5CBMA

Crystal structure of pfa-m17 with virtual ligand inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M17 family aminopeptidase
publication title Identification and Validation of a Potent Dual Inhibitor of the P. falciparum M1 and M17 Aminopeptidases Using Virtual Screening.
pubmed doi rcsb
source organism Plasmodium falciparum vietnam oak-knoll (fvo)
total genus 175
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5cbmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5cbmA02
5J1QA 4EWTA 5K8NA 3T8WA 4NGRA 4ZX8A 4GUAA 4MCPA 2EEEA 1RTQA 4TWEA 4TU0A 2AFWA 3D67A 3KASA 4GM5A 3SI0A 3JRUA 3GQOA 3GB0A 4PXBA 3SIIA 4PQAA 3B3SA 4A39A 3KR5A 1TXRA 4NJRA 2O53A 1ZR5A 4MHYA 3FEDA 3VATA 4MCSA 2ZEDA 1YMEA 3MN8A 2LGRA 3KR4A 2PIZA 2PJCA 3PB9X 3S9MA 5CPAA 3KQZA 3IO1A 1LAPA 1TXZA 2WYRA 4FBEA 2IMOA 4IHMA 3WABA 5LYIA 4ZX9A 1CP6A 3CT9A 5JGFA 4P4EA 3SJXA 5FSUA 1CPXA 2AFUA 4F9VA 3PFEA 2PJ4A 1YSJA 3B3WA 3GUXA 4P4FA 5FSXA 2NSMA 5DUSA 4MHNA 3IWWA 1KWMA 4P4JA 4UEEA 5D8NA 4P4IA 1AYEA 4OMEA 3WT4A 2F8HA 2XEJA 4KSIA 3IC1A 3I1UA 3FJUA 4EFDA 2DEAA 3PB4X 3EW5A 5CB5A 5CMSA 3FF3A 4IAVA 8CPAA 3B3VA 4UF4A 4OP4A 1ZG9A 1HEEA 4JZ0A 1Z8LA 2L8RA 1YLOA 3L2NA 2AFOA 4BD9A 1FNOA 4NJQA 3IIFA 4RUHA 2BOAA 4P45A 3Q6ZA 4IK2A 3PFOA 1HDUA 3V38A 4PPZA 3SJGA 2J9AA 4OC4A 4DYOA 4B6ZA 1EE3P 3EKEA 1CBXA 2ZELA 1H8LA 5AILA 2CTBA 4PXEA 4P4BA 2IJZA 2FAVA 3FEEA 1VIXA 2PIYA 4ZI6A 1NJRA 4J5SA 3D7HA 3TX8A 3D4UA 1UWYA 4GVWA 5FSZA 5HIHA 3PBBA 3BI1A 1CG2A 5LYDA 4R76A 1TKFA 2PJ1A 4YU9A 3SI1A 3HUVA 5E3BA 4K3NA 3GQEA 2FG1A 3RZAA 4X3RA 1LANA 2ZEFA 2PJ5A 5CB3A 4DUKA 4MXUA 2ZEEA 4JVVA 3PB7X 2QJ8A 4MRIA 2PJ2A 1XMBA 1M4LA 2AFXA 3D7FA 5LYFA 4JLLA 1TKJA 3K9TA 3NH8A 3NH5A 5FSYA 4P10A 