  1IU8 A;  4P6Y A;  4YGO A;  2ZEH A;  5FSY A;  3ZZI A;  2C1C A;  3B35 A;  2X47 A;  1XEB A;  4TNU A;  4KOX A;  5HVF A;  4BIN A;  1SPV A;  4F0Y A;  1OZP A;  5DWM A;  2ACF A;  2H5M A;  2QVP A;  2WYR A;  4TWE A;  3JRU A;  3I3G A;  2V8D A;  2PC1 A;  3DGV A;  4MXU A;  3FVL A;  1M4D A;  5FSX A;  4OC3 A;  3BXM A;  3SII A;  4UF4 A;  1XFO A;  3PB4 X;  3HUV A;  4M6G A;  1Y0Y A;  1SQH A;  2Z10 A;  4MJ8 A;  1CBX A;  1TKJ A;  1VIX A;  2PJ0 A;  3GKR A;  8CPA A;  3EY5 A;  1L0C A;  1S7N A;  2C6C A;  2PCU A;  4JYW A;  4M3S A;  7CPA A;  2I00 A;  4NGR A;  2P6F A;  1YD9 A;  4I49 A;  4KUB A;  4KSA A;  3B3V A;  4P4D A;  3SI2 A;  4MY0 A;  4OKO A;  3VAR A;  4P45 A;  2FCK A;  3GYA A;  4A32 A;  1IIC A;  3DNS A;  2PDO A;  4TU0 A;  4OAD A;  4IUS A;  3B3C A;  3SJF A;  4FBE A;  2XEF A;  3IGR A;  2GIV A;  3FBU A;  2DF5 A;  4KOV A;  1FY7 A;  3H8G A;  1YVK A;  2XEJ A;  3PFE A;  4UIB A;  2BOA A;  5THW A;  2FT0 A;  3W91 A;  2Q44 A;  4AB7 A;  5C82 A;  1J4J A;  4F8Z A;  1NJR A;  3D7G A;  4K3N A;  2CNM A;  2FIA A;  2Q7S A;  4YRH A;  4PXD A;  1I12 A;  2WPX A;  4B14 A;  3H5Z A;  4FAI A;  3D68 A;  2FXF A;  1KZF A;  1P4N A;  5K8P A;  3EC4 A;  2AFW A;  1QSO A;  1YW4 A;  2RNK A;  2B3V A;  4FD5 A;  3GUX A;  4CGO A;  1YQE A;  5LYD A;  2QEC A;  3SJE A;  5G22 A;  2HC9 A;  3KAS A;  4HNY B;  4IAV A;  4ONW A;  3V7Z A;  4UCN A;  2EK8 A;  2ZOG A;  2ZED A;  4EFD A;  5HMN A;  3T90 A;  4D86 A;  4P10 A;  3GIU A;  3PEI A;  3T8W A;  1XJO A;  4A94 A;  1IB1 E;  4F9U A;  2JDD A;  1K4J A;  4J5S A;  5HIH A;  1M4L A;  2GE3 A;  3IWW A;  2V8H A;  3FIX A;  3LOD A;  2BO9 A;  3OWC A;  3QAY A;  4HNX B;  2BEI A;  4KOR A;  4UCP A;  3SJX A;  2CNS A;  2O4H A;  4XPL A;  3SI0 A;  1IY7 A;  5CB3 A;  2B4D A;  1NE9 A;  4OC1 A;  5CB5 A;  2Z3L A;  1ELL P;  2YNE A;  2EUI A;  2HV2 A;  4BBH A;  5KTC A;  4JXR A;  5AIL A;  3QAH A;  1TF8 A;  3GPG A;  2FS5 A;  3Q71 A;  4H2K A;  4CYN A;  2P0W A;  3K9T A;  2CF4 A;  3PBB A;  4R9M A;  2Z3P A;  3JTK A;  1RTQ A;  3R96 A;  4QUS A;  4CYP A;  4MHD A;  4UFW A;  5LYI A;  4MCR A;  3S9L A;  4CPA A;  3R9E A;  3DR6 A;  3PGP A;  1YVO A;  1XOV A;  4ABL A;  1GYT A;  4XPD C;  5DS0 A;  2GLF A;  1Z4E A;  4LQ6 A;  3RO0 A;  2B58 A;  2PJ6 A;  2F5I A;  3P2H A;  4K30 A;  3V2B A;  5H86 A;  2OU2 A;  2AFU A;  4PK2 A;  3CDX A;  2FXK A;  1BPM A;  3WC6 A;  3B3S A;  4ESS A;  3IO1 A;  2G3A A;  2EWB