3H8GA

Bestatin complex structure of leucine aminopeptidase from pseudomonas putida
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
497
structure length
497
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 170
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8gA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8gA02
4ZYQA 5FSXA 4K0CA 4BD9A 3FX6A 2EK9A 4KYBA 4DYOA 2F8HA 1YD9A 2VRIA 5JM6A 2FXKA 3KQZA 3D7GA 3DLJA 5LRGA 2QVPA 4GM5A 2GREA 2LGRA 2AFMA 1AYEA 4OKOA 4H2KA 3GQOA 2EK8A 1CP7A 1LANA 4NGTA 5HIHA 4P45A 3D7FA 4OC3A 4PQAA 2FG1A 4UEZA 1NSAA 1Q7LA 3SJEA 2ZENA 4JVVA 3JRUA 1QQ9A 4P4FA 2IQ6A 4MCSA 5CB3A 5K8OA 3KQXA 2O53A 3IIFA 3GPQA 2QYVA 1GYTA 2HC9A 2PRQA 2PJ3A 4UMLA 2DX6A 1VHOA 1VHEA 4F9VA 4PXDA 3EJFA 3D4UA 4P4BA 4CPAA 1IGBA 3D7DA 3IWWA 4MRIA 3WT4A 3EWPA 2PJCA 4OMEA 3PFOA 3VARA 2C6PA 3GQEA 4IHMA 4OP4A 1TKJA 2ZEEA 4MCRA 2Q4ZA 4DUKA 3FEEA 4MCPA 2XEFA 2PJ0A 4PXEA 2PJ8A 1ELMP 1ZG8A 3PBBA 5AILA 3CPAA 3KHXA 4ABKA 4NJQA 4NGMA 4D86A 3H8EA 2PJAA 3B7IA 4GUAA 3LMSA 2EWBA 1TF9A 5FSYA 1Z8LA 4X2TA 5LYIA 4X8IA 4P6YA 4ZY1A 1TKFA 4EWTA 2I3CA 2JEWA 4OC2A 3HLPA 1LAPA 3EJGA 3S9NA 2JBJA 5E3BA 4KSIA 4JLLA 1VHUA 1Y0RA 1OBRA 1ZLHA 2DEAA 2JBKA 3IJ3A 3D7HA 3N5FA 2GLFA 3FF3A 3V2BA 1PYTB 4R76A 4MCQA 2O4HA 3KI9A 4UF4A 3K9TA 1TY8A 1TXZA 2PE3A 2CIJA 5CMSA 5LYLA 3NA6A 3GPOA 1CP6A 3SI2A 3PFEA 1LCPA 3PBEA 2AFCA 1ZG9A 2PVWA 4MHZA 2ZEDA 3KL9A 3SIJA 3PRTA 2GLJA 4G1PA 2POKA 1DTDA 1KWMA 4LQGA 4R6TA 4P44A 4J5RA 3D67A 5K8PA 4UEFA 3BHXA 1ZR5A 3BI0A 2ACFA 4FWUA 5FSVA 2ZEPA 3SIHA 2AFXA 4PXCA 2FAVA 5K8NA 3K2KA 1CBXA 2XEIA 1JQGA 3CPXA 1CPSA 2PVVA 4JYWA 3T8WA 3B3TA 1Z5RA 2BCOA 2CTCA 5DUSA 3PB9X 4MXUA 5LRJA 2EEEA 1M4LA 4NGSA 1TKHA 3TX8A 3I1UA 3NH4A 3EWOA 3BI1A 3S9MA 4TWEA 3Q6ZA 1F2PA 4WWVA 4F8ZA 3CDXA 4WJBA 1F57A 3V7ZA 3BXMA 3WC6A 1HDQA 2F7VA 1BPMA 2AFSA 4NGNA 5D29A 2V8GA 3IC1A 1R43A 4EMEA 2ZEHA 3KASA 4OIWA 4OIDA 3SJXA 3FECA 1IY7A 5HVFA 2OOTA 3PB7X 3RBUA 4ABLA 1Y0YA 2BFRA 1TXRA 3S9LA 3KR5A 1XBUA 3JZTA 2IMOA 8CPAA 2ZOGA 3KZWA 7CPAA 2CTBA 2ZOFA 2WZNA 4NGPA 4UEEA 4ZX8A 3SI1A 4PPZA 2XD7A 2BFQA 3B3SA 4UIBA 2PJ4A 3FEDA 4EFDA 3WC7A 4NGRA 3FMCA 2PJ9A 4A94A 4FBEA 5FSZA 4IAVA 4YWYA 3IIDA 2AFOA 2PJ2A 2X47A 4Z65A 1R3NA 4NFRA 4TNUA 4ZX9A 1YLOA 2PCUA 5IB9A 3PB8X 4YU9A 2WYRA 1RTQA 4A39A 4ZI6A 1HEEA 2ZELA 3RZAA 5LYDA 2J9AA 2V8HA 4FAIA 4J4ZA 3EW5A 3IEHA 2ABZA 4TU0A 5LYFA 4R8FA 1XJOA 3KR4A 5I4MA 3DGVA 1ARMA 4P4EA 3IIBA 4O23A 4FUUA 4R7MA 1FNOA 2PJ6A 4DJLA 5K8MA 3QNVA 3SJFA 5THWA 3D68A 3SIGA 4UIAA 2V8DA 4PXBA 5FSUA 4RUHA 2FVGA 1TF8A 4ESSA 1CG2A 4OC0A 4JZ0A 3SIIA 3LWUA 2BOAA 2HB6A 2RB7A 4P4JA 2XEJA 3H8FA 4AXVA 4GVWA 4A37A 1NJRA 1QMUA 1Z2LA 4ZY2A 3SJGA 5J1QA 5CPAA 4F9UA 4X3RA 1EE3P 3GLJA 3CT9A 1ZG7A 4NJRA 5HOLA 3FJUA 5CB5A 2PJ1A 3VFQA 4B6ZA 6CPAA 1ZLIA 3V38A 2V8VA 2ZEFA 3EWRA 2Q43A 1Y7EA 2L8RA 3IFEA 4P4DA 4ETKA 3Q71A 3GB0A 4NGQA 3VH9A 4MHPA 1LOKA 2ANPA 4JCAA 3V45A 2PJBA 5ELYA 1XRYA 3B35A 1XFOA 1HJZA 2BO9A 1YMEA 5F09A 1VGYA 3ISZA 1CPXA 3SI0A 4K3NA 2G9DA 3EWQA 2NYQA 1FT7A 2QJ8A 3KHZA 4JGKA 3FVLA 3D66A 1ZR3A 1ELLP 1LFWA 1UWYA 3FH4A 4IK2A 1ARLA 5CBMA 1YW6A 2C1CA 3GUXA 3B3WA 4GVVA 3B2YA 3B3VA 3ETIA 5HVHA 2CF4A 3L2NA 5HXDA 2C6GA 5JH9A 3NH8A 2PIYA 4A38A 3RAMA 3WABA 3PEIA 3PB4X 1YW4A 3MN8A 5HVGA 2OR4A 1H8LA 2IJZA 2ZEGA 3B3CA 2RFHA 4ZY0A 1BLLE 1AMPA 1CX8A 4P10A 5DS0A 4OC5A 3GPGA 4MMOA 3H8GA 1F2OA 5LRKA 2AFWA 4W9YA 3TC8A 1BPNA 3WC5A 3KGQA 4J5QA 1LAMA 4Q7AA 2C6CA 3ISXA 3VATA 4ONWA 1BAVA 2NSMA 2ZEOA 3HUVA 1DE4C 5JGFA 3NFZA 1PCAA 2Q51A 2PIZA 2AFZA 3MRUA 1SPVA 1VIXA 3PB6X 2AFUA 3NH5A 3EKEA 3IO1A 4MHYA 4MHNA 4OC1A 4J5SA 4OC4A 2V77A 2PJ5A 2VL1A 2PJ7A 1XMBA 5D8NA 4IQYA 4P4IA 1YSJA 2ZEMA 2GU2A 4ETJA 1HDUA 2XEGA
chains in the Genus database with same CATH superfamily
