3H8GA

Bestatin complex structure of leucine aminopeptidase from pseudomonas putida
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
497
structure length
497
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
total genus 170
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8gA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8gA02
1OBRA 3LWUA 2ZEHA 2FG1A 2OR4A 3IC1A 1FT7A 3GPOA 2ANPA 5HVGA 3FF3A 1PCAA 2AFXA 3V7ZA 1XMBA 3FVLA 3WC6A 3GPGA 2GREA 4MCQA 1HDUA 4IK2A 3KR5A 5K8MA 2O4HA 3HUVA 1CPSA 2VL1A 3EWOA 4ABKA 1IY7A 2ZOFA 1R43A 1LAMA 1LANA 3S9LA 3KHZA 4NJRA 2XEJA 3VH9A 3IWWA 4CPAA 1Z8LA 4RUHA 1TY8A 2PJ8A 1YW6A 5AILA 4FWUA 2NSMA 4UMLA 3SJEA 3PB4X 1NJRA 2ZEEA 1JQGA 2PIYA 1DTDA 3EWQA 3IFEA 3PFOA 4OC2A 4NGSA 1TF8A 1CX8A 2PE3A 3CPAA 5K8OA 2XEIA 5HIHA 3SI2A 1SPVA 5FSYA 3B3TA 4NGQA 1XBUA 2EK9A 3EJGA 3D4UA 3VATA 4J4ZA 3PFEA 2ZEPA 3BXMA 3KASA 4P45A 4R76A 3B3CA 3FEDA 5HVFA 1LCPA 2FXKA 1CPXA 3PB8X 3KGQA 2RFHA 3MRUA 1ZLIA 2ZENA 6CPAA 5JH9A 5LYIA 1HDQA 3B35A 2PJBA 1H8LA 5K8PA 2AFOA 4DUKA 2JBKA 1XFOA 2Q4ZA 5DUSA 4PXEA 3PB9X 1QQ9A 4F9VA 5CB5A 4MHYA 4MCPA 4IQYA 1FNOA 2C1CA 4TWEA 3V38A 2EEEA 4DJLA 2LGRA 3KR4A 3GPQA 2PJ0A 4ZX9A 4ETKA 3KL9A 2IJZA 4OKOA 2F7VA 2HC9A 2BCOA 3SIGA 5E3BA 2ZEMA 2AFZA 4J5RA 2AFWA 1HJZA 2C6CA 2V8HA 3PBEA 3PRTA 3CT9A 4NFRA 3S9NA 1XJOA 4GUAA 4JCAA 3KHXA 1ELLP 3D7HA 3KI9A 1ZR3A 4WWVA 2I3CA 5F09A 4G1PA 2XD7A 2PJCA 2XEGA 4PPZA 4OC1A 2GU2A 4MMOA 1YMEA 2IMOA 4TNUA 4F8ZA 1BLLE 3LMSA 4X2TA 5LYDA 1KWMA 4J5SA 1CG2A 3ISXA 4ZI6A 2PJ3A 3IEHA 4TU0A 2POKA 4GM5A 3IO1A 4PQAA 3TC8A 1ARMA 1M4LA 1TKJA 5CPAA 2C6PA 4A37A 1AMPA 3EWRA 3B2YA 3DGVA 4MCRA 4A38A 3SIHA 4A94A 1XRYA 2O53A 2PVWA 4K3NA 1ZG8A 2X47A 3GUXA 3K2KA 1VHOA 1LOKA 5DS0A 1Y0RA 2BFQA 3NFZA 3PB7X 1YD9A 3WT4A 1HEEA 2CF4A 3IIFA 4MCSA 3VFQA 3IJ3A 1Z5RA 2QJ8A 3HLPA 4WJBA 4ESSA 4ZY2A 1Y7EA 3EJFA 4OC3A 5FSVA 4NGTA 2WZNA 4X8IA 3KQZA 2IQ6A 1TKHA 5HOLA 5K8NA 4MRIA 3D68A 4FBEA 5LRKA 1ELMP 4J5QA 4OMEA 3QNVA 4P4FA 2AFUA 2PJ7A 2ZEOA 2PCUA 2FAVA 2OOTA 2XEFA 2PJ5A 3Q6ZA 1VGYA 2BOAA 3WABA 4F9UA 2V77A 3FJUA 3PBBA 1TF9A 4UEZA 4EFDA 2PJ9A 3EKEA 4A39A 1BPNA 4JVVA 4OP4A 3ISZA 5CMSA 2V8GA 1EE3P 4LQGA 4R6TA 2PJ1A 3EWPA 2QVPA 4NJQA 1TXZA 2QYVA 4H2KA 5FSXA 3GQOA 2BO9A 3VARA 3H8GA 3TX8A 2J9AA 4ZY0A 3MN8A 5LRJA 1AYEA 5LYLA 4K0CA 2ACFA 1IGBA 5LYFA 3Q71A 1VHEA 2GLJA 4OIDA 3H8FA 1F2OA 1Q7LA 4MXUA 3KZWA 3IIBA 2PJAA 3FH4A 4EWTA 4UF4A 3B7IA 4UEEA 3PEIA 4YWYA 4NGMA 1ZLHA 2EWBA 4ZY1A 4OC5A 3N5FA 2ZOGA 3D67A 4NGPA 2JBJA 2BFRA 3SIJA 3B3WA 4JGKA 2ABZA 4IHMA 7CPAA 3GQEA 1LFWA 1R3NA 2L8RA 3SI0A 4Z65A 2PJ4A 4R7MA 4MHNA 1ZG9A 4JLLA 3NH5A 4IAVA 4PXCA 1YLOA 4ZX8A 3FECA 3BI0A 4R8FA 5J1QA 2ZEDA 1DE4C 4BD9A 1RTQA 3FEEA 1BPMA 1ARLA 1YW4A 4P6YA 2Q51A 3NA6A 4UIBA 2RB7A 4P10A 3NH8A 4ETJA 4P44A 3L2NA 3ETIA 1F2PA 4P4DA 1PYTB 2ZELA 2V8DA 3B3SA 3JRUA 4YU9A 3V2BA 4P4BA 2CTBA 4PXDA 4UIAA 4OC0A 4NGRA 4GVVA 3SIIA 2AFSA 3FX6A 4AXVA 5IB9A 4KSIA 5FSUA 2G9DA 3SJGA 4PXBA 4Q7AA 3V45A 2VRIA 3H8EA 3B3VA 2PVVA 2WYRA 2DX6A 1VIXA 4JZ0A 5ELYA 4P4EA 5JM6A 2PJ6A 3BHXA 1Y0YA 1ZG7A 1Z2LA 3GB0A 4NGNA 3FMCA 2DEAA 4DYOA 2PRQA 3RBUA 3T8WA 3IIDA 2V8VA 3D7GA 3D66A 2ZEGA 3BI1A 1BAVA 3EW5A 5HVHA 3CDXA 2AFCA 1F57A 3SI1A 4MHZA 4KYBA 2F8HA 2PIZA 3JZTA 3NH4A 4O23A 5JGFA 1GYTA 1TKFA 1TXRA 2FVGA 4MHPA 3D7FA 4GVWA 5D29A 1VHUA 2ZEFA 5THWA 1YSJA 1UWYA 5I4MA 3KQXA 5D8NA 4ABLA 4B6ZA 3GLJA 5FSZA 4OIWA 1QMUA 2C6GA 2CIJA 4UEFA 4EMEA 4D86A 2CTCA 2Q43A 2JEWA 1CBXA 2GLFA 2PJ2A 1CP7A 8CPAA 4OC4A 2NYQA 3RZAA 4P4JA 3S9MA 5CBMA 4FUUA 3SJFA 4JYWA 1ZR5A 4P4IA 1NSAA 5HXDA 2EK8A 4W9YA 5CB3A 5LRGA 1LAPA 3SJXA 2HB6A 1CP6A 3DLJA 4X3RA 3WC5A 3CPXA 3I1UA 4FAIA 4ZYQA 3D7DA 3K9TA 3RAMA 3PB6X 4ONWA 2AFMA 3WC7A
chains in the Genus database with same CATH superfamily