A;  2JZF A;  1CP7 A;  4FD7 A;  3QB8 A;  1LRZ A;  1QSN A;  5EBV A;  4NGM A;  4FD4 A;  3GQE A;  3SHP A;  5I0C A;  3G8W A;  4OAE A;  1XE4 A;  3K9U A;  4ZX8 A;  3HLP A;  3KI9 A;  2F8H A;  3LMS A;  5LRG A;  3PP9 A;  4F0X A;  4A95 A;  4AG7 A;  2AFO A;  3D7H A;  2BCO A;  4MBU A;  4EVY A;  3D4U A;  4RUH A;  2XEG A;  5IB9 A;  3KR5 A;  2QJ8 A;  4A37 A;  4NCZ A;  2DXQ A;  3DDD A;  4B6Z A;  1ZR3 A;  4JZ0 A;  4IK2 A;  1Y7R A;  1TY8 A;  3H4Q A;  1KUX A;  3RNZ A;  4A31 A;  4UWI A;  1YLO A;  1MJB A;  3IFE A;  3NE7 A;  4DYO A;  2Q0Y A;  3IID A;  2A4N A;  2GU2 A;  3BJ8 A;  4Q38 A;  3SI1 A;  5K8O A;  4MCQ A;  4MY3 A;  4KVX A;  3RYO A;  3B3W A;  3GPQ A;  2WPW A;  3FEC A;  2DEA A;  1ARL A;  2K5T A;  1MJA A;  4G1P A;  4DNC A;  3PZJ A;  4NGT A;  2VQY A;  1XMT A;  3IJ3 A;  4O23 A;  2BL1 A;  1M44 A;  4PQA A;  5LRJ A;  3RZA A;  3WC5 A;  4ZX9 A;  1M4I A;  4CGM A;  5F46 A;  5JQ4 A;  1PUA A;  3D67 A;  4U9Y A;  3W6S A;  4U9Z A;  2PJ1 A;  3D7F A;  4C68 A;  5F47 A;  4MFJ A;  2XD7 A;  4HNW B;  3F5B A;  1HDU A;  5FSZ A;  1Z8X A;  3JVN A;  1KWM A;  3IWG A;  1JQG A;  1BOB A;  2ZW5 A;  4Y49 B;  1M4G A;  2B3U A;  1KUY A;  2ARH A;  4OC4 A;  4UEF A;  4II9 A;  1PU9 A;  3H8F A;  3TX8 A;  4NFR A;  4UA3 A;  5G21 A;  2OZU A;  4CAV A;  4C7H A;  1XIX A;  3TFY A;  4Q7A A;  3EWR A;  3EW5 A;  1FT7 A;  2OOT A;  4CS0 B;  2YGW A;  4FUU A;  2V77 A;  2ZW4 A;  3SIH A;  3FF3 A;  4KS9 A;  4RS2 A;  1YX0 A;  4KUA A;  4MI4 A;  4GVV A;  4UIA A;  5HXD A;  2OH1 A;  3TO6 A;  4C2Y A;  2F7V A;  2PJ3 A;  4MMO A;  3D7D A;  4JVV A;  4MHY A;  4UEE A;  3PRT A;  4CRZ B;  1TF9 A;  3D2M A;  3H8E A;  2J8R A;  4XNH B;  1YGH A;  4PSX A;  5I4M A;  2BSW A;  5AGE A;  1ON0 A;  4LQG A;  3V8I A;  4CAX A;  3JUW A;  2AFM A;  2L8R A;  2PJ9 A;  1CP6 A;  4OID A;  4YWY A;  3EXN A;  2WCT A;  1EE3 P;  3DR8 A;  2FIW A;  4C7I A;  5CBM A;  3W6X A;  2FG1 A;  2CNT A;  2DPS A;  2ZXV A;  3I1U A;  1ZLI A;  2REF A;  2GLJ A;  3PB8 X;  5CNP A;  1Y9K A;  5J8C A;  1VGY A;  5G20 A;  3RBU A;  3R1K A;  5F09 A; 
#chains in the Genus database with same CATH homology