4Q7AA 3VARA 3IFEA 2AFCA 1CX8A 2CIJA 5K8PA 1YW4A 2V77A 5HVFA 3CPXA 3VFQA 1F2OA 3CDXA 2ZEOA 4X8IA 1TF9A 5K8OA 3FECA 2C6CA 3D7DA 4LQGA 1Z5RA 3NH4A 3ETIA 3PB6X 3FVLA 1ELMP 3LMSA 4A37A 2XEGA 1BLLE 1IGBA 4ESSA 3GPOA 2HB6A 3H8EA 4PXDA 4P4DA 3ISZA 1FT7A 2EK8A 4P44A 5HXDA 2XD7A 2V8DA 2ZENA 4OIDA 2RB7A 4OKOA 2V8HA 4MMOA 4IQYA 3K2KA 3D66A 4Z65A 3EWPA 4ZY1A 2PJ8A 1ZG8A 1R3NA 4NGNA 3IEHA 4NGMA 2QYVA 2PJ9A 4MCRA 2GREA 1Y7EA 2PJAA 2ZOGA 2AFMA 1VGYA 1HJZA 1TY8A 3GLJA 4J4ZA 5CBMA 5LRKA 1R43A 4F8ZA 4UMLA 3FX6A 1ARLA 2BCOA 2JBKA 5IB9A 4D86A 2PRQA 4JYWA 3NA6A 4J5RA 2AFZA 3EWQA 1Z2LA 3CPAA 2V8GA 3N5FA 4FWUA 2BO9A 4ABLA 2QVPA 1LOKA 1YW6A 3ISXA 1TKHA 3PBEA 4G1PA 2OR4A 4R7MA 1HDQA 2PVWA 3Q71A 4NGSA 4EMEA 2WZNA 4UIAA 1OBRA 3KQXA 1QMUA 5JM6A 4UEFA 1BAVA 3SJEA 2GU2A 2V8VA 2VRIA 2Q43A 3KI9A 4KYBA 5JH9A 4AXVA 1LFWA 2NYQA 2BFQA 2G9DA 6CPAA 4MHPA 2XEFA 1XRYA 4PXCA 1DTDA 3D68A 5LRGA 5DS0A 3GPGA 1CP7A 4OIWA 4ONWA 4H2KA 3PEIA 1LAMA 3TC8A 1LCPA 1ZG7A 3EWRA 1F2PA 4X2TA 4O23A 2PVVA 4ZY0A 5F09A 2HC9A 2C6GA 3KHZA 4W9YA 1YD9A 5HVGA 1ARMA 4ETKA 1TF8A 4TNUA 3B2YA 2CTCA 2Q51A 4UEZA 3S9LA 3WC7A 3H8FA 3B35A 1Q7LA 1XFOA 1AMPA 2PJ6A 2PJ0A 2VL1A 3IJ3A 4OC1A 5D29A 5THWA 3BI0A 1ELLP 4NGQA 1NSAA 2ZEHA 3V7ZA 1F57A 3B3TA 1BPNA 5K8MA 4J5QA 2POKA 3KGQA 3RBUA 3EJGA 2DX6A 1QQ9A 1DE4C 3SJFA 5FSVA 4OC2A 1PCAA 5LRJA 2ACFA 1ZLHA 4ZY2A 4ZYQA 3NFZA 1IY7A 4ETJA 4P6YA 2ANPA 3H8GA 4JGKA 4K0CA 3V45A 2C6PA 3EWOA 3KZWA 4R8FA 3SIJA 3SIGA 3BXMA 2BFRA 2FVGA 3KL9A 3QNVA 1Y0YA 3HLPA 1VHUA 2ABZA 1ZLIA 2PCUA 3WC5A 3WC6A 4JCAA 2FXKA 1BPMA 4DJLA 1CPSA 2CF4A 2OOTA 2JEWA 2EK9A 4NGPA 4YWYA 1JQGA 3DLJA 3BHXA 3S9NA 3D7GA 4OC0A 7CPAA 3PB8X 3DGVA 5LYLA 2AFSA 4R6TA 3MRUA 4GVVA 4MCQA 2O4HA 1Y0RA 