4ZYQA 2HQYA 4OADA 2EVNA 5FSXA 3IWGA 4K0CA 4JLYA 4BD9A 1YGHA 3FX6A 2DPTA 3I3GA 4XPKA 1Y9WA 2EK9A 1B87A 2AE6A 4KYBA 1BOBA 4DYOA 5KTCA 3FIXA 4B5PA 2F8HA 1YD9A 2VRIA 3D2MA 5JM6A 2FXKA 3KQZA 3D7GA 3DLJA 1OZPA 5LRGA 4XPDC 5CNPA 2QVPA 4GM5A 2GREA 2Y0MA 2LGRA 2VXKA 2AFMA 1AYEA 3EY5A 4OKOA 4H2KA 3GQOA 2EK8A 1CP7A 1LANA 4NGTA 1MJBA 5HIHA 4P45A 3R96A 1Z8TA 1JWQA 2FS5A 3D7FA 4KVOE 2B3VA 4H89A 4OC3A 4PQAA 2FG1A 4UEZA 1KUVA 1NSAA 1Q7LA 3TFYA 3SJEA 1RO5A 2ZENA 2OB0A 3JRUA 4JVVA 1QQ9A 4P4FA 2FIWA 2IQ6A 4MCSA 1ZO0A 3I9SA 5AG7A 5H84A 5CB3A 5K8OA 3KQXA 2O53A 2Z3NA 3IIFA 3GPQA 4NEXA 2QYVA 1GYTA 2HC9A 2VZZA 3QAYA 4R9MA 1Z4RA 3TT2A 2PRQA 4JWPA 4KSFA 2PJ3A 4C2ZA 4KOUA 4UMLA 2DX6A 2ZW4A 1QSRA 1VHOA 1VHEA 5EC4A 4CGLA 4F9VA 4PXDA 3EJFA 5GCNA 1NSLA 2ZW7A 3D4UA 4P4BA 1BO4A 2JZFA 3C26A 5AG6A 1VKCA 2B58A 4BINA 4CPAA 1IGBA 3D7DA 1Y7RA 3IWWA 4FD5A 4KS9A 4MRIA 4U5YA 3WT4A 4QUSA 3EWPA 1N71A 2PJCA 4OMEA 3PFOA 3VARA 2C6PA 3GIUA 2GANA 1KUYA 3GQEA 4UBRA 4IHMA 4OP4A 1TKJA 4F0XA 3VWDA 2ZEEA 4MCRA 2Q4ZA 2O28A 4DUKA 2CNSA 3FEEA 4MFQA 4MCPA 2XEFA 2PJ0A 4PXEA 2PJ8A 1ELMP 1ZG8A 1P4NA 3PBBA 5AILA 3CPAA 3KHXA 4B13A 4ABKA 4L89A 4NJQA 2B4DA 4CGMA 4NGMA 1IICA 5IB0A 1Q2CA 4D86A 5HH1A 1A2ZA 2R8VA 3S6FA 4HNXB 3S6HA 3W6SA 1FY7A 3H8EA 2PJAA 5EMIA 4CYQA 5F48A 2WUUA 2QECA 4GUAA 3B7IA 3LMSA 2EWBA 3FBUA 2CXAA 4UCPA 5AGEA 4UWJA 2B5GB 3JVNA 2J8NA 5DWMA 1XOVA 3LACA 4MFLA 5F47A 1TF9A 1TIQA 5FSYA 3PGPA 4JJXA 1Z8LA 4CAXA 4X2TA 4UA3A 2Q04A 2FE7A 5LYIA 2VZYA 4P6YA 4X8IA 4ZY1A 1TKFA 4EWTA 2I3CA 2RNKA 2BEIA 1Z8XA 1S7FA 3MGDA 1S7KA 3GKRA 2JEWA 4OC2A 4CYNA 3HLPA 1LAPA 1QSOA 3W91A 3EJGA 2JDDA 3S9NA 2JBJA 5E3BA 4KSIA 2D4PA 4JLLA 1CJWA 4PSWA 4KOVA 1VHUA 4MY0A 1Y0RA 4U9ZA 3S6KA 1OBRA 1ZLHA 2DEAA 2JBKA 3IJ3A 3D7HA 3N5FA 4PSXA 4UWIA 4DNCA 2GLFA 2VEZA 4XNHC 4CRYB 4KOSA 4E8OA 4II9A 3FF3A 3V2BA 5JPHA 1PYTB 2OZHA 4R76A 4MCQA 2O4HA 3KI9A 4UF4A 1AUGA 2ZW6A 1TY8A 3K9TA 1YQEA 4ZBGA 1TXZA 2Q44A 2PE3A 4J3GA 3P2FA 3NE8A 5AG4A 2B5GA 2CIJA 3V8IA 5CMSA 4HNYB 5LYLA 3NA6A 3GPOA 1S5KA 1CP6A 3SI2A 3G8WA 3PFEA 2YNDA 3F5BA 1LCPA 3NE7A 3PBEA 2AFCA 1IOFA 4AB7A 1ZG9A 2PVWA 2Q4VA 4RS2A 4MHZA 3R9GA 3B8GA 4QB9A 4ZGYB 2ZEDA 3KL9A 3SIJA 3CXPA 3PRTA 2GLJA 4G1PA 1MJ9A 4MFPA 2POKA 4MJ8A 4CYPA 1DTDA 3KKWA 1K4JA 1S7LA 1KWMA 2FXFA 4LQGA 4R6TA 4P44A 4J5RA 2K5TA 3D67A 4MFJA 4OAEA 4QC6A 4UEFA 5K8PA 3R9EA 2P6FA 3BHXA 4I49A 4PK3A 2Q0YA 1ZR5A 4A32A 1Q2DA 4CGNA 5HMNA 1YLEA 3BI0A 2ACFA 4FWUA 5FSVA 4KORA 4B11A 2ZEPA 3SIHA 4X5KA 4KUBA 5A28A 3FXTA 2AFXA 3SXNA 4PXCA 1QSMA 2FAVA 4UFXA 5K8NA 3K2KA 1CBXA 2G3AA 2XEIA 3ZJ0A 1JQGA 3CPXA 2Z11A 1Z4EA 1CM0A 1CPSA 4MI4A 5C88A 2PVVA 4JYWA 5G21A 3T8WA 2VI7A 2ATRA 1IU8A 3B3TA 2B4BA 1Z5RA 2BCOA 2CTCA 4UCNA 5DUSA 3PB9X 4KSAA 4MXUA 4PV6A 2EEEA 1YR0A 2WCTA 1M4LA 5LRJA 4CAVA 4C7HA 4NGSA 2ODFA 3DR8A 2CNMA 2IL4A 4C2YA 2BL1A 2REFA 2HUZA 2GFQA 4NXYA 2OH1A 4Y49B 1TKHA 3TX8A 2CNTA 4KVME 3I1UA 3NH4A 3EWOA 3BI1A 3S9MA 1UFHA 4TWEA 2QMLA 2YNCC 3SXOA 5C82A 3TO6A 3Q6ZA 1Q2YA 1X10A 1F2PA 3EC4A 4WWVA 4F8ZA 2B4DB 3CDXA 1I21A 1F57A 4WJBA 3V7ZA 3BXMA 3WC6A 1HDQA 2F7VA 5G20A 1BPMA 2J8RA 4C7IA 2AFSA 1XE4A 4NGNA 1MJAA 5D29A 4CAWA 2V8GA 4IUSA 1WK4A 4B14A 3IC1A 1R43A 3SHPA 4EMEA 4C68A 1XF8A 2ZEHA 3KASA 4U9YA 4OIWA 4OIDA 3SJXA 3FECA 1IY7A 5HVFA 2OOTA 3PB7X 4NCZA 3RBUA 1IYLA 3CXQA 4ABLA 1Y0YA 3GYAA 2BFRA 1TXRA 3R9FA 1SQHA 3S9LA 3H5ZA 2D4OA 4AVBA 3BJ7A 3KR5A 1XBUA 2Q7SA 3JZTA 2IMOA 8CPAA 2ZOGA 3KZWA 1IB1E 3IU2A 7CPAA 2FIAA 4UCMA 4XNHB 2CTBA 3FNCA 2ZOFA 4M85A 2WZNA 4NGPA 4UEEA 4ZX8A 2EO8A 2JEVA 3SI1A 3TTHA 2J8MA 4PPZA 4A2ZA 2ZPAA 2XD7A 3D8PA 1M4DA 2BFQA 3B3SA 2R98A 4M3SA 2PJ4A 4UIBA 3FEDA 1MK4A 4EFDA 3WC7A 2R1IA 2DXQA 4NGRA 4A95A 3FMCA 2Z3PA 2OZGA 1Z9UA 2PJ9A 4A94A 4A30A 3W6XA 4FBEA 5FSZA 4KOTA 4IAVA 2CY2A 4YWYA 2F5IA 3CZXA 3IIDA 2AFOA 5KTAA 2PJ2A 2X47A 4CAEA 2ZXVA 1M4IA 1P0HA 1S60A 4Z65A 1R3NA 4NFRA 1YX0A 4TNUA 4ZX9A 2KCWA 5AG5A 1YLOA 2PCUA 5IB9A 4ORFA 3PB8X 4YU9A 2WYRA 1RTQA 4A39A 3F8KA 4ZI6A 1HEEA 2ZELA 4FD6A 3RZAA 5LYDA 2J9AA 2V8HA 4FAIA 4XPDB 4M6GA 4J4ZA 3EW5A 2Q4YA 3BLNA 1IIDA 1IOIA 4CGPA 3IEHA 1QSTA 2ABZA 4TU0A 4HNWB 5G1ZA 1KZFA 5LYFA 1XIXA 2REEA 4R8FA 3T90A 2DF5A 2FL4A 2PRBA 1XJOA 3KR4A 1IYKA 3D2PA 3TCVA 5I4MA 1M44A 3DGVA 1ARMA 2I00A 5FVJA 4P4EA 3IIBA 3H4QA 3FYNA 2AJ6A 4O23A 2ZW5A 3TE4A 4FUUA 4R7MA 1FNOA 2PJ6A 4FD7A 5E96A 4DJLA 5K8MA 3QNVA 2R7HA 3SJFA 5THWA 2ARHA 3IGRA 4RN7A 3D68A 1M1DA 3SIGA 4AVAA 4UIAA 2V8DA 4PXBA 5FSUA 2NMTA 4RUHA 2BSWA 2FVGA 1TF8A 4BBHA 3FB3A 4ESSA 3BJ8A 1CG2A 2WPXA 4BMHA 4OC0A 2WPWA 2Z3OA 4CAFA 4JZ0A 5H86A 3SIIA 3LWUA 4M6HA 2BOAA 2XEGA 5I0CA 2HB6A 4KLVA 2RB7A 2X7BA 4KOXA 4MBUA 4P4JA 2XEJA 3H8FA 4AXVA 4GVWA 1Y9KA 2VQYA 4A37A 1NJRA 1QMUA 4FD4A 3FRMA 1Z2LA 1S3ZA 3UY5A 2YNCA 1LRZA 2H5MA 4ZY2A 2YGWA 3SJGA 5J1QA 5ISVA 5CPAA 4F9UA 5J8FA 4LQ6A 2WSAA 3QB8A 1M4GA 2GIVA 3R1KA 1EE3P 1YVKA 2PDOA 4X3RA 2JLMA 3D3SA 3GLJA 3DSBA 3CT9A 1PU9A 1J4JA 3EO4A 4EVYA 2G3TA 2JZEA 1ZG7A 4KZTA 1WWZA 4CRZB 4A33A 4NJRA 5A27A 5HOLA 