 2OR4 A;  1YSJ A;  3EWQ A;  2PE3 A;  4GUA A;  5CMS A;  2FVG A;  3KHX A;  1LAM A;  1ZR5 A;  3GLJ A;  3PB6 X;  3PB7 X;  2ZOF A;  3IIF A;  4JGK A;  4MCP A;  2PIY A;  5K8N A;  3BI0 A;  1LOK A;  2JEW A;  3NH8 A;  2Q4Z A;  2ZEP A;  1VHO A;  1ZLH A;  1VHE A;  4R76 A;  2PRQ A;  5J1Q A;  3WT4 A;  1Z5R A;  5FSV A;  3KHZ A;  4MCS A;  4JLL A;  2VL1 A;  1Z8L A;  4KSI A;  2PVW A;  1HJZ A;  2PJC A;  4PXC A;  5LRK A;  3ISX A;  1ZG8 A;  4ETJ A;  2JBJ A;  2BFR A;  2AFX A;  1CX8 A;  2ABZ A;  1DE4 C;  1HEE A;  1ELM P;  2LGR A;  4X8I A;  3WAB A;  1BLL E;  3SJG A;  3WC7 A;  5HOL A;  1AYE A;  2V8G A;  4PXB A;  5HVH A;  1F2P A;  2O53 A;  4OIW A;  2PIZ A;  1XRY A;  4Z65 A;  3EKE A;  2POK A;  4GM5 A;  5DUS A;  4OP4 A;  1F57 A;  3D66 A;  1Q7L A;  2CIJ A;  1BAV A;  2PJ4 A;  3EJF A;  2V8V A;  1OBR A;  3PFO A;  3L2N A;  1F2O A;  4MRI A;  2NYQ A;  3B7I A;  2IMO A;  3KL9 A;  5LYF A;  3CPA A;  1Y7E A;  5JH9 A;  3NFZ A;  4IHM A;  5CPA A;  5ELY A;  4KYB A;  4JCA A;  1TXR A;  2JBK A;  2ZEO A;  2QYV A;  2AFC A;  4R6T A;  4AXV A;  3GPO A;  1VHU A;  1TKF A;  3ETI A;  4OC5 A;  4P4J A;  4DJL A;  1TXZ A;  2Q51 A;  3GB0 A;  4FWU A;  4P4B A;  3PBE A;  1PCA A;  5HVG A;  1BPN A;  2C6G A;  5JGF A;  2WZN A;  1LCP A;  3EJG A;  4DUK A;  4P4E A;  2J9A A;  2ZEL A;  2CTC A;  3FED A;  3SIJ A;  2ZEF A;  1HDQ A;  4WJB A;  4J5R A;  5D8N A;  4ZY0 A;  1NSA A;  1CG2 A;  3QNV A;  3RAM A;  3MN8 A;  2AFZ A;  5E3B A;  4NJQ A;  4UEZ A;  4GVW A;  5JM6 A;  1QMU A;  2Q43 A;  4OC0 A;  4ZY2 A;  4A38 A;  4ABK A;  2CTB A;  3FMC A;  4P4I A;  3IIB A;  3BHX A;  3B2Y A;  2FAV A;  4W9Y A;  4X2T A;  2ZEM A;  3GQO A;  1CPS A;  2NSM A;  2XEI A;  4PXE A;  3CT9 A;  2VRI A;  1Y0R A;  2HB6 A;  4ZYQ A;  4MHP A;  1IGB A;  3EWO A;  3FH4 A;  3IEH A;  3NA6 A;  3PB9 X;  4UML A;  3S9N A;  4MHZ A;  3VH9 A;  2PJ8 A;  3BI1 A;  3VAT A;  3FEE A;  2BFQ A;  1AMP A;  2PJ7 A;  3KR4 A;  3LWU A;  4NGN A;  4OC2 A;  3KZW A;  3S9M A;  2DX6 A;  3KQZ A;  1QQ9 A;  1H8L A;  2EK9 A;  2ANP A;  1PYT B;  2AFS A;  2GRE A;  1ZG7 A;  3ISZ A;  4ZI6 A;  1DTD A;  2ZEG A;  4EWT A;  2PJA A;  1TKH A;  4IQY A;  1XBU A;  2PJB A;  3VFQ A;  1LAP A;  4MHN A;  1ARM A;  1XMB A;  4PPZ A;  3EWP A;  3CPX A;  3V45 A;  1ZG9 A;  5D29 A;  3TC8 A;  1Z2L A;  2RFH A;  3FJU A;  3NH4 A;  4J4Z A;  3Q6Z A;  3SIG A;  2ZEN A;  2PJ5 A;  4BD9 A;  1LFW A;  3NH5 A;  1CPX A;  2IQ6 A;  4NGP A;  3KGQ A;  4RUH A;  4EME A;  1LAN A;  4YU9 A;  2PVV A;  4WWV A;  4R7M A;  1UWY A;  2C6P A;  4R8F A;  3IC1 A;  2I3C A;  5K8M A;  4OME A;  3N5F A;  3B3T A;  1R3N A;  4F9V A;  1YME A;  3MRU A;  1FNO A;  4X3R A;  4P4F A;  4K0C A;  3KQX A;  3K2K A;  4ZY1 A;  