4MHZA 1VHEA 4ABKA 4WJBA 5HOLA 3VH9A 2ZEPA 1ZR3A 3B7IA 3RAMA 3FH4A 3V2BA 4OC3A 3EJFA 5ELYA 2Q4ZA 2I3CA 1XJOA 2PE3A 3FMCA 1GYTA 2PJ7A 3IIBA 3GPQA 3SIHA 1SPVA 4OC5A 3JZTA 4A94A 4WWVA 5HVHA 2ZEMA 3PRTA 1VHOA 4CPAA 4FAIA 2ZOFA 2XEIA 1PYTB 2F7VA 4F9UA 5I4MA 4NFRA 2ZEGA 2PJBA 2IQ6A 4FUUA 1XBUA 3KHXA 2GLFA 2PJ3A 4UIBA 3LWUA 2C1CA 4A38A 2JBJA 2EWBA 2RFHA 3IIDA 2GLJA 3B3CA 2X47A 3SI2A 4NGTA
chains in the Genus database with same CATH superfamily
1Y9WA 2BEIA 5J1QA 2DPTA 4B5PB 4EWTA 4NXYA 2KCWA 2ZXVA 1AUGA 4UFWA 5K8NA 4MFZA 1IYKA 1YGHA 2D4PA 1XIXA 3T8WA 4U5YA 5C88A 4C68A 4NGRA 3BJ7A 2PR8A 4B5OA 4ZX8A 4GUAA 4MCPA 2EEEA 1RTQA 4TWEA 5J8CA 4A32A 4TU0A 3MGDA 4AVCA 1XEBA 2AFWA 2R7HA 3D67A 3KASA 4GM5A 4X5KA 3JRUA 3GQOA 3SI0A 3CXQA 3GB0A 4PXBA 4A95A 3SIIA 2WUUA 4PQAA 2WCTA 2AE6A 3B3SA 3H5ZA 4ORFA 4A39A 3KR5A 5AG6A 4AG7A 1TXRA 4OLLA 3TOBA 4NJRA 2O53A 1ZR5A 2Z3LA 3SXNA 5J8FA 1QSOA 1I1DA 4PSXA 4MJ8A 4A31A 4MHYA 3FEDA 3VATA 1OZPA 2FT0A 4OAEA 4GXHA 4MCSA 3A9LA 3JTKA 2ZEDA 3KKWA 1RXTA 1YMEA 3MN8A 1KUVA 3SHPA 3R9EA 2LGRA 3KR4A 2PIZA 2PJCA 3PB9X 3S9MA 5CPAA 3KQZA 3IO1A 1LAPA 1TXZA 5IB0A 4JXRA 2WYRA 4FBEA 3R9GA 2IMOA 1JWQA 4IHMA 4PK2A 4PV6A 4UCMA 3WABA 2FS5A 2J8NA 1CJWA 3P2FA 4ZX9A 1CP6A 3CT9A 4FD5A 5H84A 2JEVA 4P4EA 5LYIA 3D8PA 5FSUA 3SJXA 3PZJA 1CPXA 2YNDA 4UWIA 2AFUA 1QSNA 4F9VA 1N71A 4UBRA 3G3SA 1YQEA 1YK3A 3PFEA 2PJ4A 5A28A 3GY9A 1YSJA 2ZW6A 3B3WA 3GUXA 3R1KA 3LODA 2OH1A 2Q7BA 4P4FA 2B4DB 4R57A 5FSXA 3RYOA 2NSMA 2D4OA 5DUSA 2HQYA 3SXOA 4MHNA 2B4DA 3R9FA 3IWWA 1KWMA 5EC4A 2RC4A 4BMHA 4P4JA 2QIRA 2O28A 2PQ8A 3F8KA 5D8NA 3DR6A 4UEEA 5AG4A 4P4IA 4R9MA 4J3GA 5EBVA 1AYEA 4OMEA 3WT4A 2F8HA 2XEJA 4KSIA 3IC1A 3I1UA 3CXPA 3FJUA 4EFDA 2FXFA 4MFKA 2DEAA 