1RXTA 3S6KA 1OBRA 5F49A 1XF8A 1IIDA 3LWUA 1NMTA 2ZEHA 3BLNA 4HPSA 2FG1A 2OR4A 3IC1A 2EVNA 3DSBA 5G1ZA 1FT7A 3GPOA 2ANPA 5HVGA 2REEA 2YNCC 3FF3A 1PCAA 2AFXA 3V7ZA 4CAWA 2O28A 1XMBA 2C27A 5G21A 3FVLA 3QAHA 3WC6A 3GPGA 1XE4A 1QSTA 2GREA 4MCQA 1HDUA 4R3KA 2HQYA 4IK2A 4F0YA 3KR5A 4BMHA 1IICA 2JEVA 2RC4A 4CAFA 2FIAA 5K8MA 2O4HA 1BO4A 2DPSA 3HUVA 1CPSA 3EXNA 2VL1A 3EWOA 4U9ZA 1Q2DA 4ABKA 5FVJA 1IY7A 2ZOFA 1R43A 2F5IA 4JXQA 3IWEA 2Q7BA 1LAMA 4PSXA 4HNYB 4U9YA 1LANA 3S9LA 4KLWA 2YNDA 3KHZA 4NJRA 2W2GA 2XEJA 3IWWA 4FD7A 1Z8LA 3VH9A 3TO9A 4CPAA 4RUHA 1TY8A 2PJ8A 5AG4A 1YW6A 3A9LA 5AILA 4FWUA 4KS9A 2NSMA 4UMLA 3SJEA 1KUXA 3PB4X 1NJRA 2ZEEA 1JQGA 4Y49C 4CAXA 2PIYA 1DTDA 3EWQA 5A27A 2OZHA 2B4DB 3IFEA 4M6IA 3PFOA 3TCVA 4K30A 4KOVA 4KSAA 4OC2A 5IB0A 2Q04A 4NGSA 1TF8A 5C82A 4KZTA 2CY2A 2WPXA 4R9MA 1CX8A 2PE3A 3V8IA 1Z8XA 5HH1A 2WCTA 4J3GA 3CPAA 4KOXA 3QAYA 5K8OA 2I00A 2DF5A 2XEIA 5HIHA 2GE3A 3SI2A 1PUAA 1SPVA 4C7HA 3D8PA 1S60A 5FSYA 1TIQA 2Z3PA 3FNCA 3P2FA 3B3TA 1IOIA 1B6BA 1XBUA 2I79A 4NGQA 4UCPA 3TO7A 1VHSA 4NSQA 2EK9A 4CRYB 3EJGA 3D4UA 4MY3A 4AB7A 4CAVA 3D2MA 3VATA 4PV6A 4J4ZA 4MFQA 2ZW4A 3PFEA 1KZFA 1WK4A 2QIRA 2ZEPA 4B5PB 3BXMA 2R7HA 3KASA 2FCKA 4R76A 3B3CA 3FEDA 4P45A 5HVFA 1LCPA 2FXKA 4C2ZA 1CPXA 3PB8X 3KGQA 2RFHA 4CYQA 3S6HA 5ISVA 3MRUA 2ATRA 1YLEA 1ZLIA 2VZYA 2OU2A 2ZENA 3GY9A 4A2ZA 1MJ9A 3QB8A 4FD5A 6CPAA 5JH9A 4C2XA 4F0XA 4UA3A 3JUWA 2JLMA 5LYIA 2Z11A 1HDQA 3B35A 2PJBA 1H8LA 1NE9A 5K8PA 4XPKA 1OZPA 2AFOA 4DUKA 2JBKA 1R57A 4AVCA 1XFOA 2Q4ZA 5DUSA 4PXEA 2H5MA 3PB9X 1QQ9A 2NMTA 4KLVA 3R96A 3W91A 4F9VA 5CB5A 4UFVA 3T90A 2PR8A 2PR1A 4MHYA 4MCPA 4IQYA 1FNOA 2C1CA 4KVXA 4TWEA 3V38A 1XEBA 2EEEA 4DJLA 2LGRA 3KR4A 3GPQA 2YNEA 3EC4A 2PJ0A 4ZX9A 4ETKA 4JWPA 3KL9A 2IJZA 5IV0A 3H4QA 4OKOA 2F7VA 2HC9A 2BCOA 3SIGA 5E3BA 2ZEMA 2AFZA 4JLYA 4J5RA 4QC6A 2AFWA 3CXSA 1HJZA 1ZO0A 2C6CA 4PK3A 2V8HA 3VWDA 3PBEA 1GHEA 1ON0A 1M4GA 4LQ6A 3PRTA 3CT9A 4U5YA 4C7IA 1S7FA 4NFRA 4ORFA 3S9NA 1XJOA 4GUAA 1KUVA 2FE7A 2B3VA 3MGDA 2B58A 5F47A 4JCAA 3KHXA 4A31A 1ELLP 2REFA 3FXTA 5HMNA 3D7HA 2Z3LA 5EC4A 4B11A 3KI9A 1ZR3A 1YGHA 3G3SA 4WWVA 2I3CA 5F09A 4G1PA 2BL1A 2XD7A 2KCWA 2PJCA 2FL4A 3F8KA 4UFWA 4CYNA 2XEGA 3UY5A 4PPZA 4OC1A 2GU2A 3S6GA 4B5PA 3RYOA 4MMOA 3VWEA 4MFPA 4CGOA 4RI1A 1CJWA 2VBQA 3IGRA 1YMEA 4I49A 2KQVA 2IL4A 2IMOA 4KOUA 4TNUA 1BLLE 3LMSA 2JZDA 4X2TA 4F8ZA 5LYDA 4AVBA 2BEIA 1KWMA 4J5SA 1CG2A 3ISXA 4BBHA 4ZI6A 2PJ3A 3IEHA 5A28A 4X5KA 5G20A 4XPDB 5AG7A 4TU0A 4M3SA 1QSRA 4OADA 5JPHA 3FYNA 4L89A 2K5TA 2POKA 2VQYA 4GM5A 3IO1A 4H89A 4M6GA 3ZZIA 3IWGA 4PQAA 3TC8A 1ARMA 1FY7A 1M4LA 1TKJA 5CPAA 2C6PA 4A37A 1AMPA 5KTAA 3EWRA 2J8RA 3B2YA 3DGVA 2Q0YA 4MCRA 3BJ8A 4KVME 3KKWA 4A38A 3SIHA 1XOVA 5DWMA 4A94A 1XRYA 2BSWA 2J8NA 2O53A 2PVWA 4UCMA 3RNZA 4BINA 4K3NA 1ZG8A 2X47A 3GUXA 3K2KA 1VHOA 3R9EA 1QSOA 3R95A 4H6ZA 4E8OA 1LOKA 5DS0A 1Y0RA 2BFQA 1S7LA 4LX9A 3LD2A 3NFZA 3PB7X 4IF5A 1YD9A 4RS2A 5GCNA 3WT4A 1HEEA 4B12A 2CF4A 3IIFA 2OH1A 2G0BA 4MCSA 3VFQA 3IJ3A 1Z5RA 2PQ8A 2QJ8A 4UWJA 5AG6A 3SXOA 3HLPA 4WJBA 4YGOA 3EO4A 4ESSA 4ZY2A 4XNHB 1YVOA 1Y7EA 3EJFA 4OC3A 5FSVA 1Q2YA 4NGTA 2JDDA 3R9GA 1P0HA 2ODFA 2WZNA 5AGEA 4X8IA 3KQZA 1XMTA 3F0AA 1IYKA 1I12A 4UFXA 2IQ6A 3N7ZA 4CGMA 1TKHA 5HOLA 1M1DA 2JZFA 4B14A 5K8NA 1AUGA 4AVAA 3D3SA 4MRIA 2OB0A 3D68A 4FBEA 2Y0MA 5KTCA 5LRKA 1ELMP 2B5GB 4RN7A 4NCZA 3ZJ0A 4J5QA 3TTHA 4OMEA 3QNVA 4KOTA 4P4FA 1S7NA 2AFUA 2PJ7A 2ZEOA 2PCUA 2EBJA 2FAVA 3DR8A 2OOTA 2XEFA 4E0AA 4KUBA 2ARHA 1MJBA 2PJ5A 3Q6ZA 4C68A 4CGLA 4Q38A 4XPDC 3W6XA 1VGYA 2FIWA 2B4DA 4QB9A 5J8CA 2BOAA 3WABA 4F9UA 2V77A 3FJUA 3PBBA 4R57A 1TF9A 5F48A 1MJAA 4UEZA 4B5OA 4MFKA 4DNCA 2PJ9A 2EUIA 4AG7A 4EFDA 5C88A 3EKEA 4A39A 3P2HA 4A95A 1BPNA 4JVVA 4C2YA 4OP4A 2Z0ZA 5H84A 2ZW7A 1Y9KA 3ISZA 3NE8A 5CMSA 2V8GA 1EE3P 2CNMA 4LQGA 4R6TA 1A2ZA 2PJ1A 4HNXB 4NEXA 3EWPA 2QVPA 4MFZA 4NJQA 1TXZA 4FD6A 4GS4A 2QYVA 4H2KA 5FSXA 4CRZB 3GQOA 3R9FA 4OLLA 1B87A 4P4DA 2BO9A 2PDOA 4KOSA 3VARA 3H8GA 3TX8A 3GIUA 2J9AA 3FB3A 2AJ6A 2FXFA 1YREA 2RNKA 4ZY0A 3MN8A 4KUAA 2FS5A 5LRJA 1AYEA 5LYLA 4QBJA 2EO8A 3NE7A 4K0CA 2ACFA 1IGBA 5LYFA 3Q71A 2JZEA 3IU1A 1VHEA 2OZGA 2GLJA 2Q4YA 3H5ZA 2PSWA 4OIDA 3G8WA 3H8FA 1F2OA 1Q7LA 5KTDA 2Q44A 4MXUA 3KZWA 5AG5A 3IIBA 3JVNA 2PJAA 3FH4A 4EWTA 1JWQA 2P6FA 3BJ7A 3PGPA 4UF4A 5IX3A 2DXQA 1K4JA 3B7IA 4MI4A 4L8AA 4UEEA 2ZW5A 3PEIA 1YVKA 2R1IA 4YWYA 1M4DA 2GIVA 4NGMA 1L0CA 1IB1E 3TOAA 1ZLHA 2EWBA 3FBUA 4ZY1A 4OC5A 3I3GA 5EMIA 4IUSA 3N5FA 2ZOGA 2WUUA 1MK4A 2Z3KA 3D67A 4B13A 1N71A 2X7BA 4JJXA 4NGPA 4CYPA 2JBJA 2R98A 4JXRA 1IOFA 2BFRA 2J8MA 4H6UA 4M85A 2Z3MA 3LODA 3RO0A 3SIJA 3B3WA 4LUAA 4JGKA 2ABZA 4IHMA 7CPAA 2R8VA 4KOYA 3GQEA 1LFWA 1R3NA 3FIXA 2L8RA 4KORA 3SI0A 4Z65A 2PJ4A 4R7MA 2B3UA 3OWCA 4HKFA 5H86A 4MHNA 4ZGYB 4NF1A 3JTKA 1ZG9A 4AG9A 4JLLA 3NH5A 4IAVA 4PXCA 1YLOA 4MY0A 4ZX8A 3PZJA 3F5BA 4CS0B 4EVYA 2G3AA 3FECA 3BI0A 4KVOE 4R8FA 2Q7SA 3SHPA 5F46A 2ZEDA 5BWAB 4NXYA 5J1QA 1IU8A 