3H8GA

Bestatin complex structure of leucine aminopeptidase from pseudomonas putida
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
497
structure length
497
Chain Sequence
MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGKDEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALKKVTLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAVGQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLLACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYAERFKPQAVIDIATLTGACIVALGSHTTGLMGNNDDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISGGKDKGATGRPVPLLTQYLLDRAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosol aminopeptidase
publication title Crystal structure of the leucine aminopeptidase from Pseudomonas putida reveals the molecular basis for its enantioselectivity and broad substrate specificity.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 170
structure length 497
sequence length 497
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
A PF02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3h8gA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3h8gA02
4DJLA 4K0CA 4IHMA 5K8OA 3SIGA 2PCUA 4P4DA 2XEIA 4MXUA 2FXKA 4OKOA 1CPXA 3GQEA 4NGRA 3CPXA 3PBBA 1ELLP 1QMUA 3PB6X 3V2BA 4JCAA 1EE3P 4TNUA 2CTCA 2O53A 2PJ7A 4O23A 5ELYA 1BLLE 2ZEDA 4UEEA 1LOKA 2IJZA 2XEFA 2PJ6A 2ZEOA 1TF9A 3V7ZA 3SI1A 3PB8X 2FAVA 2IQ6A 4MRIA 2WYRA 4EMEA 3WABA 4NGNA 4ZX8A 4P4IA 1LCPA 4IAVA 4OIWA 3WC5A 4OC4A 1ARLA 1LAPA 4JGKA 3NFZA 4GUAA 2ACFA 2HB6A 3KR4A 3CDXA 2PJCA 4Z65A 4ONWA 4ETKA 3S9MA 4FWUA 1IGBA 3FMCA 1NJRA 2GLFA 4UMLA 4NGMA 2AFCA 2QJ8A 3QNVA 1TF8A 5I4MA 1M4LA 1TXRA 3NH5A 3PB4X 1ELMP 2GREA 1AYEA 3EJGA 1ZR3A 5FSXA 3SI2A 3IC1A 5THWA 4PPZA 1F2PA 2PJ4A 2GLJA 2C6CA 4IK2A 1OBRA 1YLOA 4OP4A 3K9TA 3H8GA 4J5SA 3WC6A 1Y0YA 5IB9A 2POKA 2ZEHA 3EWQA 3Q6ZA 4P4FA 4MCRA 4OC1A 4D86A 2ZELA 3I1UA 5JM6A 3KQZA 4P6YA 4JYWA 2F8HA 2PRQA 3KASA 5LRGA 3SJFA 4ABKA 3PFOA 4GM5A 3D7DA 2C1CA 3BHXA 2QYVA 2V8VA 3FH4A 4NJQA 3B2YA 6CPAA 1VIXA 2ABZA 2ZEPA 4AXVA 3TX8A 5K8PA 3Q71A 2ANPA 3FECA 3IWWA 4P44A 5K8NA 5FSVA 1CP7A 1YW4A 2QVPA 4J5QA 3B3WA 3IIFA 4H2KA 2PE3A 3EWOA 5AILA 3LWUA 1R43A 4OMEA 3SIHA 3D7GA 3H8EA 4R6TA 4KYBA 4ETJA 3RZAA 3JRUA 2PJ1A 1ARMA 8CPAA 4YWYA 2NYQA 3IIDA 4ESSA 2PJ3A 4NGSA 3KGQA 2ZEMA 3GPGA 4MHPA 3KL9A 2PJ9A 1F57A 2EWBA 2RB7A 2XEJA 3SJGA 2PIYA 3BI1A 1GYTA 3EKEA 3KHXA 1XBUA 3SIIA 4KSIA 3WC7A 2PJ5A 5JH9A 2V8HA 4X3RA 4NGTA 3B3SA 2Q4ZA 5D29A 4F8ZA 3NA6A 2ZEEA 4UEZA 3TC8A 5HVGA 4J4ZA 4JLLA 1YMEA 3B3TA 3NH4A 2PJ0A 4OC3A 3RAMA 3D68A 1BPNA 4IQYA 4TWEA 4TU0A 4GVVA 4B6ZA 2XD7A 5CBMA 4OIDA 1NSAA 1BAVA 1Z8LA 3GQOA 5HVHA 2DEAA 2EK8A 3NH8A 4OC2A 3BI0A 2ZOGA 4GVWA 4R76A 1TKHA 3IEHA 3PB9X 2Q43A 5LYLA 4JVVA 1YW6A 4A37A 5CB3A 3CPAA 5FSYA 4P4EA 4CPAA 4WWVA 1CBXA 4A39A 4R8FA 3SJXA 5LYIA 4MHNA 2L8RA 4ABLA 1QQ9A 2AFMA 1Y0RA 1HEEA 3B3CA 3VH9A 2EK9A 3N5FA 4NGPA 5LRKA 2WZNA 3ETIA 4ZX9A 4W9YA 4MMOA 3D67A 1HDQA 4UF4A 4EWTA 3V38A 4PQAA 3SIJA 1H8LA 4DYOA 2PJ8A 1HDUA 3B7IA 3V45A 2BFRA 2NSMA 1CG2A 5HVFA 1YD9A 4ZY2A 1ZG7A 2V8GA 4F9VA 3VATA 2VRIA 5HOLA 1KWMA 2OOTA 3VARA 4F9UA 4MCPA 1XFOA 3LMSA 1AMPA 1CX8A 1ZR5A 1UWYA 4ZY0A 2JBJA 2PVVA 3IJ3A 4NGQA 3KHZA 1TXZA 3S9LA 5LYDA 2AFOA 2ZENA 4MCSA 4PXBA 2BFQA 3PFEA 3MRUA 4FBEA 4OC5A 3HUVA 4X8IA 3EWRA 3IIBA 4NJRA 2JEWA 4DUKA 2BOAA 5LRJA 4BD9A 1Y7EA 2O4HA 2PJ2A 2DX6A 4A38A 7CPAA 5F09A 2AFZA 2LGRA 2JBKA 4A94A 2AFWA 4ZY1A 2F7VA 4P10A 4P45A 3GPQA 3JZTA 3FX6A 3D7HA 2ZOFA 2V8DA 1VHUA 1FNOA 2RFHA 3DGVA 3EJFA 4EFDA 4ZYQA 4ZI6A 4Q7AA 5HXDA 1SPVA 4G1PA 1F2OA 4NFRA 4J5RA 2CIJA 3S9NA 2V77A 4K3NA 4R7MA 3IFEA 2CF4A 5J1QA 2HC9A 3FF3A 3KR5A 1TKJA 1CPSA 3ISZA 2EEEA 1RTQA 1YSJA 1R3NA 3SI0A 5CPAA 3VFQA 3GLJA 1LAMA 4P4JA 3EWPA 4FUUA 4LQGA 2ZEFA 2PJBA 3B35A 1FT7A 3FEEA 4MCQA 2GU2A 3KQXA 3H8FA 3DLJA 2C6GA 4JZ0A 3HLPA 1LANA 4PXEA 5HIHA 3D4UA 2OR4A 1PYTB 4WJBA 4FAIA 2XEGA 3PRTA 2PVWA 5DUSA 2AFUA 3K2KA 3BXMA 1DTDA 3T8WA 1JQGA 3IO1A 1XJOA 1DE4C 2Q51A 1XRYA 2J9AA 3GPOA 3KI9A 3GUXA 3D66A 2IMOA 4RUHA 1Q7LA 3RBUA 1HJZA 5D8NA 5FSZA 1IY7A 1VHEA 2X47A 4X2TA 1LFWA 4UEFA 1VGYA 2PIZA 1XMBA 1ZG8A 4YU9A 3FJUA 1TY8A 1PCAA 3PBEA 2PJAA 3SJEA 2FVGA 5LYFA 2AFXA 1Z2LA 2BCOA 5K8MA 2ZEGA 3CT9A 1TKFA 1ZLHA 3B3VA 4PXDA 4UIBA 3PB7X 3D7FA 2AFSA 1Z5RA 1ZG9A 3FEDA 4UIAA 5JGFA 2CTBA 5FSUA 5E3BA 4P4BA 3KZWA 4MHYA 3FVLA 1BPMA 5CB5A 3WT4A 3PEIA 4PXCA 5DS0A 5CMSA 2BO9A 4OC0A 4MHZA 2FG1A 2G9DA 3GB0A 3ISXA 1CP6A 3MN8A 3L2NA 2VL1A 2C6PA 2I3CA 3EW5A 1ZLIA 1VHOA
chains in the Genus database with same CATH superfamily
1YQEA 3DR6A 4KSFA 4K0CA 4IHMA 4UCNA 4DJLA 5K8OA 3SIGA 2PCUA 2FCKA 1S7NA 2XEIA 4P4DA 3VWDA 1A2ZA 2B3UA 2FXKA 4MXUA 4M85A 4BMHA 4L89A 4OKOA 3JTKA 4CGNA 2AE6A 1CPXA 4M6IA 3GQEA 4NGRA 3CPXA 3PBBA 1ELLP 4H89A 2CXAA 3BLNA 1QMUA 4YGOA 2VZYA 2VBQA 3PB6X 3PZJA 3V2BA 4JCAA 3TTHA 1EE3P 4B14A 4TNUA 1NMTA 2CTCA 2O53A 4A2ZA 2PJ7A 3TO7A 1BOBA 4O23A 5ELYA 2Z11A 1BLLE 3SXOA 1U6MA 2ZEDA 4UEEA 1M4GA 4FD5A 1LOKA 2IJZA 4JD6A 4NSQA 1N71A 2XEFA 4XPDC 2PJ6A 2VXKA 2ZEOA 3FYNA 1TF9A 4AVBA 4IF5A 4CGPA 3V7ZA 2B4DB 3VWEA 3SI1A 3PB8X 4Q38A 2FAVA 1Y9KA 4MFKA 2GE3A 5EC4A 4CRZB 2IQ6A 4MRIA 2P6EA 2WYRA 4L8AA 4EMEA 3I9SA 2HQYA 3WABA 4NGNA 4ZX8A 2Z3NA 4P4IA 4C2XA 1S7FA 1LCPA 3P2HA 3IGRA 4IAVA 4OIWA 5GCNA 3WC5A 5JPHA 1YVKA 1S60A 2JDCA 4OC4A 1ARLA 5I0CA 1LAPA 4JGKA 3NFZA 2REEA 4GUAA 4JLYA 2ACFA 2HB6A 3KR4A 3F0AA 3CDXA 2PJCA 4AVAA 4Z65A 2Y0MA 4ONWA 1IOIA 1ON0A 4ETKA 3S9MA 4FWUA 1IGBA 1Z8TA 2WSAA 3NE7A 3FMCA 4EVYA 4R57A 1NJRA 2GLFA 1XOVA 4UMLA 4NGMA 1Y7RA 3QAYA 2AFCA 2QJ8A 3JUWA 1XF8A 2GANA 1TF8A 3QNVA 4UCMA 4CAEA 4MFLA 3T90A 5I4MA 1M4LA 4PK2A 4R87A 3D8PA 1TXRA 1JWQA 3W6SA 4CAWA 3NH5A 3PB4X 1ELMP 4MI4A 2GREA 1AYEA 3EJGA 5AG5A 1ZR3A 2D4OA 5FSXA 3SI2A 3IC1A 5THWA 4PPZA 4DNCA 1F2PA 2PJ4A 2GLJA 2YNCA 2C6CA 2JDDA 1OBRA 1YLOA 3LACA 3NE8A 4IK2A 4OP4A 3R9FA 2KQVA 4CS0B 2VQYA 5F49A 2B5GA 1B87A 3K9TA 3H8GA 5G20A 4J5SA 3GIUA 4B5PA 3WC6A 1Y0YA 1VHSA 2Q0YA 4C2YA 5IB9A 1PUAA 2POKA 4R3LA 4Y49C 2ZEHA 5HMNA 2J8RA 3EWQA 4KVME 1SQHA 4OADA 2VZZA 3Q6ZA 4OLLA 4P4FA 5KTDA 4MCRA 4OC1A 3W91A 4D86A 2ZELA 3BJ7A 3I1UA 4XPDB 3TFYA 5JM6A 3KQZA 4HPSA 4P6YA 1J4JA 2OZGA 2F8HA 2PRQA 4JYWA 4MBUA 2REFA 3R9GA 2P6FA 3KASA 3TOAA 4CAXA 5LRGA 1IYKA 3SJFA 1S7KA 4ABKA 4UFWA 4CAFA 4UCPA 3PFOA 4GM5A 2BL1A 2WUUA 3D7DA 4CGLA 2C1CA 5AGEA 4II9A 3QB8A 3BHXA 4KUAA 2QYVA 2V8VA 3FH4A 4NJQA 3B2YA 3ZZIA 4MY0A 3MGDA 1MK4A 1VIXA 2ABZA 2FS5A 4A95A 6CPAA 2RNKA 2ZEPA 4A32A 3TE4A 4AXVA 3TX8A 4AG9A 5K8PA 3Q71A 2BSWA 1B6BA 2EUIA 2YNCC 3LD2A 5G22A 4E2AA 1M44A 2ANPA 3D2MA 3FECA 4QB9A 2G0BA 3IU1A 4XNHB 4OAEA 3IWWA 4P44A 5K8NA 2Z3PA 5FSVA 1R57A 1CP7A 1YW4A 1YVOA 3CXPA 1KUXA 2QVPA 4KOUA 4J5QA 3B3WA 3IIFA 1YK3A 2Z3MA 4H2KA 2PE3A 4FD4A 4H6ZA 5H86A 2R7HA 3EWOA 5AILA 2CNSA 2JZFA 1QSNA 3LWUA 4AVCA 1R43A 1MJAA 3SIHA 3D7GA 4OMEA 4CGOA 1KZFA 3H8EA 4R6TA 4KYBA 3CXSA 3P2FA 4ETJA 3N7ZA 3RZAA 3JRUA 2PJ1A 4KS9A 2CNTA 4U9YA 2JZEA 5J8FA 1ARMA 2FL4A 8CPAA 4YWYA 3GY9A 1Z9UA 2NYQA 3FNCA 3IIDA 4JXRA 4ESSA 4JXQA 4A30A 2PJ3A 4NGSA 1NE9A 3KGQA 2YNDA 2ZEMA 3GPGA 4MHPA 3KL9A 2PJ9A 1F57A 1IU8A 1KUVA 2Z3KA 2EWBA 2EBJA 2RB7A 2XEJA 4Y49B 2PIYA 3SJGA 2FXFA 2Q4VA 1GYTA 3BI1A 3EXNA 4ZGYB 3K9UA 3EKEA 4KVXA 3KHXA 4MFQA 1V0CA 3TOBA 1XBUA 2BUEA 3SIIA 4FD6A 2CNMA 5IX3A 4KSIA 5KTAA 4U9ZA 3WC7A 2WPXA 2PJ5A 5JH9A 2V8HA 4X3RA 4NGTA 3B3SA 1KUYA 2Q4ZA 5D29A 4F8ZA 3NA6A 2QECA 1YR0A 2ZEEA 1S3ZA 4UFXA 4UEZA 5H84A 2ZW4A 3TC8A 3EC4A 2Q04A 5HVGA 4J4ZA 4JLLA 1YMEA 2DF5A 3B3TA 2PJ0A 3NH4A 4KOVA 4OC3A 3RAMA 5IB0A 2QIRA 4UWIA 3D68A 1BPNA 4IQYA 5JQ4A 4TWEA 4TU0A 3H5ZA 4GVVA 4HNXB 4B6ZA 2XD7A 2B58A 4KORA 5CBMA 4OIDA 4C2ZA 1NSAA 1XIXA 2F5IA 1BAVA 1Z8LA 3GQOA 5HVHA 2DEAA 3IWEA 2EK8A 2Z10A 2ZPAA 1RXTA 3NH8A 3BI0A 4KOYA 2ZOGA 4OC2A 2VI7A 4GVWA 4AG7A 5F46A 4NXYA 1QSOA 2FT0A 4NEXA 4KUBA 4MJ8A 4R76A 1NSLA 4J3GA 1TKHA 1Q2DA 3IEHA 3PB9X 2C27A 2Q43A 4BBHA 2DPTA 3KKWA 5LYLA 4JVVA 1YW6A 2RC4A 3FIXA 4H6UA 4A37A 5CB3A 3CPAA 5FSYA 4P4EA 1OZPA 4CPAA 4QUSA 1CBXA 4WWVA 4A39A 2ZW7A 1M4IA 2PR8A 4LUAA 3BJ8A 4R8FA 3SJXA 5LYIA 4CYQA 1M4DA 2K5TA 5IV0A 1Z4EA 3TO6A 4R9MA 3S6KA 3C26A 1QSMA 2B4DA 2L8RA 4MHNA 1ZO0A 4E0AA 4CYOA 1MJ9A 4ABLA 5AG7A 1QQ9A 2AFMA 1Y0RA 2OZHA 1HEEA 2Z3OA 5CNPA 3B3CA 5F48A 2JZDA 1LRZA 3VH9A 4QVTA 5AG6A 4PK3A 2EK9A 3N5FA 4NGPA 4U5YA 4C7IA 4PV6A 5LRKA 1I21A 2WZNA 1IOFA 3ETIA 4GS4A 4ZX9A 1IIDA 2OU2A 4W9YA 1IICA 4MMOA 2EVNA 3D67A 2O28A 1HDQA 4UF4A 3SHPA 4EWTA 3PP9A 2YNEA 3V38A 2D4PA 4KOSA 3CZXA 5AG4A 4GXHA 4PQAA 3SIJA 1H8LA 3R96A 4DYOA 2PJ8A 1HDUA 2R1IA 4B10A 1IYLA 4UA3A 3EO4A 4F0YA 3B7IA 3V45A 5G21A 3JVNA 1FY7A 2BFRA 2GIVA 2NSMA 2H5MA 1XEBA 3FXTA 1CG2A 2PC1A 4KOWA 5HVFA 4UWJA 4LX9A 1YD9A 5EBVA 4ZY2A 1Z8XA 4BINA 1ZG7A 2V8GA 4F9VA 2I79A 2WPWA 3VATA 2VRIA 5HOLA 1KWMA 2G3TA 4FD7A 3G8WA 2X7BA 2KCWA 2OOTA 3VARA 4F9UA 4MCPA 1XFOA 1X12A 3LMSA 1AMPA 1CX8A 2BEIA 1ZR5A 1UWYA 2Q7SA 4ZY0A 3S6FA 2JBJA 4I49A 2PVVA 3TT2A 3IJ3A 4NGQA 