3PB4X 1XMTA 3EW5A 4KOUA 5CB5A 1NSLA 5CMSA 2PC1A 3FF3A 2ODFA 2VI7A 4IAVA 8CPAA 3TFYA 4CAXA 3B3VA 4UF4A 4CYOA 3CXSA 4OP4A 3TE4A 1ZG9A 1HEEA 2G0BA 4JZ0A 3SI2A 5JQ4A 4A30A 1S7FA 3GYAA 1Z8LA 4P4DA 2AJ6A 2L8RA 1YLOA 2Z10A 3L2NA 4GS4A 2AFOA 4HNYB 4K30A 4BD9A 1FNOA 2Q04A 4NJQA 4CYPA 1BO4A 1SQHA 5JGFA 3IIFA 4RUHA 2BOAA 4KSAA 4P45A 3Q6ZA 4MFQA 3C26A 4IK2A 3PFOA 4RN7A 1MJBA 1HDUA 4H6UA 3V38A 4PPZA 4U9YA 2A4NA 4KLWA 4CYQA 3S6FA 4MI4A 3SJGA 2J9AA 4HNXB 4OC4A 1A2ZA 4E0AA 4DYOA 4B6ZA 1EE3P 3EKEA 2QMLA 1CBXA 2ZELA 3F5BA 1H8LA 4DNCA 4CYNA 2FE7A 5AILA 5IX3A 2CTBA 2P6GA 4PXEA 4P4BA 2GIVA 5HH1A 2IJZA 2FAVA 2R1IA 3BJ8A 3FEEA 1VIXA 4UCPA 4II9A 3DSBA 2PIYA 1M4DA 4ZI6A 4KOWA 4CAVA 1NJRA 4YRHA 4J5SA 3D7HA 4L8AA 1Y7RA 2YNEA 1UWYA 1TIQA 3D4UA 4GVWA 1WK4A 5FSZA 1PU9A 5HIHA 5AG5A 3PBBA 4CRYB 2EUIA 2VZYA 3BI1A 4XNHC 5DWMA 1CG2A 1R57A 5LYDA 4R76A 4QVTA 1TKFA 1Z8TA 3V8IA 5KTCA 2PJ1A 4YU9A 5KTDA 3IWGA 2P0WA 3PP9A 1YR0A 3F0AA 3SI1A 3HUVA 2NMTA 4B12A 5E3BA 4K3NA 3FXTA 3GQEA 4CS0B 2FG1A 1RO5A 3RZAA 4X3RA 1IB1E 2Z3OA 1LANA 2OZUA 2ZEFA 3FNCA 2PJ5A 3BLNA 5CB3A 4KOYA 4DUKA 4MXUA 3CZXA 1M4IA 4UFXA 4Y49C 4CAEA 2ZEEA 5EMIA 2FCKA 4JVVA 3PB7X 2QJ8A 4MRIA 2PJ2A 4M6GA 1S5KA 1M4LA 1XMBA 2AFXA 2JLMA 3D7FA 4H89A 5LYFA 4JLLA 3VWEA 5BWAB 1TKJA 3K9TA 3NH8A 3NH5A 3N7ZA 5FSYA 4P10A 5KTAA 2Z11A 4Q7AA 4AB7A 3VARA 3IFEA 2AFCA 1IOFA 1CX8A 2CIJA 1XOVA 2EBJA 4AVBA 4B13A 1YW4A 5K8PA 2V77A 5HVFA 3RO0A 3CPXA 2G3TA 2ZW5A 3VFQA 1F2OA 3CDXA 2Z3NA 4XNHB 2ZEOA 4KORA 1TF9A 4X8IA 2ZW4A 3FECA 4XPKA 2C6CA 5K8OA 3D7DA 1FY7A 3D2MA 4LQGA 1NMTA 1Z5RA 3NH4A 3ETIA 3PB6X 2REFA 4OADA 2QECA 4MY3A 2GE3A 3EO4A 3DDDA 3FVLA 1ELMP 3LMSA 3GIUA 4A37A 1BLLE 1IGBA 4ESSA 2XEGA 3RNZA 3GPOA 2FL4A 2HB6A 