3FJUA 5CB5A 1QSNA 2PJ1A 4IF5A 4HKFA 4UFVA 3VFQA 4B6ZA 6CPAA 1ZLIA 3V38A 2V8VA 2ZEFA 2PR8A 4KUAA 5F49A 4C2XA 4UFWA 3EWRA 3VWEA 2Q43A 1Y7EA 2L8RA 2OU2A 2A4NA 3IFEA 4P4DA 4ETKA 3Q71A 1X12A 3GB0A 5J8CA 3R95A 4NGQA 3VH9A 4MHPA 3RNZA 5JQ4A 5KTDA 1LOKA 2ANPA 3QAHA 1V0CA 4JXQA 4H6UA 2JZDA 4JCAA 3V45A 2PJBA 5ELYA 1XRYA 3B35A 1XFOA 2BUEA 1HJZA 2BO9A 1YMEA 3WR7A 4AG7A 4MFZA 5F09A 4MHDA 1VGYA 2QIRA 2Z3KA 3ISZA 1CPXA 4MY3A 2PR1A 4Q36A 5DWNA 3SI0A 4K3NA 2G9DA 5F46A 3EWQA 2P6EA 2DPSA 2FSRA 2I79A 4NSQA 2NYQA 5EBVA 1FT7A 2QJ8A 2Z10A 2Z3LA 3KHZA 4KLWA 4JGKA 4LX9A 3FVLA 2VBQA 3D66A 1ZR3A 1ELLP 1GHEA 1LFWA 1UWYA 2Z0ZA 4KVXA 4PK2A 3N7ZA 3FH4A 3JUWA 2FCKA 3K9UA 4Q38A 4IK2A 4Y49C 4QBJA 4AG9A 4E0AA 2Z3MA 1Z8WA 4AVCA 4KOYA 1ARLA 4CS0B 5IX3A 5CBMA 1YW6A 2C1CA 1U6MA 2EBJA 2GE3A 1NMTA 3GUXA 4MFKA 2HV2A 4XPLA 3E0KA 3OWCA 4R57A 3B3WA 4GVVA 3B2YA 3B3VA 4B5OA 1YVOA 3ETIA 2RC4A 3G3SA 5HVHA 1L0CA 2KQVA 2EUIA 1RXTA 2CF4A 4LUAA 3L2NA 4QVTA 2C6GA 1ON0A 4R87A 5HXDA 4L8AA 5IV0A 1NE9A 5JH9A 3NH8A 1YK3A 4CGOA 2PIYA 5BWAB 4A38A 3RAMA 4GS4A 3WABA 4JXRA 3PEIA 3PB4X 1YW4A 2B3UA 3MN8A 3IU1A 3CXSA 3IWEA 5HVGA 3T9YA 4YFJA 2OR4A 1H8LA 4GXHA 1I1DA 1VHSA 2IJZA 4R3LA 2ZEGA 3B3CA 2RFHA 3LODA 4H6ZA 1S7NA 4ZY0A 1BLLE 1R57A 2G0BA 1AMPA 4ONUA 3PZJA 1CX8A 4YRHA 1PUAA 2FT0A 3P2HA 2PC1A 4OC5A 4P10A 5DS0A 3GPGA 4F0YA 4MMOA 3H8GA 1F2OA 5LRKA 2AFWA 3DDDA 4W9YA 3TC8A 1BPNA 4B10A 1YREA 3KGQA 3WC5A 4J5QA 1LAMA 4Q7AA 3TOBA 4CYOA 2C6CA 3ISXA 3PP9A 3VATA 3DR6A 4HPSA 1BAVA 1KUXA 2W2GA 2NSMA 3LD2A 4ONWA 2ZEOA 3S6GA 4YGOA 3TO7A 3HUVA 1DE4C 4M6IA 4K30A 5JGFA 4B5PB 3NFZA 1PCAA 2PQ8A 2Q51A 2PIZA 2C27A 3TOAA 2AFZA 3A9LA 3MRUA 1SPVA 1VIXA 3PB6X 3RO0A 4F6AA 2AFUA 3NH5A 2YNEA 3EKEA 2P6GA 3IO1A 4MHYA 3JTKA 4MHNA 3EFAA 4OC1A 3TO9A 4J5SA 4OC4A 2V77A 2PJ5A 3GY9A 3ZZIA 4NF1A 3EXNA 2VL1A 2PJ7A 4RI1A 5G22A 2Q7BA 2P0WA 1XMBA 4OLLA 4B12A 4JD6A 5D8NA 4E2AA 1B6BA 4IQYA 3DNSA 4KOWA 4P4IA 1YSJA 4R3KA 3RYOA 4A31A 1XMTA 2JDCA 2GU2A 2ZEMA 1I12A 4ETJA 1HDUA 1XEBA 3F0AA 2PSWA 2OZUA
chains in the Genus database with same CATH topology
4ZYQA 5FSXA 4K0CA 4BD9A 3FX6A 2EK9A 4KYBA 4DYOA 2F8HA 1YD9A 2VRIA 5JM6A 2FXKA 3KQZA 3D7GA 3DLJA 5LRGA 2QVPA 4GM5A 2GREA 2LGRA 2AFMA 1AYEA 4OKOA 4H2KA 3GQOA 2EK8A 1CP7A 1LANA 4NGTA 5HIHA 4P45A 3D7FA 4OC3A 4PQAA 2FG1A 4UEZA 1NSAA 1Q7LA 3SJEA 2ZENA 4JVVA 3JRUA 1QQ9A 4P4FA 2IQ6A 4MCSA 5CB3A 5K8OA 3KQXA 2O53A 3IIFA 3GPQA 2QYVA 1GYTA 2HC9A 2PRQA 2PJ3A 4UMLA 2DX6A 1VHOA 1VHEA 4F9VA 4PXDA 3EJFA 3D4UA 4P4BA 4CPAA 1IGBA 3D7DA 3IWWA 4MRIA 3WT4A 3EWPA 2PJCA 4OMEA 3PFOA 3VARA 2C6PA 3GQEA 4IHMA 4OP4A 1TKJA 2ZEEA 4MCRA 2Q4ZA 4DUKA 3FEEA 4MCPA 2XEFA 2PJ0A 4PXEA 2PJ8A 1ELMP 1ZG8A 3PBBA 5AILA 3CPAA 3KHXA 4ABKA 4NJQA 4NGMA 4D86A 3H8EA 2PJAA 3B7IA 4GUAA 3LMSA 2EWBA 1TF9A 5FSYA 1Z8LA 4X2TA 5LYIA 4X8IA 4P6YA 4ZY1A 1TKFA 4EWTA 2I3CA 2JEWA 4OC2A 3HLPA 1LAPA 3EJGA 3S9NA 2JBJA 5E3BA 4KSIA 4JLLA 1VHUA 1Y0RA 1OBRA 1ZLHA 2DEAA 2JBKA 3IJ3A 3D7HA 3N5FA 2GLFA 3FF3A 3V2BA 1PYTB 4R76A 4MCQA 2O4HA 3KI9A 4UF4A 3K9TA 1TY8A 1TXZA 2PE3A 2CIJA 5CMSA 5LYLA 3NA6A 3GPOA 1CP6A 3SI2A 3PFEA 1LCPA 3PBEA 2AFCA 1ZG9A 2PVWA 4MHZA 2ZEDA 3KL9A 3SIJA 3PRTA 2GLJA 4G1PA 2POKA 1DTDA 1KWMA 4LQGA 4R6TA 4P44A 4J5RA 3D67A 5K8PA 4UEFA 3BHXA 1ZR5A 3BI0A 2ACFA 4FWUA 5FSVA 2ZEPA 3SIHA 2AFXA 4PXCA 2FAVA 5K8NA 3K2KA 1CBXA 2XEIA 1JQGA 3CPXA 1CPSA 2PVVA 4JYWA 3T8WA 3B3TA 1Z5RA 2BCOA 2CTCA 5DUSA 3PB9X 4MXUA 5LRJA 2EEEA 1M4LA 4NGSA 1TKHA 3TX8A 3I1UA 3NH4A 3EWOA 3BI1A 3S9MA 4TWEA 3Q6ZA 1F2PA 4WWVA 4F8ZA 3CDXA 4WJBA 1F57A 3V7ZA 3BXMA 3WC6A 1HDQA 2F7VA 1BPMA 2AFSA 4NGNA 5D29A 2V8GA 3IC1A 1R43A 4EMEA 2ZEHA 3KASA 4OIWA 4OIDA 3SJXA 3FECA 1IY7A 5HVFA 2OOTA 3PB7X 3RBUA 4ABLA 1Y0YA 2BFRA 1TXRA 3S9LA 3KR5A 1XBUA 3JZTA 2IMOA 8CPAA 2ZOGA 3KZWA 7CPAA 2CTBA 2ZOFA 2WZNA 4NGPA 4UEEA 4ZX8A 3SI1A 4PPZA 2XD7A 2BFQA 3B3SA 4UIBA 2PJ4A 3FEDA 4EFDA 3WC7A 4NGRA 3FMCA 2PJ9A 4A94A 4FBEA 5FSZA 4IAVA 4YWYA 3IIDA 2AFOA 2PJ2A 2X47A 4Z65A 1R3NA 4NFRA 4TNUA 4ZX9A 1YLOA 2PCUA 5IB9A 3PB8X 4YU9A 2WYRA 1RTQA 4A39A 4ZI6A 1HEEA 2ZELA 3RZAA 5LYDA 2J9AA 2V8HA 4FAIA 4J4ZA 3EW5A 3IEHA 2ABZA 4TU0A 5LYFA 4R8FA 1XJOA 3KR4A 5I4MA 3DGVA 1ARMA 4P4EA 3IIBA 4O23A 4FUUA 4R7MA 1FNOA 2PJ6A 4DJLA 5K8MA 3QNVA 3SJFA 5THWA 3D68A 3SIGA 4UIAA 2V8DA 4PXBA 5FSUA 4RUHA 2FVGA 1TF8A 4ESSA 1CG2A 4OC0A 4JZ0A 3SIIA 3LWUA 2BOAA 2HB6A 2RB7A 4P4JA 2XEJA 3H8FA 4AXVA 4GVWA 4A37A 1NJRA 1QMUA 1Z2LA 4ZY2A 3SJGA 5J1QA 5CPAA 4F9UA 4X3RA 1EE3P 3GLJA 3CT9A 1ZG7A 4NJRA 5HOLA 3FJUA 5CB5A 2PJ1A 3VFQA 4B6ZA 6CPAA 1ZLIA 3V38A 2V8VA 2ZEFA 3EWRA 2Q43A 1Y7EA 2L8RA 3IFEA 4P4DA 4ETKA 3Q71A 3GB0A 4NGQA 3VH9A 4MHPA 1LOKA 2ANPA 4JCAA 3V45A 2PJBA 5ELYA 1XRYA 3B35A 1XFOA 1HJZA 2BO9A 1YMEA 5F09A 1VGYA 3ISZA 1CPXA 3SI0A 4K3NA 2G9DA 3EWQA 2NYQA 1FT7A 2QJ8A 3KHZA 4JGKA 3FVLA 3D66A 1ZR3A 1ELLP 1LFWA 1UWYA 3FH4A 4IK2A 1ARLA 5CBMA 1YW6A 2C1CA 3GUXA 3B3WA 4GVVA 3B2YA 3B3VA 3ETIA 5HVHA 2CF4A 3L2NA 5HXDA 2C6GA 5JH9A 3NH8A 2PIYA 4A38A 3RAMA 3WABA 3PEIA 3PB4X 1YW4A 3MN8A 5HVGA 2OR4A 1H8LA 2IJZA 2ZEGA 3B3CA 2RFHA 4ZY0A 1BLLE 1AMPA 1CX8A 4P10A 5DS0A 4OC5A 3GPGA 4MMOA 3H8GA 1F2OA 5LRKA 2AFWA 4W9YA 3TC8A 1BPNA 3WC5A 3KGQA 4J5QA 1LAMA 4Q7AA 2C6CA 3ISXA 3VATA 4ONWA 1BAVA 2NSMA 2ZEOA 3HUVA 1DE4C 5JGFA 3NFZA 1PCAA 2Q51A 2PIZA 2AFZA 3MRUA 1SPVA 1VIXA 3PB6X 2AFUA 3NH5A 3EKEA 3IO1A 4MHYA 4MHNA 4OC1A 4J5SA 4OC4A 2V77A 2PJ5A 2VL1A 2PJ7A 1XMBA 5D8NA 4IQYA 4P4IA 1YSJA 2ZEMA 2GU2A 4ETJA 1HDUA 2XEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYQ A;  5FSX A;  4K0C A;  4BD9 A;  3FX6 A;  2EK9 A;  4KYB A;  4DYO A;  2F8H A;  1YD9 A;  2VRI A;  5JM6 A;  2FXK A;  3KQZ A;  3D7G A;  3DLJ A;  5LRG A;  2QVP A;  4GM5 A;  2GRE A;  2LGR A;  2AFM A;  1AYE A;  4OKO A;  4H2K A;  3GQO A;  2EK8 A;  1CP7 A;  1LAN A;  4NGT A;  5HIH A;  4P45 A;  3D7F A;  4OC3 A;  4PQA A;  2FG1 A;  4UEZ A;  1NSA A;  1Q7L A;  3SJE A;  2ZEN A;  4JVV A;  3JRU A;  1QQ9 A;  4P4F A;  2IQ6 A;  4MCS A;  5CB3 A;  5K8O A;  3KQX A;  2O53 A;  3IIF A;  3GPQ A;  2QYV A;  1GYT A;  2HC9 A;  2PRQ A;  2PJ3 A;  4UML A;  2DX6 A;  1VHO A;  1VHE A;  4F9V A;  4PXD A;  3EJF A;  3D4U A;  4P4B A;  4CPA A;  1IGB A;  3D7D A;  3IWW A;  4MRI A;  3WT4 A;  3EWP A;  2PJC A;  4OME A;  3PFO A;  3VAR A;  2C6P A;  3GQE A;  4IHM A;  4OP4 A;  1TKJ A;  2ZEE A;  4MCR A;  2Q4Z A;  4DUK A;  3FEE A;  4MCP A;  2XEF A;  2PJ0 A;  4PXE A;  2PJ8 A;  1ELM P;  1ZG8 A;  3PBB A;  5AIL A;  3CPA A;  3KHX A;  4ABK A;  4NJQ A;  4NGM A;  4D86 A;  3H8E A;  2PJA A;  3B7I A;  4GUA A;  3LMS A;  2EWB A;  1TF9 A;  5FSY A;  1Z8L A;  4X2T A;  5LYI A;  4X8I A;  4P6Y A;  4ZY1 A;  1TKF A;  4EWT A;  2I3C A;  2JEW A;  4OC2 A;  3HLP A;  1LAP A;  3EJG A;  3S9N A;  2JBJ A;  5E3B A;  4KSI A;  4JLL A;  1VHU A;  1Y0R A;  1OBR A;  1ZLH A;  2DEA A;  2JBK A;  3IJ3 A;  3D7H A;  3N5F A;  2GLF A;  3FF3 A;  3V2B A;  1PYT B;  4R76 A;  4MCQ A;  2O4H A;  3KI9 A;  4UF4 A;  3K9T A;  1TY8 A;  1TXZ A;  2PE3 A;  2CIJ A;  5CMS A;  5LYL A;  3NA6 A;  3GPO A;  1CP6 A;  3SI2 A;  3PFE A;  1LCP A;  3PBE A;  2AFC A;  1ZG9 A;  2PVW A;  4MHZ A;  2ZED A;  3KL9 A;  3SIJ A;  3PRT A;  2GLJ A;  4G1P A;  2POK A;  1DTD A;  1KWM A;  4LQG A;  4R6T A;  4P44 A;  4J5R A;  3D67 A;  5K8P A;  4UEF A;  3BHX A;  1ZR5 A;  3BI0 A;  2ACF A;  4FWU A;  5FSV A;  2ZEP A;  3SIH A;  2AFX A;  4PXC A;  2FAV A;  5K8N A;  3K2K A;  1CBX A;  2XEI A;  1JQG A;  3CPX A;  1CPS A;  2PVV A;  4JYW A;  3T8W A;  3B3T A;  1Z5R A;  2BCO A;  2CTC A;  5DUS A;  3PB9 X;  4MXU A;  5LRJ A;  2EEE A;  1M4L A;  4NGS A;  1TKH A;  3TX8 A;  3I1U A;  3NH4 A;  3EWO A;  3BI1 A;  3S9M A;  4TWE A;  3Q6Z A;  1F2P A;  4WWV A;  4F8Z A;  3CDX A;  4WJB A;  1F57 A;  3V7Z A;  3BXM A;  3WC6 A;  1HDQ A;  2F7V A;  1BPM A;  2AFS A;  4NGN A;  5D29 A;  2V8G A;  3IC1 A;  1R43 A;  4EME A;  2ZEH A;  3KAS A;  4OIW A;  4OID A;  3SJX A;  3FEC A;  1IY7 A;  5HVF A;  2OOT A;  3PB7 X;  3RBU A;  4ABL A;  1Y0Y A;  2BFR A;  1TXR A;  3S9L A;  3KR5 A;  1XBU A;  3JZT A;  2IMO A;  8CPA A;  2ZOG A;  3KZW A;  7CPA A;  2CTB A;  2ZOF A;  2WZN A;  4NGP A;  4UEE A;  4ZX8 A;  3SI1 A;  4PPZ A;  2XD7 A;  2BFQ A;  3B3S A;  4UIB A;  2PJ4 A;  3FED A;  4EFD A;  3WC7 A;  4NGR A;  3FMC A;  2PJ9 A;  4A94 A;  4FBE A;  5FSZ A;  4IAV A;  4YWY A;  3IID A;  2AFO A;  2PJ2 A;  2X47 A;  4Z65 A;  1R3N A;  4NFR A;  4TNU A;  4ZX9 A;  1YLO A;  2PCU A;  5IB9 A;  3PB8 X;  4YU9 A;  2WYR A;  1RTQ A;  4A39 A;  4ZI6 A;  1HEE A;  2ZEL A;  3RZA A;  5LYD A;  2J9A A;  2V8H A;  4FAI A;  4J4Z A;  3EW5 A;  3IEH A;  2ABZ A;  4TU0 A;  5LYF A;  4R8F A;  1XJO A;  3KR4 A;  5I4M A;  3DGV A;  1ARM A;  4P4E A;  3IIB A;  4O23 A;  4FUU A;  4R7M A;  1FNO A;  2PJ6 A;  4DJL A;  5K8M A;  3QNV A;  3SJF A;  5THW A;  3D68 A;  3SIG A;  4UIA