2Q44A 3KHZA 1TXZA 4E8OA 3S9LA 5LYDA 4B12A 2AFOA 2ZENA 3OWCA 1YGHA 2I00A 4MCSA 4NF1A 2HUZA 4PXBA 2BFQA 1CJWA 4NCZA 1WK4A 2ARHA 3PFEA 2GFQA 3MRUA 4FBEA 5C82A 4OC5A 3HUVA 4X8IA 3EWRA 4MFZA 2P0WA 4KLWA 2ODFA 4UFVA 4M6HA 3ZJ0A 4KZTA 3IIBA 4NJRA 2JEWA 2OH1A 4DUKA 2JLMA 2BOAA 5LRJA 2PSWA 4X5KA 4BD9A 1Y7EA 2O4HA 2PJ2A 2DX6A 4B11A 4A38A 7CPAA 5F47A 4MY3A 5A28A 4CYNA 4B13A 5F09A 2AFZA 2LGRA 3IWGA 4KOXA 2JBKA 4A94A 4CGMA 2AFWA 4ZY1A 2HV2A 5G1ZA 2F7VA 4P10A 4LQ6A 4P45A 4AB7A 3GPQA 3WR7A 3JZTA 3FX6A 4A31A 5DWNA 2W2GA 1TIQA 2PQ8A 3E0KA 3D7HA 2ZOFA 2V8DA 3DNSA 3RNZA 3EY5A 1VHUA 1FNOA 1IB1E 2RFHA 3DGVA 3EJFA 4EFDA 4ZYQA 2OB0A 4ZI6A 1PU9A 2B4BA 3I3GA 4Q7AA 5HXDA 1SPVA 4G1PA 1F2OA 2VEZA 1P0HA 4F6AA 4NFRA 4J5RA 3SXNA 4CRYB 1S5KA 3FB3A 1MJBA 1I12A 2CIJA 3S9NA 2FIAA 2V77A 4K3NA 1L0CA 5E96A 4R7MA 3IFEA 2CF4A 2A4NA 2YGWA 5J1QA 2HC9A 3TO9A 2ZW6A 2AJ6A 3FF3A 2R8VA 3KR5A 1TKJA 5BWAB 1CPSA 2B5GB 3ISZA 2EEEA 1RTQA 3PGPA 1YSJA 5ISVA 4B5PB 2Q4YA 1R3NA 4PSWA 3SI0A 2FSRA 3CXQA 5CPAA 3DR8A 3VFQA 1GHEA 4IUSA 4XPKA 1WWZA 4ONUA 3GLJA 3QAHA 4M6GA 1LAMA 4K30A 4XPLA 2Z3LA 2ZW5A 3EWPA 4P4JA 4FUUA 4LQGA 3GKRA 2ZEFA 2PJBA 5EMIA 3TCVA 3B35A 1FT7A 3FEEA 2DXQA 2FIWA 3D3SA 1QSRA 4MCQA 4UBRA 2GU2A 3KQXA 3H8FA 1QSTA 3DLJA 2C6GA 4JZ0A 1VKCA 2QMLA 3DDDA 4YRHA 3HLPA 4RN7A 4XNHC 4JWPA 4A33A 1LANA 4PXEA 5HIHA 4HKFA 3IU2A 4YFJA 1M1DA 3FBUA 3LODA 3DSBA 3D4UA 2OR4A 2Q7BA 1Q2YA 2P6GA 3T9YA 1XE4A 1PYTB 4WJBA 4FAIA 2NMTA 2PRBA 1P4NA 2ZXVA 4KSAA 2WCTA 2XEGA 3PRTA 2PVWA 5DUSA 2AFUA 3K2KA 3BXMA 1DTDA 3RYOA 3T8WA 1JQGA 2PDOA 4KVOE 2DPSA 4Q36A 3W6XA 3IO1A 2B3VA 3H4QA 2J8NA 4MFPA 1XJOA 1AUGA 1DE4C 4KLVA 1YX0A 2PR1A 2Q51A 1XRYA 3FRMA 4RI1A 5FVJA 2J9AA 1UFHA 4HNWB 4R3KA 1K4JA 2R98A 4JJXA 2EO8A 4MHDA 2JEVA 3GPOA 3KI9A 2CY2A 3GUXA 3D66A 1S7LA 4F0XA 2IMOA 4RUHA 1Q7LA 5C88A 5DWMA 3A9LA 4ZBGA 1RO5A 3S6HA 4ORFA 3RBUA 1HJZA 3R95A 5D8NA 5FSZA 1IY7A 1VHEA 2IL4A 2X47A 4X2TA 1LFWA 4M3SA 1VGYA 2PIZA 1XMBA 1ZG8A 4UEFA 3G3SA 4QC6A 4YU9A 3RO0A 3FJUA 1TY8A 3GYAA 3F5BA 1PCAA 1Z8WA 2PJAA 3PBEA 2FVGA 3R1KA 4KOTA 3SJEA 1X10A 2OZUA 5LYFA 2AFXA 2Z0ZA 1Z2LA 2BCOA 3V8IA 3B8GA 4B5OA 5K8MA 5J8CA 2ZEGA 2J8MA 3CT9A 1TKFA 1ZLHA 3F8KA 3B3VA 2G3AA 4PXDA 4C68A 4UIBA 3PB7X 3D7FA 2AFSA 1YLEA 4C7HA 1Z5RA 1ZG9A 4HNYB 3FEDA 4UIAA 5JGFA 1I1DA 2CTBA 1Q2CA 3D2PA 5FSUA 5E3BA 4P4BA 3KZWA 3EFAA 1XMTA 4MHYA 3FVLA 1BPMA 5CB5A 2FE7A 3WT4A 3PEIA 4PXCA 5DS0A 5CMSA 1Y9WA 2BO9A 3UY5A 3S6GA 4OC0A 5A27A 1Z4RA 4MHZA 4PSXA 4RS2A 2FG1A 3R9EA 2G9DA 3GB0A 3ISXA 5HH1A 4CAVA 4QBJA 1CP6A 3MN8A 5KTCA 4MFJA 3L2NA 2VL1A 2C6PA 2I3CA 3EW5A 4CYPA 2ATRA 1ZLIA 1VHOA 1CM0A 1YREA 1BO4A
chains in the Genus database with same CATH topology
4DJLA 4K0CA 4IHMA 5K8OA 3SIGA 2PCUA 4P4DA 2XEIA 4MXUA 2FXKA 4OKOA 1CPXA 3GQEA 4NGRA 3CPXA 3PBBA 1ELLP 1QMUA 3PB6X 3V2BA 4JCAA 1EE3P 4TNUA 2CTCA 2O53A 2PJ7A 4O23A 5ELYA 1BLLE 2ZEDA 4UEEA 1LOKA 2IJZA 2XEFA 2PJ6A 2ZEOA 1TF9A 3V7ZA 3SI1A 3PB8X 2FAVA 2IQ6A 4MRIA 2WYRA 4EMEA 3WABA 4NGNA 4ZX8A 4P4IA 1LCPA 4IAVA 4OIWA 3WC5A 4OC4A 1ARLA 1LAPA 4JGKA 3NFZA 4GUAA 2ACFA 2HB6A 3KR4A 3CDXA 2PJCA 4Z65A 4ONWA 4ETKA 3S9MA 4FWUA 1IGBA 3FMCA 1NJRA 2GLFA 4UMLA 4NGMA 2AFCA 2QJ8A 3QNVA 1TF8A 5I4MA 1M4LA 1TXRA 3NH5A 3PB4X 1ELMP 2GREA 1AYEA 3EJGA 1ZR3A 5FSXA 3SI2A 3IC1A 5THWA 4PPZA 1F2PA 2PJ4A 2GLJA 2C6CA 4IK2A 1OBRA 1YLOA 4OP4A 3K9TA 3H8GA 4J5SA 3WC6A 1Y0YA 5IB9A 2POKA 2ZEHA 3EWQA 3Q6ZA 4P4FA 4MCRA 4OC1A 4D86A 2ZELA 3I1UA 5JM6A 3KQZA 4P6YA 4JYWA 2F8HA 2PRQA 3KASA 5LRGA 3SJFA 4ABKA 3PFOA 4GM5A 3D7DA 2C1CA 3BHXA 2QYVA 2V8VA 3FH4A 4NJQA 3B2YA 6CPAA 1VIXA 2ABZA 2ZEPA 4AXVA 3TX8A 5K8PA 3Q71A 2ANPA 3FECA 3IWWA 4P44A 5K8NA 5FSVA 1CP7A 1YW4A 2QVPA 4J5QA 3B3WA 3IIFA 4H2KA 2PE3A 3EWOA 5AILA 3LWUA 1R43A 4OMEA 3SIHA 3D7GA 3H8EA 4R6TA 4KYBA 4ETJA 3RZAA 3JRUA 2PJ1A 1ARMA 8CPAA 4YWYA 2NYQA 3IIDA 4ESSA 2PJ3A 4NGSA 3KGQA 2ZEMA 3GPGA 4MHPA 3KL9A 2PJ9A 1F57A 2EWBA 2RB7A 2XEJA 3SJGA 2PIYA 3BI1A 1GYTA 3EKEA 3KHXA 1XBUA 3SIIA 4KSIA 3WC7A 2PJ5A 5JH9A 2V8HA 4X3RA 4NGTA 3B3SA 2Q4ZA 5D29A 4F8ZA 3NA6A 2ZEEA 4UEZA 3TC8A 5HVGA 4J4ZA 4JLLA 1YMEA 3B3TA 3NH4A 2PJ0A 4OC3A 3RAMA 3D68A 1BPNA 4IQYA 4TWEA 4TU0A 4GVVA 4B6ZA 2XD7A 5CBMA 4OIDA 1NSAA 1BAVA 1Z8LA 3GQOA 5HVHA 2DEAA 2EK8A 3NH8A 4OC2A 3BI0A 2ZOGA 4GVWA 4R76A 1TKHA 3IEHA 3PB9X 2Q43A 5LYLA 4JVVA 1YW6A 4A37A 5CB3A 3CPAA 5FSYA 4P4EA 4CPAA 4WWVA 1CBXA 4A39A 4R8FA 3SJXA 5LYIA 4MHNA 2L8RA 4ABLA 1QQ9A 2AFMA 1Y0RA 1HEEA 3B3CA 3VH9A 2EK9A 3N5FA 4NGPA 5LRKA 