4QB9A 4KVME 3H8EA 3DNSA 4PXDA 3FB3A 2G3AA 1FT7A 2EK8A 3EFAA 3ISZA 4P44A 2XD7A 1Z9UA 2X7BA 2V8DA 2ZENA 4LUAA 4ZBGA 2K5TA 3TO9A 4OIDA 2RB7A 4OKOA 2V8HA 4MMOA 4EVYA 4IQYA 3K2KA 1KUYA 1Z8XA 3D66A 5JPHA 2DPSA 4Z65A 5G1ZA 2KQVA 3EWPA 4ZY1A 1K4JA 2PJ8A 4CGMA 2PR1A 4MBUA 4B10A 2F5IA 4F6AA 1ZG8A 1R3NA 4NGNA 3IEHA 2Q44A 4NGMA 1MJ9A 2QYVA 1X10A 4PK3A 2PJ9A 4UCNA 4MCRA 4YFJA 2GREA 2H5MA 1Y7EA 4KS9A 2PJAA 2ZOGA 4LX9A 4UFVA 4M6IA 4F0YA 2WSAA 2FIAA 2AFMA 3FIXA 1QSTA 5GCNA 3TO7A 2HUZA 2JZFA 1VGYA 1HJZA 1TY8A 3GLJA 3EC4A 4J4ZA 3TX8A 3IWEA 4Q38A 5CBMA 4RI1A 5LRKA 4BINA 1R43A 1CM0A 4F8ZA 3FYNA 4UMLA 2JDDA 3R96A 3FX6A 1ARLA 4KOSA 5AG7A 1J4JA 1M44A 3EY5A 2BCOA 2JBKA 2B5GB 4D86A 5IB9A 2PRQA 1V0CA 4JYWA 3NA6A 1WWZA 4J5RA 2AFZA 2B5GA 3EWQA 1Z2LA 2VBQA 1Z4RA 3CPAA 2V8GA 2OZHA 3N5FA 4YGOA 4B14A 3QAYA 4FWUA 4ZGYB 2BO9A 4FD4A 3S6GA 4ABLA 2QVPA 5I0CA 1LOKA 1YW6A 3NE8A 1YREA 4U9ZA 4C2YA 3ISXA 1TKHA 4JWPA 3PBEA 1KUXA 4G1PA 2OR4A 4R7MA 1HDQA 4XPDC 1M1DA 4MHDA 2I00A 1X12A 3IGRA 2PVWA 3Q71A 4NGSA 4EMEA 4C2XA 2WZNA 4F0XA 1LRZA 1OBRA 2ZW7A 1Q2YA 2YNCC 1XF8A 2BL1A 3D3SA 4UIAA 3TO6A 2VQYA 4R3LA 4CRZB 2PRBA 3KQXA 1QMUA 5JM6A 2Q4VA 4UEFA 4CGOA 1BAVA 3SJEA 2GU2A 2V8VA 4MFPA 2GANA 2VRIA 3FRMA 2Q43A 3W6SA 2Q0YA 3K9UA 4KYBA 2Q7SA 3KI9A 1MJAA 5JH9A 4CGLA 4AXVA 3E0KA 4R87A 1LFWA 2NYQA 4IF5A 4L89A 4NF1A 2BFQA 4B11A 2G9DA 6CPAA 4MHPA 2XEFA 1XRYA 4KOTA 1DTDA 4JD6A 4PXCA 2DXQA 2BSWA 3D68A 4R3KA 5LRGA 5DS0A 3GPGA 2J8MA 1GHEA 4MFJA 1U6MA 2DF5A 1CP7A 3TOAA 1Z4EA 3I9SA 4OIWA 4RS2A 4ONWA 4XPLA 3UY5A 1Z8WA 4KVXA 4H2KA 1P0HA 3PEIA 1LAMA 4M6HA 1LCPA 3TC8A 1ZG7A 4CGPA 4XPDB 1Q2CA 3EWRA 1PUAA 1F2PA 3P2HA 1S60A 4X2TA 4O23A 2PVVA 4ZY0A 1B6BA 5F09A 1IU8A 2HC9A 4JJXA 4QC6A 4B5PA 