A;  2V8D A;  4PXB A;  5FSU A;  4RUH A;  2FVG A;  1TF8 A;  4ESS A;  1CG2 A;  4OC0 A;  4JZ0 A;  3SII A;  3LWU A;  2BOA A;  2HB6 A;  2RB7 A;  4P4J A;  2XEJ A;  3H8F A;  4AXV A;  4GVW A;  4A37 A;  1NJR A;  1QMU A;  1Z2L A;  4ZY2 A;  3SJG A;  5J1Q A;  5CPA A;  4F9U A;  4X3R A;  1EE3 P;  3GLJ A;  3CT9 A;  1ZG7 A;  4NJR A;  5HOL A;  3FJU A;  5CB5 A;  2PJ1 A;  3VFQ A;  4B6Z A;  6CPA A;  1ZLI A;  3V38 A;  2V8V A;  2ZEF A;  3EWR A;  2Q43 A;  1Y7E A;  2L8R A;  3IFE A;  4P4D A;  4ETK A;  3Q71 A;  3GB0 A;  4NGQ A;  3VH9 A;  4MHP A;  1LOK A;  2ANP A;  4JCA A;  3V45 A;  2PJB A;  5ELY A;  1XRY A;  3B35 A;  1XFO A;  1HJZ A;  2BO9 A;  1YME A;  5F09 A;  1VGY A;  3ISZ A;  1CPX A;  3SI0 A;  4K3N A;  2G9D A;  3EWQ A;  2NYQ A;  1FT7 A;  2QJ8 A;  3KHZ A;  4JGK A;  3FVL A;  3D66 A;  1ZR3 A;  1ELL P;  1LFW A;  1UWY A;  3FH4 A;  4IK2 A;  1ARL A;  5CBM A;  1YW6 A;  2C1C A;  3GUX A;  3B3W A;  4GVV A;  3B2Y A;  3B3V A;  3ETI A;  5HVH A;  2CF4 A;  3L2N A;  5HXD A;  2C6G A;  5JH9 A;  3NH8 A;  2PIY A;  4A38 A;  3RAM A;  3WAB A;  3PEI A;  3PB4 X;  1YW4 A;  3MN8 A;  5HVG A;  2OR4 A;  1H8L A;  2IJZ A;  2ZEG A;  3B3C A;  2RFH A;  4ZY0 A;  1BLL E;  1AMP A;  1CX8 A;  4P10 A;  5DS0 A;  4OC5 A;  3GPG A;  4MMO A;  3H8G A;  1F2O A;  5LRK A;  2AFW A;  4W9Y A;  3TC8 A;  1BPN A;  3WC5 A;  3KGQ A;  4J5Q A;  1LAM A;  4Q7A A;  2C6C A;  3ISX A;  3VAT A;  4ONW A;  1BAV A;  2NSM A;  2ZEO A;  3HUV A;  1DE4 C;  5JGF A;  3NFZ A;  1PCA A;  2Q51 A;  2PIZ A;  2AFZ A;  3MRU A;  1SPV A;  1VIX A;  3PB6 X;  2AFU A;  3NH5 A;  3EKE A;  3IO1 A;  4MHY A;  4MHN A;  4OC1 A;  4J5S A;  4OC4 A;  2V77 A;  2PJ5 A;  2VL1 A;  2PJ7 A;  1XMB A;  5D8N A;  4IQY A;  4P4I A;  1YSJ A;  2ZEM A;  2GU2 A;  4ETJ A;  1HDU A;  2XEG A; 
#chains in the Genus database with same CATH topology
 4ZYQ A;  2HQY A;  4OAD A;  2EVN A;  5FSX A;  3IWG A;  4K0C A;  4JLY A;  4BD9 A;  1YGH A;  3FX6 A;  2DPT A;  3I3G A;  4XPK A;  1Y9W A;  2EK9 A;  1B87 A;  2AE6 A;  4KYB A;  1BOB A;  4DYO A;  5KTC A;  3FIX A;  4B5P A;  2F8H A;  1YD9 A;  2VRI A;  3D2M A;  5JM6 A;  2FXK A;  3KQZ A;  3D7G A;  3DLJ A;  1OZP A;  5LRG A;  4XPD C;  5CNP A;  2QVP A;  4GM5 A;  2GRE A;  2Y0M A;  2LGR A;  2VXK A;  2AFM A;  1AYE A;  3EY5 A;  4OKO A;  4H2K A;  3GQO A;  2EK8 A;  1CP7 A;  1LAN A;  4NGT A;  1MJB A;  5HIH A;  4P45 A;  3R96 A;  1Z8T A;  1JWQ A;  2FS5 A;  3D7F A;  4KVO E;  2B3V A;  4H89 A;  4OC3 A;  4PQA A;  2FG1 A;  4UEZ A;  1KUV A;  1NSA A;  1Q7L A;  3TFY A;  3SJE A;  1RO5 A;  2ZEN A;  2OB0 A;  3JRU A;  4JVV A;  1QQ9 A;  4P4F A;  2FIW A;  2IQ6 A;  4MCS A;  1ZO0 A;  3I9S A;  5AG7 A;  5H84 A;  5CB3 A;  5K8O A;  3KQX A;  2O53 A;  2Z3N A;  3IIF A;  3GPQ A;  4NEX A;  2QYV A;  1GYT A;  2HC9 A;  2VZZ A;  3QAY A;  4R9M A;  1Z4R A;  3TT2 A;  2PRQ A;  4JWP A;  4KSF A;  2PJ3 A;  4C2Z A;  4KOU A;  4UML A;  2DX6 A;  2ZW4 A;  1QSR A;  1VHO A;  1VHE A;  5EC4 A;  4CGL A;  4F9V A;  4PXD A;  3EJF A;  5GCN A;  1NSL A;  2ZW7 A;  3D4U A;  4P4B A;  1BO4 A;  2JZF A;  3C26 A;  5AG6 A;  1VKC A;  2B58 A;  4BIN A;  4CPA A;  1IGB A;  3D7D A;  1Y7R A;  3IWW A;  4FD5 A;  4KS9 A;  4MRI A;  4U5Y A;  3WT4 A;  4QUS A;  3EWP A;  1N71 A;  2PJC A;  4OME A;  3PFO A;  3VAR A;  2C6P A;  3GIU A;  2GAN A;  1KUY A;  3GQE A;  4UBR A;  4IHM A;  4OP4 A;  1TKJ A;  4F0X A;  3VWD A;  2ZEE A;  4MCR A;  2Q4Z A;  2O28 A;  4DUK A;  2CNS A;  3FEE A;  4MFQ A;  4MCP A;  2XEF A;  2PJ0 A;  4PXE A;  2PJ8 A;  1ELM P;  1ZG8 A;  1P4N A;  3PBB A;  5AIL A;  3CPA A;  3KHX A;  4B13 A;  4ABK A;  4L89 A;  4NJQ A;  2B4D A;  4CGM A;  4NGM A;  1IIC A;  5IB0 A;  1Q2C A;  4D86 A;  5HH1 A;  1A2Z A;  2R8V A;  3S6F A;  4HNX B;  3S6H A;  3W6S A;  1FY7 A;  3H8E A;  2PJA A;  5EMI A;  4CYQ A;  5F48 A;  2WUU A;  2QEC A;  4GUA A;  3B7I A;  3LMS A;  2EWB A;  3FBU A;  2CXA A;  4UCP A;  5AGE A;  4UWJ A;  2B5G B;  3JVN A;  2J8N A;  5DWM A;  1XOV A;  3LAC A;  4MFL A;  5F47 A;  1TF9 A;  1TIQ A;  5FSY A;  3PGP A;  4JJX A;  1Z8L A;  4CAX A;  4X2T A;  4UA3 A;  2Q04 A;  2FE7 A;  5LYI A;  2VZY A;  4P6Y A;  4X8I A;  4ZY1 A;  1TKF A;  4EWT A;  2I3C A;  2RNK A;  2BEI A;  1Z8X A;  1S7F A;  3MGD A;  1S7K A;  3GKR A;  2JEW A;  4OC2 A;  4CYN A;  3HLP A;  1LAP A;  1QSO A;  3W91 A;  3EJG A;  2JDD A;  3S9N A;  2JBJ A;  5E3B A;  4KSI A;  2D4P A;  4JLL A;  1CJW A;  4PSW A;  4KOV