2WZNA 3ETIA 4ZX9A 4W9YA 4MMOA 3D67A 1HDQA 4UF4A 4EWTA 3V38A 4PQAA 3SIJA 1H8LA 4DYOA 2PJ8A 1HDUA 3B7IA 3V45A 2BFRA 2NSMA 1CG2A 5HVFA 1YD9A 4ZY2A 1ZG7A 2V8GA 4F9VA 3VATA 2VRIA 5HOLA 1KWMA 2OOTA 3VARA 4F9UA 4MCPA 1XFOA 3LMSA 1AMPA 1CX8A 1ZR5A 1UWYA 4ZY0A 2JBJA 2PVVA 3IJ3A 4NGQA 3KHZA 1TXZA 3S9LA 5LYDA 2AFOA 2ZENA 4MCSA 4PXBA 2BFQA 3PFEA 3MRUA 4FBEA 4OC5A 3HUVA 4X8IA 3EWRA 3IIBA 4NJRA 2JEWA 4DUKA 2BOAA 5LRJA 4BD9A 1Y7EA 2O4HA 2PJ2A 2DX6A 4A38A 7CPAA 5F09A 2AFZA 2LGRA 2JBKA 4A94A 2AFWA 4ZY1A 2F7VA 4P10A 4P45A 3GPQA 3JZTA 3FX6A 3D7HA 2ZOFA 2V8DA 1VHUA 1FNOA 2RFHA 3DGVA 3EJFA 4EFDA 4ZYQA 4ZI6A 4Q7AA 5HXDA 1SPVA 4G1PA 1F2OA 4NFRA 4J5RA 2CIJA 3S9NA 2V77A 4K3NA 4R7MA 3IFEA 2CF4A 5J1QA 2HC9A 3FF3A 3KR5A 1TKJA 1CPSA 3ISZA 2EEEA 1RTQA 1YSJA 1R3NA 3SI0A 5CPAA 3VFQA 3GLJA 1LAMA 4P4JA 3EWPA 4FUUA 4LQGA 2ZEFA 2PJBA 3B35A 1FT7A 3FEEA 4MCQA 2GU2A 3KQXA 3H8FA 3DLJA 2C6GA 4JZ0A 3HLPA 1LANA 4PXEA 5HIHA 3D4UA 2OR4A 1PYTB 4WJBA 4FAIA 2XEGA 3PRTA 2PVWA 5DUSA 2AFUA 3K2KA 3BXMA 1DTDA 3T8WA 1JQGA 3IO1A 1XJOA 1DE4C 2Q51A 1XRYA 2J9AA 3GPOA 3KI9A 3GUXA 3D66A 2IMOA 4RUHA 1Q7LA 3RBUA 1HJZA 5D8NA 5FSZA 1IY7A 1VHEA 2X47A 4X2TA 1LFWA 4UEFA 1VGYA 2PIZA 1XMBA 1ZG8A 4YU9A 3FJUA 1TY8A 1PCAA 3PBEA 2PJAA 3SJEA 2FVGA 5LYFA 2AFXA 1Z2LA 2BCOA 5K8MA 2ZEGA 3CT9A 1TKFA 1ZLHA 3B3VA 4PXDA 4UIBA 3PB7X 3D7FA 2AFSA 1Z5RA 1ZG9A 3FEDA 4UIAA 5JGFA 2CTBA 5FSUA 5E3BA 4P4BA 3KZWA 4MHYA 3FVLA 1BPMA 5CB5A 3WT4A 3PEIA 4PXCA 5DS0A 5CMSA 2BO9A 4OC0A 4MHZA 2FG1A 2G9DA 3GB0A 3ISXA 1CP6A 3MN8A 3L2NA 2VL1A 2C6PA 2I3CA 3EW5A 1ZLIA 1VHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJL A;  4K0C A;  4IHM A;  5K8O A;  3SIG A;  2PCU A;  4P4D A;  2XEI A;  4MXU A;  2FXK A;  4OKO A;  1CPX A;  3GQE A;  4NGR A;  3CPX A;  3PBB A;  1ELL P;  1QMU A;  3PB6 X;  3V2B A;  4JCA A;  1EE3 P;  4TNU A;  2CTC A;  2O53 A;  2PJ7 A;  4O23 A;  5ELY A;  1BLL E;  2ZED A;  4UEE A;  1LOK A;  2IJZ A;  2XEF A;  2PJ6 A;  2ZEO A;  1TF9 A;  3V7Z A;  3SI1 A;  3PB8 X;  2FAV A;  2IQ6 A;  4MRI A;  2WYR A;  4EME A;  3WAB A;  4NGN A;  4ZX8 A;  4P4I A;  1LCP A;  4IAV A;  4OIW A;  3WC5 A;  4OC4 A;  1ARL A;  1LAP A;  4JGK A;  3NFZ A;  4GUA A;  2ACF A;  2HB6 A;  3KR4 A;  3CDX A;  2PJC A;  4Z65 A;  4ONW A;  4ETK A;  3S9M A;  4FWU A;  1IGB A;  3FMC A;  1NJR A;  2GLF A;  4UML A;  4NGM A;  2AFC A;  2QJ8 A;  3QNV A;  1TF8 A;  5I4M A;  1M4L A;  1TXR A;  3NH5 A;  3PB4 X;  1ELM P;  2GRE A;  1AYE A;  3EJG A;  1ZR3 A;  5FSX A;  3SI2 A;  3IC1 A;  5THW A;  4PPZ A;  1F2P A;  2PJ4 A;  2GLJ A;  2C6C A;  4IK2 A;  1OBR A;  1YLO A;  4OP4 A;  3K9T A;  3H8G A;  4J5S A;  3WC6 A;  1Y0Y A;  5IB9 A;  2POK A;  2ZEH A;  3EWQ A;  3Q6Z A;  4P4F A;  4MCR A;  4OC1 A;  4D86 A;  2ZEL A;  3I1U A;  5JM6 A;  3KQZ A;  4P6Y A;  4JYW A;  2F8H A;  2PRQ A;  3KAS A;  5LRG A;  3SJF A;  4ABK A;  3PFO A;  4GM5 A;  3D7D A;  2C1C A;  3BHX A;  2QYV A;  2V8V A;  3FH4 A;  4NJQ A;  3B2Y A;  6CPA A;  1VIX A;  2ABZ A;  2ZEP A;  4AXV A;  3TX8 A;  5K8P A;  3Q71 A;  2ANP A;  3FEC A;  3IWW A;  4P44 A;  5K8N A;  5FSV A;  1CP7 A;  1YW4 A;  2QVP A;  4J5Q A;  3B3W A;  3IIF A;  4H2K A;  2PE3 A;  3EWO A;  5AIL A;  3LWU A;  1R43 A;  4OME A;  3SIH A;  3D7G A;  3H8E A;  4R6T A;  4KYB A;  4ETJ A;  3RZA A;  3JRU A;  2PJ1 A;  1ARM A;  8CPA A;  4YWY A;  2NYQ A;  3IID A;  4ESS A;  2PJ3 A;  4NGS A;  3KGQ A;  2ZEM A;  3GPG A;  4MHP A;  3KL9 A;  2PJ9 A;  1F57 A;  2EWB A;  2RB7 A;  2XEJ A;  3SJG A;  2PIY A;  3BI1 A;  1GYT A;  3EKE A;  3KHX A;  1XBU A;  3SII A;  4KSI A;  3WC7 A;  2PJ5 A;  5JH9 A;  2V8H A;  4X3R A;  4NGT A;  3B3S A;  2Q4Z A;  5D29 A;  4F8Z A;  3NA6 A;  2ZEE A;  4UEZ A;  3TC8 A;  5HVG A;  4J4Z A;  4JLL A;  1YME A;  3B3T A;  3NH4 A;  2PJ0 A;  4OC3 A;  3RAM A;  3D68 A;  1BPN A;  4IQY A;  4TWE A;  4TU0 A;  4GVV A;  4B6Z A;  2XD7 A;  5CBM A;  4OID A;  1NSA A;  1BAV A;  1Z8L A;  3GQO A;  5HVH A;  2DEA A;  2EK8 A;  3NH8 A;  4OC2 A;  3BI0 A;  2ZOG A;  4GVW A;  4R76 A;  1TKH A;  3IEH A;  3PB9 X;  2Q43 A;  5LYL A;  4JVV A;  1YW6 A;  4A37 A;  5CB3 A;  3CPA A;  5FSY A;  4P4E A;  4CPA A;  4WWV A;  1CBX A;  4A39 A;  4R8F A;  3SJX A;  5LYI A;  4MHN A;  2L8R A;  4ABL A;  1QQ9 A;  2AFM A;  1Y0R A;  1HEE A;  3B3C A;  3VH9 A;  2EK9 A;  3N5F A;  4NGP A;  5LRK A;  2WZN A;  3ETI A;  4ZX9 A;  4W9Y A;  4MMO A;  3D67 A;  1HDQ A;  4UF4 A;  4EWT A;  3V38 A;  4PQA A;  3SIJ A;  1H8L A;  4DYO A;  2PJ8 A;  1HDU A;  3B7I A;  3V45 A;  2BFR A;  2NSM A;  1CG2 A;  5HVF A;  1YD9 A;  4ZY2 A;  1ZG7 A;  2V8G A;  4F9V A;  3VAT A;  2VRI A;  5HOL A;  1KWM A;  2OOT A;  3VAR A;  4F9U A;  4MCP A;  1XFO A;  3LMS A;  1AMP A;  1CX8 A;  1ZR5 A;  1UWY A;  4ZY0 A;  2JBJ A;  2PVV A;  3IJ3 A;  4NGQ A;  3KHZ A;  1TXZ A;  3S9L A;  5LYD A;  2AFO A;  2ZEN A;  4MCS A;  4PXB A;  2BFQ A;  3PFE A;  3MRU A;  4FBE A;  4OC5 A;  3HUV A;  4X8I A;  3EWR A;  3IIB A;  4NJR A;  2JEW A;  4DUK A;  2BOA A;  5LRJ A;  4BD9 A;  1Y7E A;  2O4H A;  2PJ2 A;  2DX6 A;  4A38 A;  7CPA A;  5F09 A;  2AFZ A;  2LGR A;  2JBK A;  4A94 A;  2AFW A;  4ZY1 A;  2F7V A;  4P10 A;  4P45 A;  3GPQ A;  3JZT A;  3FX6 A;  3D7H A;  2ZOF A;  2V8D A;  1VHU A;  1FNO A;  2RFH A;  3DGV A;  3EJF A;  4EFD A;  4ZYQ A;  4ZI6 A;  4Q7A A;  5HXD A;  1SPV A;  4G1P A;  1F2O A;  4NFR A;  4J5R A;  2CIJ A;  3S9N A;  2V77 A;  4K3N A;  4R7M A;  3IFE A;  2CF4 A;  5J1Q A;  2HC9 A;  3FF3 A;  3KR5 A;  1TKJ A;  1CPS A;  3ISZ A;  2EEE A;  1RTQ A;  1YSJ A;  1R3N A;  3SI0 A;  5CPA A;  3VFQ A;  3GLJ A;  1LAM A;  4P4J A;  3EWP A;  4FUU A;  4LQG A;  2ZEF A;  2PJB A;  3B35 A;  1FT7 A;  3FEE A;  4MCQ A;  2GU2 A;  3KQX A;  3H8F A;  3DLJ A;  2C6G A;  4JZ0 A;  3HLP A;  1LAN A;  4PXE A;  5HIH A;  3D4U A;  2OR4 A;  1PYT B;  4WJB A;  4FAI A;  2XEG A;  3PRT A;  2PVW A;  5DUS A;  2AFU A;  3K2K A;  3BXM A;  1DTD A;  3T8W A;  1JQG A;  3IO1 A;  1XJO A;  1DE4 C;  2Q51 A;  1XRY A;  2J9A A;  3GPO A;  3KI9 A;  3GUX A;  3D66 A;  2IMO A;  4RUH A;  1Q7L A;  3RBU A;  1HJZ A;  5D8N A;  5FSZ A;  1IY7 A;  1VHE A;  2X47 A;  4X2T A;  1LFW A;  4UEF A;  1VGY A;  2PIZ A;  1XMB A;  1ZG8 A;  4YU9 A;  3FJU A;  1TY8 A;  1PCA A;  3PBE A;  2PJA A;  3SJE A;  2FVG A;  5LYF A;  2AFX A;  1Z2L A;  2BCO A;  5K8M A;  2ZEG A;  3CT9 A;  1TKF A;  1ZLH A;  3B3V A;  4PXD A;  4UIB A;  3PB7 X;  3D7F A;  2AFS A;  1Z5R A;  1ZG9 A;  3FED A;  4UIA A;  5JGF A;  2CTB A;  5FSU A;  5E3B A;  4P4B A;  3KZW A;  4MHY A;  3FVL A;  1BPM A;  5CB5 A;  3WT4 A;  3PEI A;  4PXC A;  5DS0 A;  5CMS A;  2BO9 A;  4OC0 A;  4MHZ A;  2FG1 A;  2G9D A;  3GB0 A;  3ISX A;  1CP6 A;  3MN8 A;  3L2N A;  2VL1 A;  2C6P A;  2I3C A;  3EW5 A;  1ZLI A;  1VHO A; 
#chains in the Genus database with same CATH topology
 1YQE A;  3DR6 A;  4KSF A;  4K0C A;  4IHM A;  4UCN A;  4DJL A;  5K8O A;  3SIG A;  2PCU A;  2FCK A;  1S7N A;  2XEI A;  4P4D A;  3VWD A;  1A2Z A;  2B3U A;  2FXK A;  4MXU A;  4M85 A;  4BMH A;  4L89 A;  4OKO A;  3JTK A;  4CGN A;  2AE6 A;  1CPX A;  4M6I A;  3GQE A;  4NGR A;  3CPX A;  3PBB A;  1ELL P;  4H89 A;  2CXA A;  3BLN A;  1QMU A;  4YGO A;  2VZY A;  2VBQ A;  3PB6 X;  3PZJ A;  3V2B A;  4JCA A;  3TTH A;  1EE3 P;  4B14 A;  4TNU A;  1NMT A;  2CTC A;  2O53 A;  4A2Z A;  2PJ7 A;  3TO7 A;  1BOB A;  4O23 A;  5ELY A;  2Z11 A;  1BLL E;  3SXO A;  1U6M A;  2ZED A;  4UEE A;  1M4G A;  4FD5 A;  1LOK A;  2IJZ A;  4JD6 A;  4NSQ A;  1N71 A;  2XEF A;  4XPD C;  2PJ6 A;  2VXK A;  2ZEO A;  3FYN A;  1TF9 A;  4AVB A;  4IF5 A;  4CGP A;  3V7Z A;  2B4D B;  3VWE A;  3SI1 A;  3PB8 X;  4Q38 A;  2FAV A;  1Y9K A;  4MFK A;  2GE3 A;  5EC4 A;  4CRZ B;  2IQ6 A;  4MRI A;  2P6E A;  2WYR A;  4L8A A;  4EME A;  3I9S A;  2HQY A;  3WAB A;  4NGN A;  4ZX8 A;  2Z3N A;  4P4I A;  4C2X A;  1S7F A;  1LCP A;  3P2H A;  3IGR A;  4IAV A;  4OIW A;  5GCN A;  3WC5 A;  5JPH A;  1YVK A;  1S60 A;  2JDC A;  4OC4 A;  1ARL A;  5I0C A;  1LAP A;  4JGK A;  3NFZ A;  2REE A;  4GUA A;  4JLY A;  2ACF A;  2HB6 A;  3KR4 A;  3F0A A;  3CDX A;  2PJC A;  4AVA A;  4Z65 A;  2Y0M A;  4ONW A;  1IOI A;  1ON0 A;  4ETK A;  3S9M A;  4FWU A;  1IGB A;  1Z8T A;  2WSA A;  3NE7 A;  3FMC A;  4EVY A;  4R57 A;  1NJR A;  2GLF A;  1XOV A;  4UML A;  4NGM A;  1Y7R A;  3QAY A;  2AFC A;  2QJ8 A;  3JUW A;  1XF8 A;  2GAN A;  1TF8 A;  3QNV A;  4UCM A;  4CAE A;  4MFL A;  3T90 A;  5I4M A;  1M4L A;  4PK2 A;  4R87 A;  3D8P A;  1TXR A;  1JWQ A;  3W6S A;  4CAW A;  3NH5 A;  3PB4 X;  1ELM P;  4MI4 A;  2GRE A;  1AYE A;  3EJG A;  5AG5 A;  1ZR3 A;  2D4O A;  5FSX A;  3SI2 A;  3IC1 A;  5THW A;  4PPZ A;  4DNC A;  1F2P A;  2PJ4 A;  2GLJ A;  2YNC A;  2C6C A;  2JDD A;  1OBR A;  1YLO A;  3LAC A;  3NE8 A;  4IK2 A;  4OP4 A;  3R9F A;  2KQV A;  4CS0 B;  2VQY A;  5F49 A;  2B5G A;  1B87 A;  3K9T A;  3H8G A;  5G20 A;  4J5S A;  3GIU A;  4B5P A;  3WC6 A;  1Y0Y A;  1VHS A;  2Q0Y A;  4C2Y A;  5IB9 A;  1PUA A;  2POK A;  4R3L A;  4Y49 C;  2ZEH A;  5HMN A;  2J8R A;  3EWQ A;  4KVM E;  1SQH A;  4OAD A;  2VZZ A;  3Q6Z A;  4OLL A;  4P4F A;  5KTD A;  4MCR A;  4OC1 A;  3W91 A;  4D86 A;  2ZEL A;  3BJ7 A;  3I1U A;  4XPD B;  3TFY A;  5JM6 A;  3KQZ A;  4HPS A;  4P6Y A;  1J4J A;  2OZG A;  2F8H A;  2PRQ A;  4JYW A;  4MBU A;  2REF A;  3R9G A;  2P6F A;  3KAS A;  3TOA A;  4CAX A;  5LRG A;  1IYK A;  3SJF A;  1S7K A;  4ABK A;  4UFW A;  4CAF A;  4UCP A;  3PFO A;  4GM5 A;  2BL1 A;  2WUU A;  3D7D A;  4CGL A;  2C1C A;  5AGE A;  4II9 A;  3QB8 A;  3BHX A;  4KUA A;  2QYV A;  2V8V A;  3FH4 A;  4NJQ A;  3B2Y A;  3ZZI A;  4MY0 A;  3MGD A;  1MK4 A;  1VIX A;  2ABZ A;  2FS5 A;  4A95 A;  6CPA A;  2RNK A;  2ZEP A;  4A32 A;  3TE4 A;  4AXV A;  3TX8 A;  4AG9 A;  5K8P A;  3Q71 A;  2BSW A;  1B6B A;  2EUI A;  2YNC C;  3LD2 A;  5G22 A;  4E2A A;  1M44 A;  2ANP A;  3D2M A;  3FEC A;  4QB9 A;  2G0B A;  3IU1 A;  4XNH B;  4OAE A;  3IWW A;  4P44 A;  5K8N A;  2Z3P A;  5FSV A;  1R57 A;  1CP7 A;  1YW4 A;  1YVO A;  3CXP A;  1KUX A;  2QVP A;  4KOU A;  4J5Q A;  3B3W A;  3IIF A;  1YK3 A;  2Z3M A;  4H2K A;  2PE3 A;  4FD4 A;  4H6Z A;  5H86 A;  2R7H A;  3EWO A;  5AIL A;  2CNS A;  2JZF A;  1QSN A;  3LWU A;  4AVC A;  1R43 A;  1MJA A;  3SIH A;  3D7G A;  4OME A;  4CGO A;  1KZF A;  3H8E A;  4R6T A;  4KYB A;  3CXS A;  3P2F A;  4ETJ A;  3N7Z A;  3RZA A;  3JRU A;  2PJ1 A;  4KS9 A;  2CNT A;  4U9Y A;  2JZE A;  5J8F A;  1ARM A;  2FL4 A;  8CPA A;  4YWY A;  3GY9 A;  1Z9U A;  2NYQ A;  3FNC A;  3IID A;  4JXR A;  4ESS A;  4JXQ A;  4A30 A;  2PJ3 A;  4NGS A;  1NE9 A;  3KGQ A;  2YND A;  2ZEM A;  3GPG A;  4MHP A;  3KL9 A;  2PJ9 A;  1F57 A;  1IU8 A;  1KUV A;  2Z3K A;  2EWB A;  2EBJ A;  2RB7 A;  2XEJ A;  4Y49 B;  2PIY A;  3SJG A;  2FXF A;  2Q4V A;  1GYT A;  3BI1 A;  3EXN A;  4ZGY B;  3K9U A;  3EKE A;  4KVX A;  3KHX A;  4MFQ A;  1V0C A;  3TOB A;  1XBU A;  2BUE A;  3SII A;  4FD6 A;  2CNM A;  5IX3 A;  4KSI A;  5KTA A;  4U9Z A;  3WC7 A;  2WPX A;  2PJ5 A;  5JH9 A;  2V8H A;  4X3R A;  4NGT A;  3B3S A;  1KUY A;  2Q4Z A;  5D29 A;  4F8Z A;  3NA6 A;  2QEC A;  1YR0 A;  2ZEE A;  1S3Z A;  4UFX A;  4UEZ A;  5H84 A;  2ZW4 A;  3TC8 A;  3EC4 A;  2Q04 A;  5HVG A;  4J4Z A;  4JLL A;  1YME A;  2DF5 A;  3B3T A;  2PJ0 A;  3NH4 A;  4KOV A;  4OC3 A;  3RAM A;  5IB0 A;  2QIR A;  4UWI A;  3D68 A;  1BPN A;  4IQY A;  5JQ4 A;  4TWE A;  4TU0 A;  3H5Z A;  4GVV A;  4HNX B;  4B6Z A;  2XD7 A;  2B58 A;  4KOR A;  5CBM A;  4OID A;  4C2Z A;  1NSA A;  1XIX A;  2F5I A;  1BAV A;  1Z8L A;  3GQO A;  5HVH A;  2DEA A;  3IWE A;  2EK8 A;  2Z10 A;  2ZPA A;  1RXT A;  3NH8 A;  3BI0 A;  4KOY A;  2ZOG A;  4OC2 A;  2VI7 A;  4GVW A;  4AG7 A;  5F46 A;  4NXY A;  1QSO A;  2FT0 A;  4NEX A;  4KUB A;  4MJ8 A;  4R76 A;  1NSL A;  4J3G A;  1TKH A;  1Q2D A;  3IEH A;  3PB9 X;  2C27 A;  2Q43 A;  4BBH A;  2DPT A;  3KKW A;  5LYL A;  4JVV A;  1YW6 A;  2RC4 A;  3FIX A;  4H6U A;  4A37 A;  5CB3 A;  3CPA A;  5FSY A;  4P4E A;  1OZP A;  4CPA A;  4QUS A;  1CBX A;  4WWV A;  4A39 A;  2ZW7 A;  1M4I A;  2PR8 A;  4LUA A;  3BJ8 A;  4R8F A;  3SJX A;  5LYI A;  4CYQ A;  1M4D A;  2K5T A;  5IV0 A;  1Z4E A;  3TO6 A;  4R9M A;  3S6K A;  3C26 A;  1QSM A;  2B4D A;  2L8R A;  4MHN A;  1ZO0 A;  4E0A A;  4CYO A;  1MJ9 A;  4ABL A;  5AG7 A;  1QQ9 A;  2AFM A;  1Y0R A;  2OZH A;  1HEE A;  2Z3O A;  5CNP A;  3B3C A;  5F48 A;  2JZD A;  1LRZ A;  3VH9 A;  4QVT A;  5AG6 A;  4PK3 A;  2EK9 A;  3N5F A;  4NGP A;  4U5Y A;  4C7I A;  4PV6 A;  5LRK A;  1I21 A;  2WZN A;  1IOF A;  3ETI A;  4GS4 A;  4ZX9 A;  1IID A;  2OU2 A;  4W9Y A;  1IIC A;  4MMO A;  2EVN A;  3D67 A;  2O28 A;  1HDQ A;  4UF4 A;  3SHP A;  4EWT A;  3PP9 A;  2YNE A;  3V38 A;  2D4P A;  4KOS A;  3CZX A;  5AG4 A;  4GXH A;  4PQA A;  3SIJ A;  1H8L A;  3R96 A;  4DYO A;  2PJ8 A;  1HDU A;  2R1I A;  4B10 A;  1IYL A;  4UA3 A;  3EO4 A;  4F0Y A;  3B7I A;  3V45 A;  5G21 A;  3JVN A;  1FY7 A;  2BFR A;  2GIV A;  2NSM A;  2H5M A;  1XEB A;  3FXT A;  1CG2 A;  2PC1 A;  4KOW A;  5HVF A;  4UWJ A;  4LX9 A;  1YD9 A;  5EBV A;  4ZY2 A;  1Z8X A;  4BIN A;  1ZG7 A;  2V8G A;  4F9V A;  2I79 A;  2WPW A;  3VAT A;  2VRI A;  5HOL A;  1KWM A;  2G3T A;  4FD7 A;  3G8W A;  2X7B A;  2KCW A;  2OOT A;  3VAR A;  4F9U A;  4MCP A;  1XFO A;  1X12 A;  3LMS A;  1AMP A;  1CX8 A;  2BEI A;  1ZR5 A;  1UWY A;  2Q7S A;  4ZY0 A;  3S6F A;  2JBJ A;  4I49 A;  2PVV A;  3TT2 A;  3IJ3 A;  4NGQ A;  2Q44 A;  3KHZ A;  1TXZ A;  4E8O A;  3S9L A;  5LYD A;  4B12 A;  2AFO A;  2ZEN A;  3OWC A;  1YGH A;  2I00 A;  4MCS A;  4NF1 A;  2HUZ A;  4PXB A;  