1DE4C 2VEZA 1J4JA 1RTQA 4KOWA 4R3LA 4UCNA 4BD9A 2QMLA 3FEEA 1BPMA 1ARLA 1X10A 1YW4A 2VI7A 3CZXA 4P6YA 3R1KA 4JD6A 4MFJA 2Q51A 3NA6A 1QSNA 4UIBA 1Z8TA 3TOBA 2RB7A 4ZBGA 4P10A 2Q4VA 3NH8A 1KUYA 2ZXVA 4HNWB 4E2AA 4ETJA 2Z10A 4P44A 4A33A 3L2NA 3ETIA 1F2PA 3DNSA 1X12A 3GKRA 1PYTB 1SQHA 1Y9WA 2V8DA 2ZELA 3B3SA 1I21A 3JRUA 4YU9A 3V2BA 4P4BA 2PRBA 2CTBA 1Z4EA 2VXKA 3SXNA 4PXDA 4UIAA 1NSLA 2WSAA 2A4NA 4OC0A 4NGRA 4GVVA 1CM0A 2B5GA 3SIIA 2FT0A 2AFSA 4YRHA 3TO6A 5JQ4A 3FX6A 1I1DA 4PSWA 1YQEA 3GYAA 4AXVA 5IB9A 2B4BA 4KSIA 5FSUA 2G9DA 3SJGA 3TFYA 2G3TA 2ZPAA 4PXBA 4Q7AA 3V45A 2VRIA 3H8EA 1QSMA 2YGWA 3B3VA 2PVVA 2WYRA 4Q36A 1Z8WA 2DX6A 2DPTA 1VIXA 4JZ0A 4MJ8A 5J8FA 2CNTA 3CXQA 4P4EA 4XNHC 5ELYA 4CGPA 5JM6A 3TE4A 1YX0A 2PJ6A 3BHXA 3WR7A 1Y0YA 1ZG7A 1Z2LA 3GB0A 3I9SA 4NGNA 1RO5A 3FMCA 4A32A 2DEAA 4DYOA 2PRQA 3RBUA 1S5KA 3T8WA 3IIDA 1IYLA 2V8VA 2WPWA 1LRZA 3EFAA 4XPLA 3S6FA 4UWIA 2P6EA 3D7GA 5E96A 3D66A 3K9UA 2ZEGA 3PP9A 3BI1A 4R87A 1Z4RA 1BAVA 5EBVA 1YR0A 3EW5A 5HVHA 1S3ZA 3CDXA 1U6MA 4QUSA 2AFCA 4CYOA 1F57A 1Q2CA 2BUEA 4MHZA 3SI1A 1BOBA 1M4IA 1V0CA 4A30A 4KYBA 2D4PA 2F8HA 5I0CA 3EY5A 4OAEA 2PIZA 3JZTA 3NH4A 4O23A 4Y49B 4ONUA 5JGFA 1GYTA 1TKFA 1TXRA 2CNSA 4GXHA 2FVGA 3TT2A 4MHPA 3D7FA 3DR6A 4MFLA 4GVWA 5DWNA 5D29A 5CNPA 5G22A 1VHUA 2P6GA 2ZEFA 3B8GA 5THWA 1YSJA 1UWYA 5I4MA 1VKCA 3KQXA 5D8NA 3DDDA 4QVTA 1Z9UA 4ABLA 2JDCA 3LACA 2HV2A 2Z3OA 4B6ZA 3GLJA 1P4NA 4CAEA 2OZUA 2VZZA 4B10A 5FSZA 4OIWA 1QMUA 2CXAA 2D4OA 2C6GA 2CIJA 1Y7RA 2P0WA 2ZW6A 3E0KA 4D86A 2CTCA 4UEFA 4EMEA 2Q43A 2AE6A 2JEWA 3D2PA 4II9A 1CBXA 3W6SA 2GLFA 2PJ2A 1CP7A 8CPAA 4OC4A 2NYQA 2GFQA 3CXPA 3RZAA 2HUZA 1S7KA 2FSRA 4P4JA 4M6HA 4PK2A 3FRMA 4MBUA 3S9MA 1XIXA 4FD4A 5CBMA 2PC1A 2YNCA 4FUUA 4JYWA 3SJFA 3IU2A 4YFJA 1ZR5A 1YK3A 4P4IA 1NSAA 2GANA 5HXDA 2EK8A 4W9YA 4CGNA 5CB3A 1WWZA 5LRGA 1LAPA 3SJXA 2HB6A 1CP6A 4F6AA 3DLJA 4X3RA 3WC5A 3T9YA 2Z3NA 3C26A 2QECA 4MHDA 3CPXA 3I1UA 4KSFA 4ZYQA 4FAIA 3D7DA 3K9TA 4UBRA 3RAMA 1M44A 3PB6X 4ONWA 2AFMA 1PU9A 3WC7A 1UFHA
chains in the Genus database with same CATH topology
1OBRA 3LWUA 2ZEHA 2FG1A 2OR4A 3IC1A 1FT7A 3GPOA 2ANPA 5HVGA 3FF3A 1PCAA 2AFXA 3V7ZA 1XMBA 3FVLA 3WC6A 3GPGA 2GREA 4MCQA 1HDUA 4IK2A 3KR5A 5K8MA 2O4HA 3HUVA 1CPSA 2VL1A 3EWOA 4ABKA 1IY7A 2ZOFA 1R43A 1LAMA 1LANA 3S9LA 3KHZA 4NJRA 2XEJA 3VH9A 3IWWA 4CPAA 1Z8LA 4RUHA 1TY8A 2PJ8A 1YW6A 5AILA 4FWUA 2NSMA 4UMLA 3SJEA 3PB4X 1NJRA 2ZEEA 1JQGA 2PIYA 1DTDA 3EWQA 3IFEA 3PFOA 4OC2A 4NGSA 1TF8A 1CX8A 2PE3A 3CPAA 5K8OA 2XEIA 5HIHA 3SI2A 1SPVA 5FSYA 3B3TA 4NGQA 1XBUA 2EK9A 3EJGA 3D4UA 3VATA 4J4ZA 3PFEA 2ZEPA 3BXMA 3KASA 4P45A 4R76A 3B3CA 3FEDA 5HVFA 1LCPA 2FXKA 1CPXA 3PB8X 3KGQA 2RFHA 3MRUA 1ZLIA 2ZENA 6CPAA 5JH9A 5LYIA 1HDQA 3B35A 2PJBA 1H8LA 5K8PA 2AFOA 4DUKA 2JBKA 1XFOA 2Q4ZA 5DUSA 4PXEA 3PB9X 1QQ9A 4F9VA 5CB5A 4MHYA 4MCPA 4IQYA 1FNOA 2C1CA 4TWEA 3V38A 2EEEA 4DJLA 2LGRA 3KR4A 3GPQA 2PJ0A 4ZX9A 4ETKA 3KL9A 2IJZA 4OKOA 2F7VA 2HC9A 2BCOA 3SIGA 5E3BA 2ZEMA 2AFZA 4J5RA 2AFWA 1HJZA 2C6CA 2V8HA 3PBEA 3PRTA 3CT9A 4NFRA 3S9NA 1XJOA 4GUAA 4JCAA 3KHXA 1ELLP 3D7HA 3KI9A 1ZR3A 4WWVA 2I3CA 5F09A 4G1PA 2XD7A 2PJCA 2XEGA 4PPZA 4OC1A 2GU2A 4MMOA 1YMEA 2IMOA 4TNUA 4F8ZA 1BLLE 3LMSA 4X2TA 5LYDA 1KWMA 4J5SA 1CG2A 3ISXA 4ZI6A 2PJ3A 3IEHA 4TU0A 2POKA 4GM5A 3IO1A 4PQAA 3TC8A 1ARMA 1M4LA 1TKJA 5CPAA 2C6PA 4A37A 1AMPA 3EWRA 3B2YA 3DGVA 4MCRA 4A38A 3SIHA 4A94A 1XRYA 2O53A 2PVWA 4K3NA 1ZG8A 2X47A 3GUXA 3K2KA 1VHOA 1LOKA 5DS0A 1Y0RA 2BFQA 3NFZA 3PB7X 1YD9A 3WT4A 1HEEA 2CF4A 3IIFA 4MCSA 3VFQA 3IJ3A 1Z5RA 2QJ8A 3HLPA 4WJBA 4ESSA 4ZY2A 1Y7EA 3EJFA 4OC3A 5FSVA 4NGTA 2WZNA 4X8IA 3KQZA 2IQ6A 1TKHA 5HOLA 5K8NA 4MRIA 3D68A 4FBEA 5LRKA 1ELMP 4J5QA 4OMEA 3QNVA 4P4FA 2AFUA 2PJ7A 2ZEOA 2PCUA 2FAVA 2OOTA 2XEFA 2PJ5A 3Q6ZA 1VGYA 2BOAA 3WABA 4F9UA 2V77A 3FJUA 3PBBA 1TF9A 4UEZA 4EFDA 2PJ9A 3EKEA 4A39A 1BPNA 4JVVA 4OP4A 3ISZA 5CMSA 2V8GA 1EE3P 4LQGA 4R6TA 2PJ1A 3EWPA 2QVPA 4NJQA 1TXZA 2QYVA 4H2KA 5FSXA 3GQOA 2BO9A 3VARA 3H8GA 3TX8A 2J9AA 4ZY0A 3MN8A 5LRJA 1AYEA 5LYLA 4K0CA 2ACFA 1IGBA 5LYFA 3Q71A 1VHEA 2GLJA 4OIDA 3H8FA 1F2OA 1Q7LA 4MXUA 3KZWA 3IIBA 2PJAA 3FH4A 4EWTA 4UF4A 3B7IA 4UEEA 3PEIA 4YWYA 4NGMA 1ZLHA 2EWBA 4ZY1A 4OC5A 3N5FA 2ZOGA 3D67A 4NGPA 2JBJA 2BFRA 3SIJA 3B3WA 4JGKA 2ABZA 4IHMA 7CPAA 3GQEA 1LFWA 1R3NA 2L8RA 3SI0A 4Z65A 2PJ4A 4R7MA 4MHNA 1ZG9A 4JLLA 3NH5A 