A;  1VHU A;  4MY0 A;  1Y0R A;  4U9Z A;  3S6K A;  1OBR A;  1ZLH A;  2DEA A;  2JBK A;  3IJ3 A;  3D7H A;  3N5F A;  4PSX A;  4UWI A;  4DNC A;  2GLF A;  2VEZ A;  4XNH C;  4CRY B;  4KOS A;  4E8O A;  4II9 A;  3FF3 A;  3V2B A;  5JPH A;  1PYT B;  2OZH A;  4R76 A;  4MCQ A;  2O4H A;  3KI9 A;  4UF4 A;  1AUG A;  2ZW6 A;  1TY8 A;  3K9T A;  1YQE A;  4ZBG A;  1TXZ A;  2Q44 A;  2PE3 A;  4J3G A;  3P2F A;  3NE8 A;  5AG4 A;  2B5G A;  2CIJ A;  3V8I A;  5CMS A;  4HNY B;  5LYL A;  3NA6 A;  3GPO A;  1S5K A;  1CP6 A;  3SI2 A;  3G8W A;  3PFE A;  2YND A;  3F5B A;  1LCP A;  3NE7 A;  3PBE A;  2AFC A;  1IOF A;  4AB7 A;  1ZG9 A;  2PVW A;  2Q4V A;  4RS2 A;  4MHZ A;  3R9G A;  3B8G A;  4QB9 A;  4ZGY B;  2ZED A;  3KL9 A;  3SIJ A;  3CXP A;  3PRT A;  2GLJ A;  4G1P A;  1MJ9 A;  4MFP A;  2POK A;  4MJ8 A;  4CYP A;  1DTD A;  3KKW A;  1K4J A;  1S7L A;  1KWM A;  2FXF A;  4LQG A;  4R6T A;  4P44 A;  4J5R A;  2K5T A;  3D67 A;  4MFJ A;  4OAE A;  4QC6 A;  4UEF A;  5K8P A;  3R9E A;  2P6F A;  3BHX A;  4I49 A;  4PK3 A;  2Q0Y A;  1ZR5 A;  4A32 A;  1Q2D A;  4CGN A;  5HMN A;  1YLE A;  3BI0 A;  2ACF A;  4FWU A;  5FSV A;  4KOR A;  4B11 A;  2ZEP A;  3SIH A;  4X5K A;  4KUB A;  5A28 A;  3FXT A;  2AFX A;  3SXN A;  4PXC A;  1QSM A;  2FAV A;  4UFX A;  5K8N A;  3K2K A;  1CBX A;  2G3A A;  2XEI A;  3ZJ0 A;  1JQG A;  3CPX A;  2Z11 A;  1Z4E A;  1CM0 A;  1CPS A;  4MI4 A;  5C88 A;  2PVV A;  4JYW A;  5G21 A;  3T8W A;  2VI7 A;  2ATR A;  1IU8 A;  3B3T A;  2B4B A;  1Z5R A;  2BCO A;  2CTC A;  4UCN A;  5DUS A;  3PB9 X;  4KSA A;  4MXU A;  4PV6 A;  2EEE A;  1YR0 A;  2WCT A;  1M4L A;  5LRJ A;  4CAV A;  4C7H A;  4NGS A;  2ODF A;  3DR8 A;  2CNM A;  2IL4 A;  4C2Y A;  2BL1 A;  2REF A;  2HUZ A;  2GFQ A;  4NXY A;  2OH1 A;  4Y49 B;  1TKH A;  3TX8 A;  2CNT A;  4KVM E;  3I1U A;  3NH4 A;  3EWO A;  3BI1 A;  3S9M A;  1UFH A;  4TWE A;  2QML A;  2YNC C;  3SXO A;  5C82 A;  3TO6 A;  3Q6Z A;  1Q2Y A;  1X10 A;  1F2P A;  3EC4 A;  4WWV A;  4F8Z A;  2B4D B;  3CDX A;  1I21 A;  1F57 A;  4WJB A;  3V7Z A;  3BXM A;  3WC6 A;  1HDQ A;  2F7V A;  5G20 A;  1BPM A;  2J8R A;  4C7I A;  2AFS A;  1XE4 A;  4NGN A;  1MJA A;  5D29 A;  4CAW A;  2V8G A;  4IUS A;  1WK4 A;  4B14 A;  3IC1 A;  1R43 A;  3SHP A;  4EME A;  4C68 A;  1XF8 A;  2ZEH A;  3KAS A;  4U9Y A;  4OIW A;  4OID A;  3SJX A;  3FEC A;  1IY7 A;  5HVF A;  2OOT A;  3PB7 X;  4NCZ A;  3RBU A;  1IYL A;  3CXQ A;  4ABL A;  1Y0Y A;  3GYA A;  2BFR A;  1TXR A;  3R9F A;  1SQH A;  3S9L A;  3H5Z A;  2D4O A;  4AVB A;  3BJ7 A;  3KR5 A;  1XBU A;  2Q7S A;  3JZT A;  2IMO A;  8CPA A;  2ZOG A;  3KZW A;  1IB1 E;  3IU2 A;  7CPA A;  2FIA A;  4UCM A;  4XNH B;  2CTB A;  3FNC A;  2ZOF A;  4M85 A;  2WZN A;  4NGP A;  4UEE A;  4ZX8 A;  2EO8 A;  2JEV A;  3SI1 A;  3TTH A;  2J8M A;  4PPZ A;  4A2Z A;  2ZPA A;  2XD7 A;  3D8P A;  1M4D A;  2BFQ A;  3B3S A;  2R98 A;  4M3S A;  2PJ4 A;  4UIB A;  3FED A;  1MK4 A;  4EFD A;  3WC7 A;  2R1I A;  2DXQ A;  4NGR A;  4A95 A;  3FMC A;  2Z3P A;  2OZG A;  1Z9U A;  2PJ9 A;  4A94 A;  4A30 A;  3W6X A;  4FBE A;  5FSZ A;  4KOT A;  4IAV A;  2CY2 A;  4YWY A;  2F5I A;  3CZX A;  3IID A;  2AFO A;  5KTA A;  2PJ2 A;  2X47 A;  4CAE A;  2ZXV A;  1M4I A;  1P0H A;  1S60 A;  4Z65 A;  1R3N A;  4NFR A;  1YX0 A;  4TNU A;  4ZX9 A;  2KCW A;  5AG5 A;  1YLO A;  2PCU A;  5IB9 A;  4ORF A;  3PB8 X;  4YU9 A;  2WYR A;  1RTQ A;  4A39 A;  3F8K A;  4ZI6 A;  1HEE A;  2ZEL A;  4FD6 A;  3RZA A;  5LYD A;  2J9A A;  2V8H A;  4FAI A;  4XPD B;  4M6G A;  4J4Z A;  3EW5 A;  2Q4Y A;  3BLN A;  1IID A;  1IOI A;  4CGP A;  3IEH A;  1QST A;  2ABZ A;  4TU0 A;  4HNW B;  5G1Z A;  1KZF A;  5LYF A;  1XIX A;  2REE A;  4R8F A;  3T90 A;  2DF5 A;  2FL4 A;  2PRB A;  1XJO A;  3KR4 A;  1IYK A;  3D2P A;  3TCV A;  5I4M A;  1M44 A;  3DGV A;  1ARM A;  2I00 A;  5FVJ A;  4P4E A;  3IIB A;  3H4Q A;  3FYN A;  2AJ6 A;  4O23 A;  2ZW5 A;  3TE4 A;  4FUU A;  4R7M A;  1FNO A;  2PJ6 A;  4FD7 A;  5E96 A;  4DJL A;  5K8M A;  3QNV A;  2R7H A;  3SJF A;  5THW A;  2ARH A;  3IGR A;  4RN7 A;  3D68 A;  1M1D A;  3SIG A;  4AVA A;  4UIA A;  2V8D A;  4PXB A;  5FSU A;  2NMT A;  4RUH A;  2BSW A;  2FVG A;  1TF8 A;  4BBH A;  3FB3 A;  4ESS A;  3BJ8 A;  1CG2 A;  2WPX A;  4BMH A;  4OC0 A;  2WPW A;  2Z3O A;  4CAF A;  4JZ0 A;  5H86 A;  3SII A;  3LWU A;  4M6H A;  2BOA A;  2XEG A;  5I0C A;  2HB6 A;  4KLV A;  2RB7 