5FSU A;  4NGQ A;  2PJ2 A;  4ETK A;  1R43 A;  2EEE A;  3JZT A;  2IJZ A;  2RB7 A;  3DLJ A;  5LYL A;  6CPA A;  3FX6 A;  4J5Q A;  3V38 A;  1YW6 A;  2ZEE A;  4NJR A;  4P44 A;  2G9D A;  4P6Y A;  2ZEH A;  5FSY A;  2C1C A;  3B35 A;  2X47 A;  5HVF A;  4TNU A;  1SPV A;  2ACF A;  2QVP A;  4TWE A;  2WYR A;  3JRU A;  2V8D A;  3DGV A;  4MXU A;  3FVL A;  5FSX A;  4OC3 A;  3BXM A;  3SII A;  4UF4 A;  1XFO A;  3PB4 X;  3HUV A;  1Y0Y A;  1CBX A;  1TKJ A;  1VIX A;  2PJ0 A;  8CPA A;  2C6C A;  4JYW A;  2PCU A;  7CPA A;  4NGR A;  1YD9 A;  3SI2 A;  3VAR A;  3B3V A;  4P4D A;  4A94 A;  4OKO A;  4P45 A;  4TU0 A;  3B3C A;  3SJF A;  4FBE A;  2XEF A;  5THW A;  3H8G A;  3PFE A;  2XEJ A;  4UIB A;  2BOA A;  4F8Z A;  1NJR A;  3D7G A;  4K3N A;  4PXD A;  4FAI A;  3D68 A;  5K8P A;  2AFW A;  1YW4 A;  3GUX A;  5LYD A;  3SJE A;  2HC9 A;  3KAS A;  4IAV A;  4ONW A;  3V7Z A;  2EK8 A;  2ZOG A;  2ZED A;  4EFD A;  4D86 A;  4P10 A;  3PEI A;  3T8W A;  1XJO A;  4F9U A;  3IWW A;  4J5S A;  5HIH A;  1M4L A;  4NGS A;  2V8H A;  4A39 A;  2BO9 A;  3SJX A;  2O4H A;  3SI0 A;  1IY7 A;  5CB3 A;  4OC1 A;  5CB5 A;  1ELL P;  5AIL A;  1TF8 A;  3GPG A;  3Q71 A;  4H2K A;  3K9T A;  2CF4 A;  3PBB A;  1RTQ A;  3S9L A;  5LYI A;  4MCR A;  4CPA A;  4ABL A;  1GYT A;  5DS0 A;  2GLF A;  2PJ6 A;  3V2B A;  2AFU A;  3CDX A;  2FXK A;  1BPM A;  3WC6 A;  3B3S A;  4ESS A;  3IO1 A;  2EWB A;  1CP7 A;  4NGM A;  3GQE A;  5LRG A;  4ZX8 A;  3HLP A;  3KI9 A;  2F8H A;  3LMS A;  2AFO A;  3D7H A;  2BCO A;  3D4U A;  2XEG A;  5IB9 A;  3KR5 A;  2QJ8 A;  4A37 A;  4B6Z A;  1ZR3 A;  4JZ0 A;  4IK2 A;  1TY8 A;  1YLO A;  3IFE A;  4DYO A;  3IID A;  2GU2 A;  3SI1 A;  5K8O A;  4MCQ A;  3B3W A;  3GPQ A;  3FEC A;  2DEA A;  1ARL A;  4G1P A;  4NGT A;  4O23 A;  3IJ3 A;  4PQA A;  5LRJ A;  3RZA A;  3WC5 A;  4ZX9 A;  3D67 A;  2PJ1 A;  3D7F A;  2XD7 A;  1HDU A;  5FSZ A;  1KWM A;  1JQG A;  4OC4 A;  4UEF A;  3H8F A;  3TX8 A;  4NFR A;  4Q7A A;  3EWR A;  3EW5 A;  1FT7 A;  2OOT A;  4FUU A;  2V77 A;  3SIH A;  3FF3 A;  4UIA A;  4GVV A;  5HXD A;  2F7V A;  2PJ3 A;  4MMO A;  3D7D A;  4JVV A;  4MHY A;  4UEE A;  3PRT A;  1TF9 A;  3H8E A;  5I4M A;  4LQG A;  2AFM A;  2L8R A;  2PJ9 A;  1CP6 A;  4OID A;  4YWY A;  1EE3 P;  5CBM A;  2FG1 A;  3I1U A;  3PB8 X;  1ZLI A;  2GLJ A;  1VGY A;  3RBU A;  5F09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...