4IAVA 4PXCA 1YLOA 4ZX8A 3FECA 3BI0A 4R8FA 5J1QA 2ZEDA 1DE4C 4BD9A 1RTQA 3FEEA 1BPMA 1ARLA 1YW4A 4P6YA 2Q51A 3NA6A 4UIBA 2RB7A 4P10A 3NH8A 4ETJA 4P44A 3L2NA 3ETIA 1F2PA 4P4DA 1PYTB 2ZELA 2V8DA 3B3SA 3JRUA 4YU9A 3V2BA 4P4BA 2CTBA 4PXDA 4UIAA 4OC0A 4NGRA 4GVVA 3SIIA 2AFSA 3FX6A 4AXVA 5IB9A 4KSIA 5FSUA 2G9DA 3SJGA 4PXBA 4Q7AA 3V45A 2VRIA 3H8EA 3B3VA 2PVVA 2WYRA 2DX6A 1VIXA 4JZ0A 5ELYA 4P4EA 5JM6A 2PJ6A 3BHXA 1Y0YA 1ZG7A 1Z2LA 3GB0A 4NGNA 3FMCA 2DEAA 4DYOA 2PRQA 3RBUA 3T8WA 3IIDA 2V8VA 3D7GA 3D66A 2ZEGA 3BI1A 1BAVA 3EW5A 5HVHA 3CDXA 2AFCA 1F57A 3SI1A 4MHZA 4KYBA 2F8HA 2PIZA 3JZTA 3NH4A 4O23A 5JGFA 1GYTA 1TKFA 1TXRA 2FVGA 4MHPA 3D7FA 4GVWA 5D29A 1VHUA 2ZEFA 5THWA 1YSJA 1UWYA 5I4MA 3KQXA 5D8NA 4ABLA 4B6ZA 3GLJA 5FSZA 4OIWA 1QMUA 2C6GA 2CIJA 4UEFA 4EMEA 4D86A 2CTCA 2Q43A 2JEWA 1CBXA 2GLFA 2PJ2A 1CP7A 8CPAA 4OC4A 2NYQA 3RZAA 4P4JA 3S9MA 5CBMA 4FUUA 3SJFA 4JYWA 1ZR5A 4P4IA 1NSAA 5HXDA 2EK8A 4W9YA 5CB3A 5LRGA 1LAPA 3SJXA 2HB6A 1CP6A 3DLJA 4X3RA 3WC5A 3CPXA 3I1UA 4FAIA 4ZYQA 3D7DA 3K9TA 3RAMA 3PB6X 4ONWA 2AFMA 3WC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OBR A;  3LWU A;  2ZEH A;  2FG1 A;  2OR4 A;  3IC1 A;  1FT7 A;  3GPO A;  2ANP A;  5HVG A;  3FF3 A;  1PCA A;  2AFX A;  3V7Z A;  1XMB A;  3FVL A;  3WC6 A;  3GPG A;  2GRE A;  4MCQ A;  1HDU A;  4IK2 A;  3KR5 A;  5K8M A;  2O4H A;  3HUV A;  1CPS A;  2VL1 A;  3EWO A;  4ABK A;  1IY7 A;  2ZOF A;  1R43 A;  1LAM A;  1LAN A;  3S9L A;  3KHZ A;  4NJR A;  2XEJ A;  3VH9 A;  3IWW A;  4CPA A;  1Z8L A;  4RUH A;  1TY8 A;  2PJ8 A;  1YW6 A;  5AIL A;  4FWU A;  2NSM A;  4UML A;  3SJE A;  3PB4 X;  1NJR A;  2ZEE A;  1JQG A;  2PIY A;  1DTD A;  3EWQ A;  3IFE A;  3PFO A;  4OC2 A;  4NGS A;  1TF8 A;  1CX8 A;  2PE3 A;  3CPA A;  5K8O A;  2XEI A;  5HIH A;  3SI2 A;  1SPV A;  5FSY A;  3B3T A;  4NGQ A;  1XBU A;  2EK9 A;  3EJG A;  3D4U A;  3VAT A;  4J4Z A;  3PFE A;  2ZEP A;  3BXM A;  3KAS A;  4P45 A;  4R76 A;  3B3C A;  3FED A;  5HVF A;  1LCP A;  2FXK A;  1CPX A;  3PB8 X;  3KGQ A;  2RFH A;  3MRU A;  1ZLI A;  2ZEN A;  6CPA A;  5JH9 A;  5LYI A;  1HDQ A;  3B35 A;  2PJB A;  1H8L A;  5K8P A;  2AFO A;  4DUK A;  2JBK A;  1XFO A;  2Q4Z A;  5DUS A;  4PXE A;  3PB9 X;  1QQ9 A;  4F9V A;  5CB5 A;  4MHY A;  4MCP A;  4IQY A;  1FNO A;  2C1C A;  4TWE A;  3V38 A;  2EEE A;  4DJL A;  2LGR A;  3KR4 A;  3GPQ A;  2PJ0 A;  4ZX9 A;  4ETK A;  3KL9 A;  2IJZ A;  4OKO A;  2F7V A;  2HC9 A;  2BCO A;  3SIG A;  5E3B A;  2ZEM A;  2AFZ A;  4J5R A;  2AFW A;  1HJZ A;  2C6C A;  2V8H A;  3PBE A;  3PRT A;  3CT9 A;  4NFR A;  3S9N A;  1XJO A;  4GUA A;  4JCA A;  3KHX A;  1ELL P;  3D7H A;  3KI9 A;  1ZR3 A;  4WWV A;  2I3C A;  5F09 A;  4G1P A;  2XD7 A;  2PJC A;  2XEG A;  4PPZ A;  4OC1 A;  2GU2 A;  4MMO A;  1YME A;  2IMO A;  4TNU A;  4F8Z A;  1BLL E;  3LMS A;  4X2T A;  5LYD A;  1KWM A;  4J5S A;  1CG2 A;  3ISX A;  4ZI6 A;  2PJ3 A;  3IEH A;  4TU0 A;  2POK A;  4GM5 A;  3IO1 A;  4PQA A;  3TC8 A;  1ARM A;  1M4L A;  1TKJ A;  5CPA A;  2C6P A;  4A37 A;  1AMP A;  3EWR A;  3B2Y A;  3DGV A;  4MCR A;  4A38 A;  3SIH A;  4A94 A;  1XRY A;  2O53 A;  2PVW A;  4K3N A;  1ZG8 A;  2X47 A;  3GUX A;  3K2K A;  1VHO A;  1LOK A;  5DS0 A;  1Y0R A;  2BFQ A;  3NFZ A;  3PB7 X;  1YD9 A;  3WT4 A;  1HEE A;  2CF4 A;  3IIF A;  4MCS A;  3VFQ A;  3IJ3 A;  1Z5R A;  2QJ8 A;  3HLP A;  4WJB A;  4ESS A;  4ZY2 A;  1Y7E A;  3EJF A;  4OC3 A;  5FSV A;  4NGT A;  2WZN A;  4X8I A;  3KQZ A;  2IQ6 A;  1TKH A;  5HOL A;  5K8N A;  4MRI A;  3D68 A;  4FBE A;  5LRK A;  1ELM P;  4J5Q A;  4OME A;  3QNV A;  4P4F A;  2AFU A;  2PJ7 A;  2ZEO A;  2PCU A;  2FAV A;  2OOT A;  2XEF A;  2PJ5 A;  3Q6Z A;  1VGY A;  2BOA A;  3WAB A;  4F9U A;  2V77 A;  3FJU A;  3PBB A;  1TF9 A;  4UEZ A;  4EFD A;  2PJ9 A;  3EKE A;  4A39 A;  1BPN A;  4JVV A;  4OP4 A;  3ISZ A;  5CMS A;  2V8G A;  1EE3 P;  4LQG A;  4R6T A;  2PJ1 A;  3EWP A;  2QVP A;  4NJQ A;  1TXZ A;  2QYV A;  4H2K A;  5FSX A;  3GQO A;  2BO9 A;  3VAR A;  3H8G A;  3TX8 A;  2J9A A;  4ZY0 A;  3MN8 A;  5LRJ A;  1AYE A;  5LYL A;  4K0C A;  2ACF A;  1IGB A;  5LYF A;  3Q71 A;  1VHE A;  2GLJ A;  4OID A;  3H8F A;  1F2O A;  1Q7L A;  4MXU A;  3KZW A;  3IIB A;  2PJA A;  3FH4 A;  4EWT A;  4UF4 A;  3B7I A;  4UEE A;  3PEI A;  4YWY A;  4NGM A;  1ZLH A;  2EWB A;  4ZY1 A;  4OC5 A;  3N5F A;  2ZOG A;  3D67 A;  4NGP A;  2JBJ A;  2BFR A;  3SIJ A;  3B3W A;  4JGK A;  2ABZ A;  4IHM A;  7CPA A;  3GQE A;  1LFW A;  1R3N A;  2L8R A;  3SI0 A;  4Z65 A;  2PJ4 A;  4R7M A;  4MHN A;  1ZG9 A;  4JLL A;  3NH5 A;  4IAV A;  4PXC A;  1YLO A;  4ZX8 A;  3FEC A;  3BI0 A;  4R8F A;  5J1Q A;  2ZED A;  1DE4 C;  4BD9 A;  1RTQ A;  3FEE A;  1BPM A;  1ARL A;  1YW4 A;  4P6Y A;  2Q51 A;  3NA6 A;  4UIB A;  2RB7 A;  4P10 A;  3NH8 A;  4ETJ A;  4P44 A;  3L2N A;  3ETI A;  1F2P A;  4P4D A;  1PYT B;  2ZEL A;  2V8D A;  3B3S A;  3JRU A;  4YU9 A;  3V2B A;  4P4B A;  2CTB A;  4PXD A;  4UIA A;  4OC0 A;  4NGR A;  4GVV A;  3SII A;  2AFS A;  3FX6 A;  4AXV A;  5IB9 A;  4KSI A;  5FSU A;  2G9D A;  3SJG A;  4PXB A;  4Q7A A;  3V45 A;  2VRI A;  3H8E A;  3B3V A;  2PVV A;  2WYR A;  2DX6 A;  1VIX A;  4JZ0 A;  5ELY A;  4P4E A;  5JM6 A;  2PJ6 A;  3BHX A;  1Y0Y A;  1ZG7 A;  1Z2L A;  3GB0 A;  4NGN A;  3FMC A;  2DEA A;  4DYO A;  2PRQ A;  3RBU A;  3T8W A;  3IID A;  2V8V A;  3D7G A;  3D66 A;  2ZEG A;  3BI1 A;  1BAV A;  3EW5 A;  5HVH A;  3CDX A;  2AFC A;  1F57 A;  3SI1 A;  4MHZ A;  4KYB A;  2F8H A;  2PIZ A;  3JZT A;  3NH4 A;  4O23 A;  5JGF A;  1GYT A;  1TKF A;  1TXR A;  2FVG A;  4MHP A;  3D7F A;  4GVW A;  5D29 A;  1VHU A;  2ZEF A;  5THW A;  1YSJ A;  1UWY A;  5I4M A;  3KQX A;  5D8N A;  4ABL A;  4B6Z A;  3GLJ A;  5FSZ A;  4OIW A;  1QMU A;  2C6G A;  2CIJ A;  4UEF A;  4EME A;  4D86 A;  2CTC A;  2Q43 A;  2JEW A;  1CBX A;  2GLF A;  2PJ2 A;  1CP7 A;  8CPA A;  4OC4 A;  2NYQ A;  3RZA A;  4P4J A;  3S9M A;  5CBM A;  4FUU A;  3SJF A;  4JYW A;  1ZR5 A;  4P4I A;  1NSA A;  5HXD A;  2EK8 A;  4W9Y A;  5CB3 A;  5LRG A;  1LAP A;  3SJX A;  2HB6 A;  1CP6 A;  3DLJ A;  4X3R A;  3WC5 A;  3CPX A;  3I1U A;  4FAI A;  4ZYQ A;  3D7D A;  3K9T A;  3RAM A;  3PB6 X;  4ONW A;  2AFM A;  3WC7 A; 
#chains in the Genus database with same CATH topology
 1RXT A;  3S6K A;  1OBR A;  5F49 A;  1XF8 A;  1IID A;  3LWU A;  1NMT A;  2ZEH A;  3BLN A;  4HPS A;  2FG1 A;  2OR4 A;  3IC1 A;  2EVN A;  3DSB A;  5G1Z A;  1FT7 A;  3GPO A;  2ANP A;  5HVG A;  2REE A;  2YNC C;  3FF3 A;  1PCA A;  2AFX A;  3V7Z A;  4CAW A;  2O28 A;  1XMB A;  2C27 A;  5G21 A;  3FVL A;  3QAH A;  3WC6 A;  3GPG A;  1XE4 A;  1QST A;  2GRE A;  4MCQ A;  1HDU A;  4R3K A;  2HQY A;  4IK2 A;  4F0Y A;  3KR5 A;  4BMH A;  1IIC A;  2JEV A;  2RC4 A;  4CAF A;  2FIA A;  5K8M A;  2O4H A;  1BO4 A;  2DPS A;  3HUV A;  1CPS A;  3EXN A;  2VL1 A;  3EWO A;  4U9Z A;  1Q2D A;  4ABK A;  5FVJ A;  1IY7 A;  2ZOF A;  1R43 A;  2F5I A;  4JXQ A;  3IWE A;  2Q7B A;  1LAM A;  4PSX A;  4HNY B;  4U9Y A;  1LAN A;  3S9L A;  4KLW A;  2YND A;  3KHZ A;  4NJR A;  2W2G A;  2XEJ A;  3IWW A;  4FD7 A;  1Z8L A;  3VH9 A;  3TO9 A;  4CPA A;  4RUH A;  1TY8 A;  2PJ8 A;  5AG4 A;  1YW6 A;  3A9L A;  5AIL A;  4FWU A;  4KS9 A;  2NSM A;  4UML A;  3SJE A;  1KUX A;  3PB4 X;  1NJR A;  2ZEE A;  1JQG A;  4Y49 C;  4CAX A;  2PIY A;  1DTD A;  3EWQ A;  5A27 A;  2OZH A;  2B4D B;  3IFE A;  4M6I A;  3PFO A;  3TCV A;  4K30 A;  4KOV A;  4KSA A;  4OC2 A;  5IB0 A;  2Q04 A;  4NGS A;  1TF8 A;  5C82 A;  4KZT A;  2CY2 A;  2WPX A;  4R9M A;  1CX8 A;  2PE3 A;  3V8I A;  1Z8X A;  5HH1 A;  2WCT A;  4J3G A;  3CPA A;  4KOX A;  3QAY A;  5K8O A;  2I00 A;  2DF5 A;  2XEI A;  5HIH A;  2GE3 A;  3SI2 A;  1PUA A;  1SPV A;  4C7H A;  3D8P A;  1S60 A;  5FSY A;  1TIQ A;  2Z3P A;  3FNC A;  3P2F A;  3B3T A;  1IOI A;  1B6B A;  1XBU A;  2I79 A;  4NGQ A;  4UCP A;  3TO7 A;  1VHS A;  4NSQ A;  2EK9 A;  4CRY B;  3EJG A;  3D4U A;  4MY3 A;  4AB7 A;  4CAV A;  3D2M A;  3VAT A;  4PV6 A;  4J4Z A;  4MFQ A;  2ZW4 A;  3PFE A;  1KZF A;  1WK4 A;  2QIR A;  2ZEP A;  4B5P B;  3BXM A;  2R7H A;  3KAS A;  2FCK A;  4R76 A;  3B3C A;  3FED A;  4P45 A;  5HVF A;  1LCP A;  2FXK A;  4C2Z A;  1CPX A;  3PB8 X;  3KGQ A;  2RFH A;  4CYQ A;  3S6H A;  5ISV A;  3MRU A;  2ATR A;  1YLE A;  1ZLI A;  2VZY A;  2OU2 A;  2ZEN A;  3GY9 A;  4A2Z A;  1MJ9 A;  3QB8 A;  4FD5 A;  6CPA A;  5JH9 A;  4C2X A;  4F0X A;  4UA3 A;  3JUW A;  2JLM A;  5LYI A;  2Z11 A;  1HDQ A;  3B35 A;  2PJB A;  1H8L A;  1NE9 A;  5K8P A;  4XPK A;  1OZP A;  2AFO A;  4DUK A;  2JBK A;  1R57 A;  4AVC A;  1XFO A;  2Q4Z A;  5DUS A;  4PXE A;  2H5M A;  3PB9 X;  1QQ9 A;  2NMT A;  4KLV A;  3R96 A;  3W91 A;  4F9V A;  5CB5 A;  4UFV A;  3T90 A;  2PR8 A;  2PR1 A;  4MHY A;  4MCP A;  4IQY A;  1FNO A;  2C1C A;  4KVX A;  4TWE A;  3V38 A;  