2BFQ A;  1CJW A;  4NCZ A;  1WK4 A;  2ARH A;  3PFE A;  2GFQ A;  3MRU A;  4FBE A;  5C82 A;  4OC5 A;  3HUV A;  4X8I A;  3EWR A;  4MFZ A;  2P0W A;  4KLW A;  2ODF A;  4UFV A;  4M6H A;  3ZJ0 A;  4KZT A;  3IIB A;  4NJR A;  2JEW A;  2OH1 A;  4DUK A;  2JLM A;  2BOA A;  5LRJ A;  2PSW A;  4X5K A;  4BD9 A;  1Y7E A;  2O4H A;  2PJ2 A;  2DX6 A;  4B11 A;  4A38 A;  7CPA A;  5F47 A;  4MY3 A;  5A28 A;  4CYN A;  4B13 A;  5F09 A;  2AFZ A;  2LGR A;  3IWG A;  4KOX A;  2JBK A;  4A94 A;  4CGM A;  2AFW A;  4ZY1 A;  2HV2 A;  5G1Z A;  2F7V A;  4P10 A;  4LQ6 A;  4P45 A;  4AB7 A;  3GPQ A;  3WR7 A;  3JZT A;  3FX6 A;  4A31 A;  5DWN A;  2W2G A;  1TIQ A;  2PQ8 A;  3E0K A;  3D7H A;  2ZOF A;  2V8D A;  3DNS A;  3RNZ A;  3EY5 A;  1VHU A;  1FNO A;  1IB1 E;  2RFH A;  3DGV A;  3EJF A;  4EFD A;  4ZYQ A;  2OB0 A;  4ZI6 A;  1PU9 A;  2B4B A;  3I3G A;  4Q7A A;  5HXD A;  1SPV A;  4G1P A;  1F2O A;  2VEZ A;  1P0H A;  4F6A A;  4NFR A;  4J5R A;  3SXN A;  4CRY B;  1S5K A;  3FB3 A;  1MJB A;  1I12 A;  2CIJ A;  3S9N A;  2FIA A;  2V77 A;  4K3N A;  1L0C A;  5E96 A;  4R7M A;  3IFE A;  2CF4 A;  2A4N A;  2YGW A;  5J1Q A;  2HC9 A;  3TO9 A;  2ZW6 A;  2AJ6 A;  3FF3 A;  2R8V A;  3KR5 A;  1TKJ A;  5BWA B;  1CPS A;  2B5G B;  3ISZ A;  2EEE A;  1RTQ A;  3PGP A;  1YSJ A;  5ISV A;  4B5P B;  2Q4Y A;  1R3N A;  4PSW A;  3SI0 A;  2FSR A;  3CXQ A;  5CPA A;  3DR8 A;  3VFQ A;  1GHE A;  4IUS A;  4XPK A;  1WWZ A;  4ONU A;  3GLJ A;  3QAH A;  4M6G A;  1LAM A;  4K30 A;  4XPL A;  2Z3L A;  2ZW5 A;  3EWP A;  4P4J A;  4FUU A;  4LQG A;  3GKR A;  2ZEF A;  2PJB A;  5EMI A;  3TCV A;  3B35 A;  1FT7 A;  3FEE A;  2DXQ A;  2FIW A;  3D3S A;  1QSR A;  4MCQ A;  4UBR A;  2GU2 A;  3KQX A;  3H8F A;  1QST A;  3DLJ A;  2C6G A;  4JZ0 A;  1VKC A;  2QML A;  3DDD A;  4YRH A;  3HLP A;  4RN7 A;  4XNH C;  4JWP A;  4A33 A;  1LAN A;  4PXE A;  5HIH A;  4HKF A;  3IU2 A;  4YFJ A;  1M1D A;  3FBU A;  3LOD A;  3DSB A;  3D4U A;  2OR4 A;  2Q7B A;  1Q2Y A;  2P6G A;  3T9Y A;  1XE4 A;  1PYT B;  4WJB A;  4FAI A;  2NMT A;  2PRB A;  1P4N A;  2ZXV A;  4KSA A;  2WCT A;  2XEG A;  3PRT A;  2PVW A;  5DUS A;  2AFU A;  3K2K A;  3BXM A;  1DTD A;  3RYO A;  3T8W A;  1JQG A;  2PDO A;  4KVO E;  2DPS A;  4Q36 A;  3W6X A;  3IO1 A;  2B3V A;  3H4Q A;  2J8N A;  4MFP A;  1XJO A;  1AUG A;  1DE4 C;  4KLV A;  1YX0 A;  2PR1 A;  2Q51 A;  1XRY A;  3FRM A;  4RI1 A;  5FVJ A;  2J9A A;  1UFH A;  4HNW B;  4R3K A;  1K4J A;  2R98 A;  4JJX A;  2EO8 A;  4MHD A;  2JEV A;  3GPO A;  3KI9 A;  2CY2 A;  3GUX A;  3D66 A;  1S7L A;  4F0X A;  2IMO A;  4RUH A;  1Q7L A;  5C88 A;  5DWM A;  3A9L A;  4ZBG A;  1RO5 A;  3S6H A;  4ORF A;  3RBU A;  1HJZ A;  3R95 A;  5D8N A;  5FSZ A;  1IY7 A;  1VHE A;  2IL4 A;  2X47 A;  4X2T A;  1LFW A;  4M3S A;  1VGY A;  2PIZ A;  1XMB A;  1ZG8 A;  4UEF A;  3G3S A;  4QC6 A;  4YU9 A;  3RO0 A;  3FJU A;  1TY8 A;  3GYA A;  3F5B A;  1PCA A;  1Z8W A;  2PJA A;  3PBE A;  2FVG A;  3R1K A;  4KOT A;  3SJE A;  1X10 A;  2OZU A;  5LYF A;  2AFX A;  2Z0Z A;  1Z2L A;  2BCO A;  3V8I A;  3B8G A;  4B5O A;  5K8M A;  5J8C A;  2ZEG A;  2J8M A;  3CT9 A;  1TKF A;  1ZLH A;  3F8K A;  3B3V A;  2G3A A;  4PXD A;  4C68 A;  4UIB A;  3PB7 X;  3D7F A;  2AFS A;  1YLE A;  4C7H A;  1Z5R A;  1ZG9 A;  4HNY B;  3FED A;  4UIA A;  5JGF A;  1I1D A;  2CTB A;  1Q2C A;  3D2P A;  5FSU A;  5E3B A;  4P4B A;  3KZW A;  3EFA A;  1XMT A;  4MHY A;  3FVL A;  1BPM A;  5CB5 A;  2FE7 A;  3WT4 A;  3PEI A;  4PXC A;  5DS0 A;  5CMS A;  1Y9W A;  2BO9 A;  3UY5 A;  3S6G A;  4OC0 A;  5A27 A;  1Z4R A;  4MHZ A;  4PSX A;  4RS2 A;  2FG1 A;  3R9E A;  2G9D A;  3GB0 A;  3ISX A;  5HH1 A;  4CAV A;  4QBJ A;  1CP6 A;  3MN8 A;  5KTC A;  4MFJ A;  3L2N A;  2VL1 A;  2C6P A;  2I3C A;  3EW5 A;  4CYP A;  2ATR A;  1ZLI A;  1VHO A;  1CM0 A;  1YRE A;  1BO4 A; 
#chains in the Genus database with same CATH homology