A;  2X7B A;  4KOX A;  4MBU A;  4P4J A;  2XEJ A;  3H8F A;  4AXV A;  4GVW A;  1Y9K A;  2VQY A;  4A37 A;  1NJR A;  1QMU A;  4FD4 A;  3FRM A;  1Z2L A;  1S3Z A;  3UY5 A;  2YNC A;  1LRZ A;  2H5M A;  4ZY2 A;  2YGW A;  3SJG A;  5J1Q A;  5ISV A;  5CPA A;  4F9U A;  5J8F A;  4LQ6 A;  2WSA A;  3QB8 A;  1M4G A;  2GIV A;  3R1K A;  1EE3 P;  1YVK A;  2PDO A;  4X3R A;  2JLM A;  3D3S A;  3GLJ A;  3DSB A;  3CT9 A;  1PU9 A;  1J4J A;  3EO4 A;  4EVY A;  2G3T A;  2JZE A;  1ZG7 A;  4KZT A;  1WWZ A;  4CRZ B;  4A33 A;  4NJR A;  5A27 A;  5HOL A;  3FJU A;  5CB5 A;  1QSN A;  2PJ1 A;  4IF5 A;  4HKF A;  4UFV A;  3VFQ A;  4B6Z A;  6CPA A;  1ZLI A;  3V38 A;  2V8V A;  2ZEF A;  2PR8 A;  4KUA A;  5F49 A;  4C2X A;  4UFW A;  3EWR A;  3VWE A;  2Q43 A;  1Y7E A;  2L8R A;  2OU2 A;  2A4N A;  3IFE A;  4P4D A;  4ETK A;  3Q71 A;  1X12 A;  3GB0 A;  5J8C A;  3R95 A;  4NGQ A;  3VH9 A;  4MHP A;  3RNZ A;  5JQ4 A;  5KTD A;  1LOK A;  2ANP A;  3QAH A;  1V0C A;  4JXQ A;  4H6U A;  2JZD A;  4JCA A;  3V45 A;  2PJB A;  5ELY A;  1XRY A;  3B35 A;  1XFO A;  2BUE A;  1HJZ A;  2BO9 A;  1YME A;  3WR7 A;  4AG7 A;  4MFZ A;  5F09 A;  4MHD A;  1VGY A;  2QIR A;  2Z3K A;  3ISZ A;  1CPX A;  4MY3 A;  2PR1 A;  4Q36 A;  5DWN A;  3SI0 A;  4K3N A;  2G9D A;  5F46 A;  3EWQ A;  2P6E A;  2DPS A;  2FSR A;  2I79 A;  4NSQ A;  2NYQ A;  5EBV A;  1FT7 A;  2QJ8 A;  2Z10 A;  2Z3L A;  3KHZ A;  4KLW A;  4JGK A;  4LX9 A;  3FVL A;  2VBQ A;  3D66 A;  1ZR3 A;  1ELL P;  1GHE A;  1LFW A;  1UWY A;  2Z0Z A;  4KVX A;  4PK2 A;  3N7Z A;  3FH4 A;  3JUW A;  2FCK A;  3K9U A;  4Q38 A;  4IK2 A;  4Y49 C;  4QBJ A;  4AG9 A;  4E0A A;  2Z3M A;  1Z8W A;  4AVC A;  4KOY A;  1ARL A;  4CS0 B;  5IX3 A;  5CBM A;  1YW6 A;  2C1C A;  1U6M A;  2EBJ A;  2GE3 A;  1NMT A;  3GUX A;  4MFK A;  2HV2 A;  4XPL A;  3E0K A;  3OWC A;  4R57 A;  3B3W A;  4GVV A;  3B2Y A;  3B3V A;  4B5O A;  1YVO A;  3ETI A;  2RC4 A;  3G3S A;  5HVH A;  1L0C A;  2KQV A;  2EUI A;  1RXT A;  2CF4 A;  4LUA A;  3L2N A;  4QVT A;  2C6G A;  1ON0 A;  4R87 A;  5HXD A;  4L8A A;  5IV0 A;  1NE9 A;  5JH9 A;  3NH8 A;  1YK3 A;  4CGO A;  2PIY A;  5BWA B;  4A38 A;  3RAM A;  4GS4 A;  3WAB A;  4JXR A;  3PEI A;  3PB4 X;  1YW4 A;  2B3U A;  3MN8 A;  3IU1 A;  3CXS A;  3IWE A;  5HVG A;  3T9Y A;  4YFJ A;  2OR4 A;  1H8L A;  4GXH A;  1I1D A;  1VHS A;  2IJZ A;  4R3L A;  2ZEG A;  3B3C A;  2RFH A;  3LOD A;  4H6Z A;  1S7N A;  4ZY0 A;  1BLL E;  1R57 A;  2G0B A;  1AMP A;  4ONU A;  3PZJ A;  1CX8 A;  4YRH A;  1PUA A;  2FT0 A;  3P2H A;  2PC1 A;  4OC5 A;  4P10 A;  5DS0 A;  3GPG A;  4F0Y A;  4MMO A;  3H8G A;  1F2O A;  5LRK A;  2AFW A;  3DDD A;  4W9Y A;  3TC8 A;  1BPN A;  4B10 A;  1YRE A;  3KGQ A;  3WC5 A;  4J5Q A;  1LAM A;  4Q7A A;  3TOB A;  4CYO A;  2C6C A;  3ISX A;  3PP9 A;  3VAT A;  3DR6 A;  4HPS A;  1BAV A;  1KUX A;  2W2G A;  2NSM A;  3LD2 A;  4ONW A;  2ZEO A;  3S6G A;  4YGO A;  3TO7 A;  3HUV A;  1DE4 C;  4M6I A;  4K30 A;  5JGF A;  4B5P B;  3NFZ A;  1PCA A;  2PQ8 A;  2Q51 A;  2PIZ A;  2C27 A;  3TOA A;  2AFZ A;  3A9L A;  3MRU A;  1SPV A;  1VIX A;  3PB6 X;  3RO0 A;  4F6A A;  2AFU A;  3NH5 A;  2YNE A;  3EKE A;  2P6G A;  3IO1 A;  4MHY A;  3JTK A;  4MHN A;  3EFA A;  4OC1 A;  3TO9 A;  4J5S A;  4OC4 A;  2V77 A;  2PJ5 A;  3GY9 A;  3ZZI A;  4NF1 A;  3EXN A;  2VL1 A;  2PJ7 A;  4RI1 A;  5G22 A;  2Q7B A;  2P0W A;  1XMB A;  4OLL A;  4B12 A;  4JD6 A;  5D8N A;  4E2A A;  1B6B A;  4IQY A;  3DNS A;  4KOW A;  4P4I A;  1YSJ A;  4R3K A;  3RYO A;  4A31 A;  1XMT A;  2JDC A;  2GU2 A;  2ZEM A;  1I12 A;  4ETJ A;  1HDU A;  1XEB A;  3F0A A;  2PSW A;  2OZU A; 
#chains in the Genus database with same CATH homology
 4ZYQ A;  5FSX A;  4K0C A;  4BD9 A;  3FX6 A;  2EK9 A;  4KYB A;  4DYO A;  2F8H A;  1YD9 A;  2VRI A;  5JM6 A;  2FXK A;  3KQZ A;  3D7G A;  3DLJ A;  5LRG A;  2QVP A;  4GM5 A;  2GRE A;  2LGR A;  2AFM A;  1AYE A;  4OKO A;  4H2K A;  3GQO A;  2EK8 A;  1CP7 A;  1LAN A;  4NGT A;  5HIH A;  4P45 A;  3D7F A;  4OC3 A;  4PQA A;  2FG1 A;  4UEZ A;  1NSA A;  1Q7L A;  3SJE A;  2ZEN A;  4JVV A;  3JRU A;  1QQ9 A;  4P4F A;  2IQ6 A;  4MCS A;  5CB3 A;  5K8O A;  3KQX A;  2O53 A;  3IIF A;  3GPQ A;  2QYV A;  1GYT A;  2HC9 A;  2PRQ A;  2PJ3 A;  4UML A;  2DX6 A;  1VHO A;  1VHE A;  4F9V A;  4PXD A;  3EJF A;  3D4U A;  4P4B A;  4CPA A;  1IGB A;  3D7D A;  3IWW A;  4MRI A;  3WT4 A;  3EWP A;  2PJC