1XEB A;  2EEE A;  4DJL A;  2LGR A;  3KR4 A;  3GPQ A;  2YNE A;  3EC4 A;  2PJ0 A;  4ZX9 A;  4ETK A;  4JWP A;  3KL9 A;  2IJZ A;  5IV0 A;  3H4Q A;  4OKO A;  2F7V A;  2HC9 A;  2BCO A;  3SIG A;  5E3B A;  2ZEM A;  2AFZ A;  4JLY A;  4J5R A;  4QC6 A;  2AFW A;  3CXS A;  1HJZ A;  1ZO0 A;  2C6C A;  4PK3 A;  2V8H A;  3VWD A;  3PBE A;  1GHE A;  1ON0 A;  1M4G A;  4LQ6 A;  3PRT A;  3CT9 A;  4U5Y A;  4C7I A;  1S7F A;  4NFR A;  4ORF A;  3S9N A;  1XJO A;  4GUA A;  1KUV A;  2FE7 A;  2B3V A;  3MGD A;  2B58 A;  5F47 A;  4JCA A;  3KHX A;  4A31 A;  1ELL P;  2REF A;  3FXT A;  5HMN A;  3D7H A;  2Z3L A;  5EC4 A;  4B11 A;  3KI9 A;  1ZR3 A;  1YGH A;  3G3S A;  4WWV A;  2I3C A;  5F09 A;  4G1P A;  2BL1 A;  2XD7 A;  2KCW A;  2PJC A;  2FL4 A;  3F8K A;  4UFW A;  4CYN A;  2XEG A;  3UY5 A;  4PPZ A;  4OC1 A;  2GU2 A;  3S6G A;  4B5P A;  3RYO A;  4MMO A;  3VWE A;  4MFP A;  4CGO A;  4RI1 A;  1CJW A;  2VBQ A;  3IGR A;  1YME A;  4I49 A;  2KQV A;  2IL4 A;  2IMO A;  4KOU A;  4TNU A;  1BLL E;  3LMS A;  2JZD A;  4X2T A;  4F8Z A;  5LYD A;  4AVB A;  2BEI A;  1KWM A;  4J5S A;  1CG2 A;  3ISX A;  4BBH A;  4ZI6 A;  2PJ3 A;  3IEH A;  5A28 A;  4X5K A;  5G20 A;  4XPD B;  5AG7 A;  4TU0 A;  4M3S A;  1QSR A;  4OAD A;  5JPH A;  3FYN A;  4L89 A;  2K5T A;  2POK A;  2VQY A;  4GM5 A;  3IO1 A;  4H89 A;  4M6G A;  3ZZI A;  3IWG A;  4PQA A;  3TC8 A;  1ARM A;  1FY7 A;  1M4L A;  1TKJ A;  5CPA A;  2C6P A;  4A37 A;  1AMP A;  5KTA A;  3EWR A;  2J8R A;  3B2Y A;  3DGV A;  2Q0Y A;  4MCR A;  3BJ8 A;  4KVM E;  3KKW A;  4A38 A;  3SIH A;  1XOV A;  5DWM A;  4A94 A;  1XRY A;  2BSW A;  2J8N A;  2O53 A;  2PVW A;  4UCM A;  3RNZ A;  4BIN A;  4K3N A;  1ZG8 A;  2X47 A;  3GUX A;  3K2K A;  1VHO A;  3R9E A;  1QSO A;  3R95 A;  4H6Z A;  4E8O A;  1LOK A;  5DS0 A;  1Y0R A;  2BFQ A;  1S7L A;  4LX9 A;  3LD2 A;  3NFZ A;  3PB7 X;  4IF5 A;  1YD9 A;  4RS2 A;  5GCN A;  3WT4 A;  1HEE A;  4B12 A;  2CF4 A;  3IIF A;  2OH1 A;  2G0B A;  4MCS A;  3VFQ A;  3IJ3 A;  1Z5R A;  2PQ8 A;  2QJ8 A;  4UWJ A;  5AG6 A;  3SXO A;  3HLP A;  4WJB A;  4YGO A;  3EO4 A;  4ESS A;  4ZY2 A;  4XNH B;  1YVO A;  1Y7E A;  3EJF A;  4OC3 A;  5FSV A;  1Q2Y A;  4NGT A;  2JDD A;  3R9G A;  1P0H A;  2ODF A;  2WZN A;  5AGE A;  4X8I A;  3KQZ A;  1XMT A;  3F0A A;  1IYK A;  1I12 A;  4UFX A;  2IQ6 A;  3N7Z A;  4CGM A;  1TKH A;  5HOL A;  1M1D A;  2JZF A;  4B14 A;  5K8N A;  1AUG A;  4AVA A;  3D3S A;  4MRI A;  2OB0 A;  3D68 A;  4FBE A;  2Y0M A;  5KTC A;  5LRK A;  1ELM P;  2B5G B;  4RN7 A;  4NCZ A;  3ZJ0 A;  4J5Q A;  3TTH A;  4OME A;  3QNV A;  4KOT A;  4P4F A;  1S7N A;  2AFU A;  2PJ7 A;  2ZEO A;  2PCU A;  2EBJ A;  2FAV A;  3DR8 A;  2OOT A;  2XEF A;  4E0A A;  4KUB A;  2ARH A;  1MJB A;  2PJ5 A;  3Q6Z A;  4C68 A;  4CGL A;  4Q38 A;  4XPD C;  3W6X A;  1VGY A;  2FIW A;  2B4D A;  4QB9 A;  5J8C A;  2BOA A;  3WAB A;  4F9U A;  2V77 A;  3FJU A;  3PBB A;  4R57 A;  1TF9 A;  5F48 A;  1MJA A;  4UEZ A;  4B5O A;  4MFK A;  4DNC A;  2PJ9 A;  2EUI A;  4AG7 A;  4EFD A;  5C88 A;  3EKE A;  4A39 A;  3P2H A;  4A95 A;  1BPN A;  4JVV A;  4C2Y A;  4OP4 A;  2Z0Z A;  5H84 A;  2ZW7 A;  1Y9K A;  3ISZ A;  3NE8 A;  5CMS A;  2V8G A;  1EE3 P;  2CNM A;  4LQG A;  4R6T A;  1A2Z A;  2PJ1 A;  4HNX B;  4NEX A;  3EWP A;  2QVP A;  4MFZ A;  4NJQ A;  1TXZ A;  4FD6 A;  4GS4 A;  2QYV A;  4H2K A;  5FSX A;  4CRZ B;  3GQO A;  3R9F A;  4OLL A;  1B87 A;  4P4D A;  2BO9 A;  2PDO A;  4KOS A;  3VAR A;  3H8G A;  3TX8 A;  3GIU A;  2J9A A;  3FB3 A;  2AJ6 A;  2FXF A;  1YRE A;  2RNK A;  4ZY0 A;  3MN8 A;  4KUA A;  2FS5 A;  5LRJ A;  1AYE A;  5LYL A;  4QBJ A;  2EO8 A;  3NE7 A;  4K0C A;  2ACF A;  1IGB A;  5LYF A;  3Q71 A;  2JZE A;  3IU1 A;  1VHE A;  2OZG A;  2GLJ A;  2Q4Y A;  3H5Z A;  2PSW A;  4OID A;  3G8W A;  3H8F A;  1F2O A;  1Q7L A;  5KTD A;  2Q44 A;  4MXU A;  3KZW A;  5AG5 A;  3IIB A;  3JVN A;  2PJA A;  3FH4 A;  4EWT A;  1JWQ A;  2P6F A;  3BJ7 A;  3PGP A;  4UF4 A;  5IX3 A;  2DXQ A;  1K4J A;  3B7I A;  4MI4 A;  4L8A A;  4UEE A;  2ZW5 A;  3PEI A;  1YVK A;  2R1I A;  4YWY A;  1M4D A;  2GIV A;  4NGM A;  1L0C A;  1IB1 E;  3TOA A;  1ZLH A;  2EWB A;  3FBU A;  4ZY1 A;  4OC5 A;  3I3G A;  5EMI A;  4IUS A;  3N5F A;  2ZOG A;  2WUU A;  1MK4 A;  2Z3K A;  3D67 A;  4B13 A;  1N71 A;  2X7B A;  4JJX A;  4NGP A;  4CYP A;  2JBJ A;  2R98 A;  4JXR A;  1IOF A;  2BFR A;  2J8M A;  4H6U A;  