2C6GA 2FSRA 3KHZA 1YD9A 4NEXA 2YNCA 4W9YA 1ARMA 1IIDA 2ATRA 5HVGA 2I79A 4ETKA 1M4GA 5F48A 1NE9A 2CNMA 1TF8A 1I12A 4TNUA 3B2YA 4HNWB 2CTCA 2ARHA 2Q51A 4UEZA 3EXNA 4UWJA 3S9LA 4I49A 3WC7A 4Q36A 2WPWA 3H8FA 3B35A 1S3ZA 1Q7LA 1XFOA 1AMPA 2BUEA 2CXAA 2PJ6A 4FD6A 3IU1A 1VKCA 2PJ0A 2VL1A 3IJ3A 3NE7A 3OWCA 4OC1A 5D29A 5H86A 5THWA 3B8GA 3BI0A 3VWDA 5F49A 4A2ZA 1ELLP 4NGQA 1NSAA 2ZEHA 3V7ZA 2OZGA 2VXKA 1I21A 1F57A 3B3TA 4KOVA 1BPNA 1UFHA 2REEA 1BOBA 5K8MA 1XE4A 5ISVA 4J5QA 2POKA 3KGQA 4Y49B 3LD2A 3RBUA 3EJGA 3T90A 2DX6A 1QQ9A 1QSMA 1S7KA 4KZTA 1DE4C 4A33A 3SJFA 5FSVA 2FIWA 4OC2A 4AG9A 1PCAA 5LRJA 2ACFA 2JZEA 4JLYA 4CAFA 1ZLHA 5G22A 4KUAA 4ZY2A 2HV2A 2R8VA 2J8RA 5F47A 4CAWA 1KZFA 4ZYQA 3PGPA 3NFZA 1IY7A 5HMNA 4ETJA 3W6XA 3LACA 4P6YA 3TT2A 2P6EA 2ANPA 2OU2A 4KOXA 3H8GA 4JGKA 1VHSA 5CNPA 4ONUA 4K0CA 3V45A 2C6PA 2R98A 4JXQA 3WR7A 1YX0A 4E8OA 3EWOA 4C7IA 3KZWA 4R8FA 4H6ZA 3SIJA 3SIGA 3BXMA 4UA3A 5A27A 4IUSA 2B3UA 2BFRA 2FVGA 2PSWA 3KL9A 5AGEA 5HXDA 4M3SA 3QNVA 1Y0YA 3H4QA 2WPXA 3HLPA 1YLEA 1VHUA 4FD7A 2ABZA 4E2AA 1ZLIA 2PCUA 2B58A 1Y9KA 3QAHA 2B3VA 3WC5A 1MK4A 2Q4YA 3WC6A 4JCAA 3ZZIA 2FXKA 1BPMA 4PSWA 4DJLA 1CPSA 4KVOE 4CGNA 2CF4A 2OOTA 2JEWA 2EK9A 4KUBA 1ZO0A 4NGPA 4QUSA 4NSQA 4YWYA 4C2ZA 3FBUA 3TCVA 3JUWA 1JQGA 3DLJA 1Q2DA 3BHXA 4AVAA 3S9NA 3D7GA 4OC0A 7CPAA 5IV0A 3PB8X 2GFQA 3DGVA 5LYLA 2AFSA 4R6TA 2YGWA 3MRUA 3S6KA 3T9YA 4GVVA 4MCQA 2O4HA 2Z3PA 1L0CA 1Y0RA 1VHEA 4ABKA 4MHZA 4MY0A 1P4NA 3DR8A 4WJBA 5HOLA 4KSFA 3ZJ0A 3VH9A 2JZDA 2ZEPA 1ZR3A 3B7IA 3RAMA 1S7NA 2VEZA 3D2PA 3FH4A 3V2BA 1ON0A 2CNTA 3EJFA 4OC3A 5ELYA 2Z3MA 5C82A 2CY2A 2OB0A 2W2GA 2PDOA 2Q4ZA 2Y0MA 2B4BA 4NCZA 5G20A 2I3CA 2EVNA 4MFLA 4KLVA 1XJOA 3QB8A 2PE3A 3S6HA 