A;  4OME A;  3PFO A;  3VAR A;  2C6P A;  3GQE A;  4IHM A;  4OP4 A;  1TKJ A;  2ZEE A;  4MCR A;  2Q4Z A;  4DUK A;  3FEE A;  4MCP A;  2XEF A;  2PJ0 A;  4PXE A;  2PJ8 A;  1ELM P;  1ZG8 A;  3PBB A;  5AIL A;  3CPA A;  3KHX A;  4ABK A;  4NJQ A;  4NGM A;  4D86 A;  3H8E A;  2PJA A;  3B7I A;  4GUA A;  3LMS A;  2EWB A;  1TF9 A;  5FSY A;  1Z8L A;  4X2T A;  5LYI A;  4X8I A;  4P6Y A;  4ZY1 A;  1TKF A;  4EWT A;  2I3C A;  2JEW A;  4OC2 A;  3HLP A;  1LAP A;  3EJG A;  3S9N A;  2JBJ A;  5E3B A;  4KSI A;  4JLL A;  1VHU A;  1Y0R A;  1OBR A;  1ZLH A;  2DEA A;  2JBK A;  3IJ3 A;  3D7H A;  3N5F A;  2GLF A;  3FF3 A;  3V2B A;  1PYT B;  4R76 A;  4MCQ A;  2O4H A;  3KI9 A;  4UF4 A;  3K9T A;  1TY8 A;  1TXZ A;  2PE3 A;  2CIJ A;  5CMS A;  5LYL A;  3NA6 A;  3GPO A;  1CP6 A;  3SI2 A;  3PFE A;  1LCP A;  3PBE A;  2AFC A;  1ZG9 A;  2PVW A;  4MHZ A;  2ZED A;  3KL9 A;  3SIJ A;  3PRT A;  2GLJ A;  4G1P A;  2POK A;  1DTD A;  1KWM A;  4LQG A;  4R6T A;  4P44 A;  4J5R A;  3D67 A;  5K8P A;  4UEF A;  3BHX A;  1ZR5 A;  3BI0 A;  2ACF A;  4FWU A;  5FSV A;  2ZEP A;  3SIH A;  2AFX A;  4PXC A;  2FAV A;  5K8N A;  3K2K A;  1CBX A;  2XEI A;  1JQG A;  3CPX A;  1CPS A;  2PVV A;  4JYW A;  3T8W A;  3B3T A;  1Z5R A;  2BCO A;  2CTC A;  5DUS A;  3PB9 X;  4MXU A;  5LRJ A;  2EEE A;  1M4L A;  4NGS A;  1TKH A;  3TX8 A;  3I1U A;  3NH4 A;  3EWO A;  3BI1 A;  3S9M A;  4TWE A;  3Q6Z A;  1F2P A;  4WWV A;  4F8Z A;  3CDX A;  4WJB A;  1F57 A;  3V7Z A;  3BXM A;  3WC6 A;  1HDQ A;  2F7V A;  1BPM A;  2AFS A;  4NGN A;  5D29 A;  2V8G A;  3IC1 A;  1R43 A;  4EME A;  2ZEH A;  3KAS A;  4OIW A;  4OID A;  3SJX A;  3FEC A;  1IY7 A;  5HVF A;  2OOT A;  3PB7 X;  3RBU A;  4ABL A;  1Y0Y A;  2BFR A;  1TXR A;  3S9L A;  3KR5 A;  1XBU A;  3JZT A;  2IMO A;  8CPA A;  2ZOG A;  3KZW A;  7CPA A;  2CTB A;  2ZOF A;  2WZN A;  4NGP A;  4UEE A;  4ZX8 A;  3SI1 A;  4PPZ A;  2XD7 A;  2BFQ A;  3B3S A;  4UIB A;  2PJ4 A;  3FED A;  4EFD A;  3WC7 A;  4NGR A;  3FMC A;  2PJ9 A;  4A94 A;  4FBE A;  5FSZ A;  4IAV A;  4YWY A;  3IID A;  2AFO A;  2PJ2 A;  2X47 A;  4Z65 A;  1R3N A;  4NFR A;  4TNU A;  4ZX9 A;  1YLO A;  2PCU A;  5IB9 A;  3PB8 X;  4YU9 A;  2WYR A;  1RTQ A;  4A39 A;  4ZI6 A;  1HEE A;  2ZEL A;  3RZA A;  5LYD A;  2J9A A;  2V8H A;  4FAI A;  4J4Z A;  3EW5 A;  3IEH A;  2ABZ A;  4TU0 A;  5LYF A;  4R8F A;  1XJO A;  3KR4 A;  5I4M A;  3DGV A;  1ARM A;  4P4E A;  3IIB A;  4O23 A;  4FUU A;  4R7M A;  1FNO A;  2PJ6 A;  4DJL A;  5K8M A;  3QNV A;  3SJF A;  5THW A;  3D68 A;  3SIG A;  4UIA A;  2V8D A;  4PXB A;  5FSU A;  4RUH A;  2FVG A;  1TF8 A;  4ESS A;  1CG2 A;  4OC0 A;  4JZ0 A;  3SII A;  3LWU A;  2BOA A;  2HB6 A;  2RB7 A;  4P4J A;  2XEJ A;  3H8F A;  4AXV A;  4GVW A;  4A37 A;  1NJR A;  1QMU A;  1Z2L A;  4ZY2 A;  3SJG A;  5J1Q A;  5CPA A;  4F9U A;  4X3R A;  1EE3 P;  3GLJ A;  3CT9 A;  1ZG7 A;  4NJR A;  5HOL A;  3FJU A;  5CB5 A;  2PJ1 A;  3VFQ A;  4B6Z A;  6CPA A;  1ZLI A;  3V38 A;  2V8V A;  2ZEF A;  3EWR A;  2Q43 A;  1Y7E A;  2L8R A;  3IFE A;  4P4D A;  4ETK A;  3Q71 A;  3GB0 A;  4NGQ A;  3VH9 A;  4MHP A;  1LOK A;  2ANP A;  4JCA A;  3V45 A;  2PJB A;  5ELY A;  1XRY A;  3B35 A;  1XFO A;  1HJZ A;  2BO9 A;  1YME A;  5F09 A;  1VGY A;  3ISZ A;  1CPX A;  3SI0 A;  4K3N A;  2G9D A;  3EWQ A;  2NYQ A;  1FT7 A;  2QJ8 A;  3KHZ A;  4JGK A;  3FVL A;  3D66 A;  1ZR3 A;  1ELL P;  1LFW A;  1UWY A;  3FH4 A;  4IK2 A;  1ARL A;  5CBM A;  1YW6 A;  2C1C A;  3GUX A;  3B3W A;  4GVV A;  3B2Y A;  3B3V A;  3ETI A;  5HVH A;  2CF4 A;  3L2N A;  5HXD A;  2C6G A;  5JH9 A;  3NH8 A;  2PIY A;  4A38 A;  3RAM A;  3WAB A;  3PEI A;  3PB4 X;  1YW4 A;  3MN8 A;  5HVG A;  2OR4 A;  1H8L A;  2IJZ A;  2ZEG A;  3B3C A;  2RFH A;  4ZY0 A;  1BLL E;  1AMP A;  1CX8 A;  4P10 A;  5DS0 A;  4OC5 A;  3GPG A;  4MMO A;  3H8G A;  1F2O A;  5LRK A;  2AFW A;  4W9Y A;  3TC8 A;  1BPN A;  3WC5 A;  3KGQ A;  4J5Q A;  1LAM A;  4Q7A A;  2C6C A;  3ISX A;  3VAT A;  4ONW A;  1BAV A;  2NSM A;  2ZEO A;  3HUV A;  1DE4 C;  5JGF A;  3NFZ A;  1PCA A;  2Q51 A;  2PIZ A;  2AFZ A;  3MRU A;  1SPV A;  1VIX A;  3PB6 X;  2AFU A;  3NH5 A;  3EKE A;  3IO1 A;  4MHY A;  4MHN A;  4OC1 A;  4J5S A;  4OC4 A;  2V77 A;  2PJ5 A;  2VL1 A;  2PJ7 A;  1XMB A;  5D8N A;  4IQY A;  4P4I A;  1YSJ A;  2ZEM A;  2GU2 A;  4ETJ A;  1HDU A;  2XEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...