4M85 A;  2Z3M A;  3LOD A;  3RO0 A;  3SIJ A;  3B3W A;  4LUA A;  4JGK A;  2ABZ A;  4IHM A;  7CPA A;  2R8V A;  4KOY A;  3GQE A;  1LFW A;  1R3N A;  3FIX A;  2L8R A;  4KOR A;  3SI0 A;  4Z65 A;  2PJ4 A;  4R7M A;  2B3U A;  3OWC A;  4HKF A;  5H86 A;  4MHN A;  4ZGY B;  4NF1 A;  3JTK A;  1ZG9 A;  4AG9 A;  4JLL A;  3NH5 A;  4IAV A;  4PXC A;  1YLO A;  4MY0 A;  4ZX8 A;  3PZJ A;  3F5B A;  4CS0 B;  4EVY A;  2G3A A;  3FEC A;  3BI0 A;  4KVO E;  4R8F A;  2Q7S A;  3SHP A;  5F46 A;  2ZED A;  5BWA B;  4NXY A;  5J1Q A;  1IU8 A;  1DE4 C;  2VEZ A;  1J4J A;  1RTQ A;  4KOW A;  4R3L A;  4UCN A;  4BD9 A;  2QML A;  3FEE A;  1BPM A;  1ARL A;  1X10 A;  1YW4 A;  2VI7 A;  3CZX A;  4P6Y A;  3R1K A;  4JD6 A;  4MFJ A;  2Q51 A;  3NA6 A;  1QSN A;  4UIB A;  1Z8T A;  3TOB A;  2RB7 A;  4ZBG A;  4P10 A;  2Q4V A;  3NH8 A;  1KUY A;  2ZXV A;  4HNW B;  4E2A A;  4ETJ A;  2Z10 A;  4P44 A;  4A33 A;  3L2N A;  3ETI A;  1F2P A;  3DNS A;  1X12 A;  3GKR A;  1PYT B;  1SQH A;  1Y9W A;  2V8D A;  2ZEL A;  3B3S A;  1I21 A;  3JRU A;  4YU9 A;  3V2B A;  4P4B A;  2PRB A;  2CTB A;  1Z4E A;  2VXK A;  3SXN A;  4PXD A;  4UIA A;  1NSL A;  2WSA A;  2A4N A;  4OC0 A;  4NGR A;  4GVV A;  1CM0 A;  2B5G A;  3SII A;  2FT0 A;  2AFS A;  4YRH A;  3TO6 A;  5JQ4 A;  3FX6 A;  1I1D A;  4PSW A;  1YQE A;  3GYA A;  4AXV A;  5IB9 A;  2B4B A;  4KSI A;  5FSU A;  2G9D A;  3SJG A;  3TFY A;  2G3T A;  2ZPA A;  4PXB A;  4Q7A A;  3V45 A;  2VRI A;  3H8E A;  1QSM A;  2YGW A;  3B3V A;  2PVV A;  2WYR A;  4Q36 A;  1Z8W A;  2DX6 A;  2DPT A;  1VIX A;  4JZ0 A;  4MJ8 A;  5J8F A;  2CNT A;  3CXQ A;  4P4E A;  4XNH C;  5ELY A;  4CGP A;  5JM6 A;  3TE4 A;  1YX0 A;  2PJ6 A;  3BHX A;  3WR7 A;  1Y0Y A;  1ZG7 A;  1Z2L A;  3GB0 A;  3I9S A;  4NGN A;  1RO5 A;  3FMC A;  4A32 A;  2DEA A;  4DYO A;  2PRQ A;  3RBU A;  1S5K A;  3T8W A;  3IID A;  1IYL A;  2V8V A;  2WPW A;  1LRZ A;  3EFA A;  4XPL A;  3S6F A;  4UWI A;  2P6E A;  3D7G A;  5E96 A;  3D66 A;  3K9U A;  2ZEG A;  3PP9 A;  3BI1 A;  4R87 A;  1Z4R A;  1BAV A;  5EBV A;  1YR0 A;  3EW5 A;  5HVH A;  1S3Z A;  3CDX A;  1U6M A;  4QUS A;  2AFC A;  4CYO A;  1F57 A;  1Q2C A;  2BUE A;  4MHZ A;  3SI1 A;  1BOB A;  1M4I A;  1V0C A;  4A30 A;  4KYB A;  2D4P A;  2F8H A;  5I0C A;  3EY5 A;  4OAE A;  2PIZ A;  3JZT A;  3NH4 A;  4O23 A;  4Y49 B;  4ONU A;  5JGF A;  1GYT A;  1TKF A;  1TXR A;  2CNS A;  4GXH A;  2FVG A;  3TT2 A;  4MHP A;  3D7F A;  3DR6 A;  4MFL A;  4GVW A;  5DWN A;  5D29 A;  5CNP A;  5G22 A;  1VHU A;  2P6G A;  2ZEF A;  3B8G A;  5THW A;  1YSJ A;  1UWY A;  5I4M A;  1VKC A;  3KQX A;  5D8N A;  3DDD A;  4QVT A;  1Z9U A;  4ABL A;  2JDC A;  3LAC A;  2HV2 A;  2Z3O A;  4B6Z A;  3GLJ A;  1P4N A;  4CAE A;  2OZU A;  2VZZ A;  4B10 A;  5FSZ A;  4OIW A;  1QMU A;  2CXA A;  2D4O A;  2C6G A;  2CIJ A;  1Y7R A;  2P0W A;  2ZW6 A;  3E0K A;  4D86 A;  2CTC A;  4UEF A;  4EME A;  2Q43 A;  2AE6 A;  2JEW A;  3D2P A;  4II9 A;  1CBX A;  3W6S A;  2GLF A;  2PJ2 A;  1CP7 A;  8CPA A;  4OC4 A;  2NYQ A;  2GFQ A;  3CXP A;  3RZA A;  2HUZ A;  1S7K A;  2FSR A;  4P4J A;  4M6H A;  4PK2 A;  3FRM A;  4MBU A;  3S9M A;  1XIX A;  4FD4 A;  5CBM A;  2PC1 A;  2YNC A;  4FUU A;  4JYW A;  3SJF A;  3IU2 A;  4YFJ A;  1ZR5 A;  1YK3 A;  4P4I A;  1NSA A;  2GAN A;  5HXD A;  2EK8 A;  4W9Y A;  4CGN A;  5CB3 A;  1WWZ A;  5LRG A;  1LAP A;  3SJX A;  2HB6 A;  1CP6 A;  4F6A A;  3DLJ A;  4X3R A;  3WC5 A;  3T9Y A;  2Z3N A;  3C26 A;  2QEC A;  4MHD A;  3CPX A;  3I1U A;  4KSF A;  4ZYQ A;  4FAI A;  3D7D A;  3K9T A;  4UBR A;  3RAM A;  1M44 A;  3PB6 X;  4ONW A;  2AFM A;  1PU9 A;  3WC7 A;  1UFH A; 
#chains in the Genus database with same CATH homology
 1OBR A;  3LWU A;  2ZEH A;  2FG1 A;  2OR4 A;  3IC1 A;  1FT7 A;  3GPO A;  2ANP A;  5HVG A;  3FF3 A;  1PCA A;  2AFX A;  3V7Z A;  1XMB A;  3FVL A;  3WC6 A;  3GPG A;  2GRE A;  4MCQ A;  1HDU A;  4IK2 A;  3KR5 A;  5K8M A;  2O4H A;  3HUV A;  1CPS A;  2VL1 A;  3EWO A;  4ABK A;  1IY7 A;  2ZOF A;  1R43 A;  1LAM A;  1LAN A;  3S9L A;  3KHZ A;  4NJR A;  2XEJ A;  3VH9 A;  3IWW A;  4CPA A;  1Z8L A;  4RUH A;  1TY8 A;  2PJ8 A;  1YW6 A;  5AIL A;  4FWU A;  2NSM A;  4UML A;  3SJE A;  3PB4 X;  1NJR A;  2ZEE A;  1JQG A;  2PIY A;  1DTD A;  3EWQ A;  3IFE A;  3PFO A;  4OC2 A;  4NGS A;  1TF8 A;  1CX8 A;  2PE3 A;  3CPA A;  5K8O A;  2XEI A;  5HIH A;  3SI2 A;  1SPV A;  5FSY A;  3B3T A;  4NGQ A;  1XBU A;  2EK9 A;  3EJG A;  3D4U A;  3VAT A;  4J4Z A;  3PFE A;  2ZEP A;  3BXM A;  3KAS A;  4P45 A;  4R76 A;  3B3C A;  3FED A;  5HVF A;  1LCP A;  2FXK A;  1CPX A;  3PB8 X;  3KGQ A;  2RFH A;  3MRU A;  1ZLI A;  2ZEN A;  6CPA A;  5JH9 A;  5LYI A;  1HDQ A;  3B35 A;  2PJB A;  1H8L A;  5K8P A;  2AFO A;  4DUK A;  2JBK A;  1XFO A;  2Q4Z A;  5DUS A;  4PXE A;  3PB9 X;  1QQ9 A;  4F9V A;  5CB5 A;  4MHY A;  4MCP A;  4IQY A;  1FNO A;  2C1C A;  4TWE A;  3V38 A;  2EEE A;  4DJL A;  2LGR A;  3KR4 A;  3GPQ A;  2PJ0 A;  4ZX9 A;  4ETK A;  3KL9 A;  2IJZ A;  4OKO A;  2F7V A;  2HC9 A;  2BCO A;  3SIG A;  5E3B A;  2ZEM A;  2AFZ A;  4J5R A;  2AFW A;  1HJZ A;  2C6C A;  2V8H A;  3PBE A;  3PRT A;  3CT9 A;  4NFR A;  3S9N A;  1XJO A;  4GUA A;  4JCA A;  3KHX A;  1ELL P;  3D7H A;  3KI9 A;  1ZR3 A;  4WWV A;  2I3C A;  5F09 A;  4G1P A;  2XD7 A;  2PJC A;  2XEG A;  4PPZ A;  4OC1 A;  2GU2 A;  4MMO A;  1YME A;  2IMO A;  4TNU A;  4F8Z A;  1BLL E;  3LMS A;  4X2T A;  5LYD A;  1KWM A;  4J5S A;  1CG2 A;  3ISX A;  4ZI6 A;  2PJ3 A;  3IEH A;  4TU0 A;  2POK A;  4GM5 A;  3IO1 A;  4PQA A;  3TC8 A;  1ARM A;  1M4L A;  1TKJ A;  5CPA A;  2C6P A;  4A37 A;  1AMP A;  3EWR A;  3B2Y A;  3DGV A;  4MCR A;  4A38 A;  3SIH A;  4A94 A;  1XRY A;  2O53 A;  2PVW A;  4K3N A;  1ZG8 A;  2X47 A;  3GUX A;  3K2K A;  1VHO A;  1LOK A;  5DS0 A;  1Y0R A;  2BFQ A;  3NFZ A;  3PB7 X;  1YD9 A;  3WT4 A;  1HEE A;  2CF4 A;  3IIF A;  4MCS A;  3VFQ A;  3IJ3 A;  1Z5R A;  2QJ8 A;  3HLP A;  4WJB A;  4ESS A;  4ZY2 A;  1Y7E A;  3EJF A;  4OC3 A;  5FSV A;  4NGT A;  2WZN A;  4X8I A;  3KQZ A;  2IQ6 A;  1TKH A;  5HOL A;  5K8N A;  4MRI A;  3D68 A;  4FBE A;  5LRK A;  1ELM P;  4J5Q A;  4OME A;  3QNV A;  4P4F A;  2AFU A;  2PJ7 A;  2ZEO A;  2PCU A;  2FAV A;  2OOT A;  2XEF A;  2PJ5 A;  3Q6Z A;  1VGY A;  2BOA A;  3WAB A;  4F9U A;  2V77 A;  3FJU A;  3PBB A;  1TF9 A;  4UEZ A;  4EFD A;  2PJ9 A;  3EKE A;  4A39 A;  1BPN A;  4JVV A;  4OP4 A;  3ISZ A;  5CMS A;  2V8G A;  1EE3 P;  4LQG A;  4R6T A;  2PJ1 A;  3EWP A;  2QVP A;  4NJQ A;  1TXZ A;  2QYV A;  4H2K A;  5FSX A;  3GQO A;  2BO9 A;  3VAR A;  3H8G A;  3TX8 A;  2J9A A;  4ZY0 A;  3MN8 A;  5LRJ A;  1AYE A;  5LYL A;  4K0C A;  2ACF A;  1IGB A;  5LYF A;  3Q71 A;  1VHE A;  2GLJ A;  4OID A;  3H8F A;  1F2O A;  1Q7L A;  4MXU A;  3KZW A;  3IIB A;  2PJA A;  3FH4 A;  4EWT A;  4UF4 A;  3B7I A;  4UEE A;  3PEI A;  4YWY A;  4NGM A;  1ZLH A;  2EWB A;  4ZY1 A;  4OC5 A;  3N5F A;  2ZOG A;  3D67 A;  4NGP A;  2JBJ A;  2BFR A;  3SIJ A;  3B3W A;  4JGK A;  2ABZ A;  4IHM A;  7CPA A;  3GQE A;  1LFW A;  1R3N A;  2L8R A;  3SI0 A;  4Z65 A;  2PJ4 A;  4R7M A;  4MHN A;  1ZG9 A;  4JLL A;  3NH5 A;  4IAV A;  4PXC A;  1YLO A;  4ZX8 A;  3FEC A;  3BI0 A;  4R8F A;  5J1Q A;  2ZED A;  1DE4 C;  4BD9 A;  1RTQ A;  3FEE A;  1BPM A;  1ARL A;  1YW4 A;  4P6Y A;  2Q51 A;  3NA6 A;  4UIB A;  2RB7 A;  4P10 A;  3NH8 A;  4ETJ A;  4P44 A;  3L2N A;  3ETI A;  1F2P A;  4P4D A;  1PYT B;  2ZEL A;  2V8D A;  3B3S A;  3JRU A;  4YU9 A;  3V2B A;  4P4B A;  2CTB A;  4PXD A;  4UIA A;  4OC0 A;  4NGR A;  4GVV A;  3SII A;  2AFS A;  3FX6 A;  4AXV A;  5IB9 A;  4KSI A;  5FSU A;  2G9D A;  3SJG A;  4PXB A;  4Q7A A;  3V45 A;  2VRI A;  3H8E A;  3B3V A;  2PVV A;  2WYR A;  2DX6 A;  1VIX A;  4JZ0 A;  5ELY A;  4P4E A;  5JM6 A;  2PJ6 A;  3BHX A;  1Y0Y A;  1ZG7 A;  1Z2L A;  3GB0 A;  4NGN A;  3FMC A;  2DEA A;  4DYO A;  2PRQ A;  3RBU A;  3T8W A;  3IID A;  2V8V A;  3D7G A;  3D66 A;  2ZEG A;  3BI1 A;  1BAV A;  3EW5 A;  5HVH A;  3CDX A;  2AFC A;  1F57 A;  3SI1 A;  4MHZ A;  4KYB A;  2F8H A;  2PIZ A;  3JZT A;  3NH4 A;  4O23 A;  5JGF A;  1GYT A;  1TKF A;  1TXR A;  2FVG A;  4MHP A;  3D7F A;  4GVW A;  5D29 A;  1VHU A;  2ZEF A;  5THW A;  1YSJ A;  1UWY A;  5I4M A;  3KQX A;  5D8N A;  4ABL A;  4B6Z A;  3GLJ A;  5FSZ A;  4OIW A;  1QMU A;  2C6G A;  2CIJ A;  4UEF A;  4EME A;  4D86 A;  2CTC A;  2Q43 A;  2JEW A;  1CBX A;  2GLF A;  2PJ2 A;  1CP7 A;  8CPA A;  4OC4 A;  2NYQ A;  3RZA A;  4P4J A;  3S9M A;  5CBM A;  4FUU A;  3SJF A;  4JYW A;  1ZR5 A;  4P4I A;  1NSA A;  5HXD A;  2EK8 A;  4W9Y A;  5CB3 A;  5LRG A;  1LAP A;  3SJX A;  2HB6 A;  1CP6 A;  3DLJ A;  4X3R A;  3WC5 A;  3CPX A;  3I1U A;  4FAI A;  4ZYQ A;  3D7D A;  3K9T A;  3RAM A;  3PB6 X;  4ONW A;  2AFM A;  3WC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...