2CNSA 1IYLA 3FMCA 1GYTA 3G8WA 2PJ7A 3IIBA 3JVNA 2RNKA 3GPQA 1YVKA 3SIHA 1SPVA 1YVOA 3I3GA 1S7LA 4HKFA 4OC5A 3TTHA 3JZTA 1IOIA 5DWNA 5FVJA 2IL4A 4WWVA 5G21A 4A94A 5HVHA 5E96A 2ZEMA 3PRTA 1VHOA 3IU2A 4CPAA 4FAIA 2ZOFA 3GKRA 4C7HA 2XEIA 1B87A 2Z0ZA 3W91A 2JDCA 1PYTB 5F46A 4LQ6A 2F7VA 4F9UA 4BBHA 5I4MA 2ZPAA 4NFRA 2ZEGA 2PJBA 2IQ6A 2EO8A 4FUUA 1XBUA 2VZZA 1QSRA 3KHXA 4HPSA 2GLFA 2PJ3A 2P6FA 4UIBA 2C27A 3LWUA 2C1CA 4A38A 2JBJA 2EWBA 2RFHA 3IIDA 3R95A 4QBJA 2GLJA 3B3CA 2X47A 2Z3KA 1IICA 4NGTA 4M85A
chains in the Genus database with same CATH topology
5J1QA 4EWTA 5K8NA 3T8WA 4NGRA 4ZX8A 4GUAA 4MCPA 2EEEA 1RTQA 4TWEA 4TU0A 2AFWA 3D67A 3KASA 4GM5A 3SI0A 3JRUA 3GQOA 3GB0A 4PXBA 3SIIA 4PQAA 3B3SA 4A39A 3KR5A 1TXRA 4NJRA 2O53A 1ZR5A 4MHYA 3FEDA 3VATA 4MCSA 2ZEDA 1YMEA 3MN8A 2LGRA 3KR4A 2PIZA 2PJCA 3PB9X 3S9MA 5CPAA 3KQZA 3IO1A 1LAPA 1TXZA 2WYRA 4FBEA 2IMOA 4IHMA 3WABA 5LYIA 4ZX9A 1CP6A 3CT9A 5JGFA 4P4EA 3SJXA 5FSUA 1CPXA 2AFUA 4F9VA 3PFEA 2PJ4A 1YSJA 3B3WA 3GUXA 4P4FA 5FSXA 2NSMA 5DUSA 4MHNA 3IWWA 1KWMA 4P4JA 4UEEA 5D8NA 4P4IA 1AYEA 4OMEA 3WT4A 2F8HA 2XEJA 4KSIA 3IC1A 3I1UA 3FJUA 4EFDA 2DEAA 3PB4X 3EW5A 5CB5A 5CMSA 3FF3A 4IAVA 8CPAA 3B3VA 4UF4A 4OP4A 1ZG9A 1HEEA 4JZ0A 1Z8LA 2L8RA 1YLOA 3L2NA 2AFOA 4BD9A 1FNOA 4NJQA 3IIFA 4RUHA 2BOAA 4P45A 3Q6ZA 4IK2A 3PFOA 1HDUA 3V38A 4PPZA 3SJGA 2J9AA 4OC4A 4DYOA 4B6ZA 1EE3P 3EKEA 1CBXA 2ZELA 1H8LA 5AILA 2CTBA 4PXEA 4P4BA 2IJZA 2FAVA 3FEEA 1VIXA 2PIYA 4ZI6A 1NJRA 4J5SA 3D7HA 3TX8A 3D4UA 1UWYA 4GVWA 5FSZA 5HIHA 3PBBA 3BI1A 1CG2A 5LYDA 4R76A 1TKFA 2PJ1A 4YU9A 3SI1A 3HUVA 5E3BA 4K3NA 3GQEA 2FG1A 3RZAA 4X3RA 1LANA 2ZEFA 2PJ5A 5CB3A 4DUKA 4MXUA 2ZEEA 4JVVA 3PB7X 2QJ8A 4MRIA 2PJ2A 1XMBA 1M4LA 2AFXA 