 4DJL A;  4K0C A;  4IHM A;  5K8O A;  3SIG A;  2PCU A;  4P4D A;  2XEI A;  4MXU A;  2FXK A;  4OKO A;  1CPX A;  3GQE A;  4NGR A;  3CPX A;  3PBB A;  1ELL P;  1QMU A;  3PB6 X;  3V2B A;  4JCA A;  1EE3 P;  4TNU A;  2CTC A;  2O53 A;  2PJ7 A;  4O23 A;  5ELY A;  1BLL E;  2ZED A;  4UEE A;  1LOK A;  2IJZ A;  2XEF A;  2PJ6 A;  2ZEO A;  1TF9 A;  3V7Z A;  3SI1 A;  3PB8 X;  2FAV A;  2IQ6 A;  4MRI A;  2WYR A;  4EME A;  3WAB A;  4NGN A;  4ZX8 A;  4P4I A;  1LCP A;  4IAV A;  4OIW A;  3WC5 A;  4OC4 A;  1ARL A;  1LAP A;  4JGK A;  3NFZ A;  4GUA A;  2ACF A;  2HB6 A;  3KR4 A;  3CDX A;  2PJC A;  4Z65 A;  4ONW A;  4ETK A;  3S9M A;  4FWU A;  1IGB A;  3FMC A;  1NJR A;  2GLF A;  4UML A;  4NGM A;  2AFC A;  2QJ8 A;  3QNV A;  1TF8 A;  5I4M A;  1M4L A;  1TXR A;  3NH5 A;  3PB4 X;  1ELM P;  2GRE A;  1AYE A;  3EJG A;  1ZR3 A;  5FSX A;  3SI2 A;  3IC1 A;  5THW A;  4PPZ A;  1F2P A;  2PJ4 A;  2GLJ A;  2C6C A;  4IK2 A;  1OBR A;  1YLO A;  4OP4 A;  3K9T A;  3H8G A;  4J5S A;  3WC6 A;  1Y0Y A;  5IB9 A;  2POK A;  2ZEH A;  3EWQ A;  3Q6Z A;  4P4F A;  4MCR A;  4OC1 A;  4D86 A;  2ZEL A;  3I1U A;  5JM6 A;  3KQZ A;  4P6Y A;  4JYW A;  2F8H A;  2PRQ A;  3KAS A;  5LRG A;  3SJF A;  4ABK A;  3PFO A;  4GM5 A;  3D7D A;  2C1C A;  3BHX A;  2QYV A;  2V8V A;  3FH4 A;  4NJQ A;  3B2Y A;  6CPA A;  1VIX A;  2ABZ A;  2ZEP A;  4AXV A;  3TX8 A;  5K8P A;  3Q71 A;  2ANP A;  3FEC A;  3IWW A;  4P44 A;  5K8N A;  5FSV A;  1CP7 A;  1YW4 A;  2QVP A;  4J5Q A;  3B3W A;  3IIF A;  4H2K A;  2PE3 A;  3EWO A;  5AIL A;  3LWU A;  1R43 A;  4OME A;  3SIH A;  3D7G A;  3H8E A;  4R6T A;  4KYB A;  4ETJ A;  3RZA A;  3JRU A;  2PJ1 A;  1ARM A;  8CPA A;  4YWY A;  2NYQ A;  3IID A;  4ESS A;  2PJ3 A;  4NGS A;  3KGQ A;  2ZEM A;  3GPG A;  4MHP A;  3KL9 A;  2PJ9 A;  1F57 A;  2EWB A;  2RB7 A;  2XEJ A;  3SJG A;  2PIY A;  3BI1 A;  1GYT A;  3EKE A;  3KHX A;  1XBU A;  3SII A;  4KSI A;  3WC7 A;  2PJ5 A;  5JH9 A;  2V8H A;  4X3R A;  4NGT A;  3B3S A;  2Q4Z A;  5D29 A;  4F8Z A;  3NA6 A;  2ZEE A;  4UEZ A;  3TC8 A;  5HVG A;  4J4Z A;  4JLL A;  1YME A;  3B3T A;  3NH4 A;  2PJ0 A;  4OC3 A;  3RAM A;  3D68 A;  1BPN A;  4IQY A;  4TWE A;  4TU0 A;  4GVV A;  4B6Z A;  2XD7 A;  5CBM A;  4OID A;  1NSA A;  1BAV A;  1Z8L A;  3GQO A;  5HVH A;  2DEA A;  2EK8 A;  3NH8 A;  4OC2 A;  3BI0 A;  2ZOG A;  4GVW A;  4R76 A;  1TKH A;  3IEH A;  3PB9 X;  2Q43 A;  5LYL A;  4JVV A;  1YW6 A;  4A37 A;  5CB3 A;  3CPA A;  5FSY A;  4P4E A;  4CPA A;  4WWV A;  1CBX A;  4A39 A;  4R8F A;  3SJX A;  5LYI A;  4MHN A;  2L8R A;  4ABL A;  1QQ9 A;  2AFM A;  1Y0R A;  1HEE A;  3B3C A;  3VH9 A;  2EK9 A;  3N5F A;  4NGP A;  5LRK A;  2WZN A;  3ETI A;  4ZX9 A;  4W9Y A;  4MMO A;  3D67 A;  1HDQ A;  4UF4 A;  4EWT A;  3V38 A;  4PQA A;  3SIJ A;  1H8L A;  4DYO A;  2PJ8 A;  1HDU A;  3B7I A;  3V45 A;  2BFR A;  2NSM A;  1CG2 A;  5HVF A;  1YD9 A;  4ZY2 A;  1ZG7 A;  2V8G A;  4F9V A;  3VAT A;  2VRI A;  5HOL A;  1KWM A;  2OOT A;  3VAR A;  4F9U A;  4MCP A;  1XFO A;  3LMS A;  1AMP A;  1CX8 A;  1ZR5 A;  1UWY A;  4ZY0 A;  2JBJ A;  2PVV A;  3IJ3 A;  4NGQ A;  3KHZ A;  1TXZ A;  3S9L A;  5LYD A;  2AFO A;  2ZEN A;  4MCS A;  4PXB A;  2BFQ A;  3PFE A;  3MRU A;  4FBE A;  4OC5 A;  3HUV A;  4X8I A;  3EWR A;  3IIB A;  4NJR A;  2JEW A;  4DUK A;  2BOA A;  5LRJ A;  4BD9 A;  1Y7E A;  2O4H A;  2PJ2 A;  2DX6 A;  4A38 A;  7CPA A;  5F09 A;  2AFZ A;  2LGR A;  2JBK A;  4A94 A;  2AFW A;  4ZY1 A;  2F7V A;  4P10 A;  4P45 A;  3GPQ A;  3JZT A;  3FX6 A;  3D7H A;  2ZOF A;  2V8D A;  1VHU A;  1FNO A;  2RFH A;  3DGV A;  3EJF A;  4EFD A;  4ZYQ A;  4ZI6 A;  4Q7A A;  5HXD A;  1SPV A;  4G1P A;  1F2O A;  4NFR A;  4J5R A;  2CIJ A;  3S9N A;  2V77 A;  4K3N A;  4R7M A;  3IFE A;  2CF4 A;  5J1Q A;  2HC9 A;  3FF3 A;  3KR5 A;  1TKJ A;  1CPS A;  3ISZ A;  2EEE A;  1RTQ A;  1YSJ A;  1R3N A;  3SI0 A;  5CPA A;  3VFQ A;  3GLJ A;  1LAM A;  4P4J A;  3EWP A;  4FUU A;  4LQG A;  2ZEF A;  2PJB A;  3B35 A;  1FT7 A;  3FEE A;  4MCQ A;  2GU2 A;  3KQX A;  3H8F A;  3DLJ A;  2C6G A;  4JZ0 A;  3HLP A;  1LAN A;  4PXE A;  5HIH A;  3D4U A;  2OR4 A;  1PYT B;  4WJB A;  4FAI A;  2XEG A;  3PRT A;  2PVW A;  5DUS A;  2AFU A;  3K2K A;  3BXM A;  1DTD A;  3T8W A;  1JQG A;  3IO1 A;  1XJO A;  1DE4 C;  2Q51 A;  1XRY A;  2J9A A;  3GPO A;  3KI9 A;  3GUX A;  3D66 A;  2IMO A;  4RUH A;  1Q7L A;  3RBU A;  1HJZ A;  5D8N A;  5FSZ A;  1IY7 A;  1VHE A;  2X47 A;  4X2T A;  1LFW A;  4UEF A;  1VGY A;  2PIZ A;  1XMB A;  1ZG8 A;  4YU9 A;  3FJU A;  1TY8 A;  1PCA A;  3PBE A;  2PJA A;  3SJE A;  2FVG A;  5LYF A;  2AFX A;  1Z2L A;  2BCO A;  5K8M A;  2ZEG A;  3CT9 A;  1TKF A;  1ZLH A;  3B3V A;  4PXD A;  4UIB A;  3PB7 X;  3D7F A;  2AFS A;  1Z5R A;  1ZG9 A;  3FED A;  4UIA A;  5JGF A;  2CTB A;  5FSU A;  5E3B A;  4P4B A;  3KZW A;  4MHY A;  3FVL A;  1BPM A;  5CB5 A;  3WT4 A;  3PEI A;  4PXC A;  5DS0 A;  5CMS A;  2BO9 A;  4OC0 A;  4MHZ A;  2FG1 A;  2G9D A;  3GB0 A;  3ISX A;  1CP6 A;  3MN8 A;  3L2N A;  2VL1 A;  2C6P A;  2I3C A;  3EW5 A;  1ZLI A;  1VHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...