3D7FA 5LYFA 4JLLA 1TKJA 3K9TA 3NH8A 3NH5A 5FSYA 4P10A 4Q7AA 3VARA 3IFEA 2AFCA 1CX8A 2CIJA 5K8PA 1YW4A 2V77A 5HVFA 3CPXA 3VFQA 1F2OA 3CDXA 2ZEOA 4X8IA 1TF9A 5K8OA 3FECA 2C6CA 3D7DA 4LQGA 1Z5RA 3NH4A 3ETIA 3PB6X 3FVLA 1ELMP 3LMSA 4A37A 2XEGA 1BLLE 1IGBA 4ESSA 3GPOA 2HB6A 3H8EA 4PXDA 4P4DA 3ISZA 1FT7A 2EK8A 4P44A 5HXDA 2XD7A 2V8DA 2ZENA 4OIDA 2RB7A 4OKOA 2V8HA 4MMOA 4IQYA 3K2KA 3D66A 4Z65A 3EWPA 4ZY1A 2PJ8A 1ZG8A 1R3NA 4NGNA 3IEHA 4NGMA 2QYVA 2PJ9A 4MCRA 2GREA 1Y7EA 2PJAA 2ZOGA 2AFMA 1VGYA 1HJZA 1TY8A 3GLJA 4J4ZA 5CBMA 5LRKA 1R43A 4F8ZA 4UMLA 3FX6A 1ARLA 2BCOA 2JBKA 5IB9A 4D86A 2PRQA 4JYWA 3NA6A 4J5RA 2AFZA 3EWQA 1Z2LA 3CPAA 2V8GA 3N5FA 4FWUA 2BO9A 4ABLA 2QVPA 1LOKA 1YW6A 3ISXA 1TKHA 3PBEA 4G1PA 2OR4A 4R7MA 1HDQA 2PVWA 3Q71A 4NGSA 4EMEA 2WZNA 4UIAA 1OBRA 3KQXA 1QMUA 5JM6A 4UEFA 1BAVA 3SJEA 2GU2A 2V8VA 2VRIA 2Q43A 3KI9A 4KYBA 5JH9A 4AXVA 1LFWA 2NYQA 2BFQA 2G9DA 6CPAA 4MHPA 2XEFA 1XRYA 4PXCA 1DTDA 3D68A 5LRGA 5DS0A 3GPGA 1CP7A 4OIWA 4ONWA 4H2KA 3PEIA 1LAMA 3TC8A 1LCPA 1ZG7A 3EWRA 1F2PA 4X2TA 4O23A 2PVVA 4ZY0A 5F09A 2HC9A 2C6GA 3KHZA 4W9YA 1YD9A 5HVGA 1ARMA 4ETKA 1TF8A 4TNUA 3B2YA 2CTCA 2Q51A 4UEZA 3S9LA 3WC7A 3H8FA 3B35A 1Q7LA 1XFOA 1AMPA 2PJ6A 2PJ0A 2VL1A 3IJ3A 4OC1A 5D29A 5THWA 3BI0A 1ELLP 4NGQA 1NSAA 2ZEHA 3V7ZA 1F57A 3B3TA 1BPNA 5K8MA 4J5QA 2POKA 3KGQA 3RBUA 3EJGA 2DX6A 1QQ9A 1DE4C 3SJFA 5FSVA 4OC2A 1PCAA 5LRJA 2ACFA 1ZLHA 4ZY2A 4ZYQA 3NFZA 1IY7A 4ETJA 4P6YA 2ANPA 3H8GA 4JGKA 4K0CA 3V45A 2C6PA 3EWOA 3KZWA 4R8FA 3SIJA 3SIGA 3BXMA 2BFRA 2FVGA 3KL9A 3QNVA 1Y0YA 3HLPA 1VHUA 2ABZA 1ZLIA 2PCUA 3WC5A 3WC6A 4JCAA 2FXKA 1BPMA 4DJLA 1CPSA 2CF4A 2OOTA 2JEWA 2EK9A 4NGPA 4YWYA 1JQGA 3DLJA 3BHXA 3S9NA 3D7GA 4OC0A 7CPAA 3PB8X 3DGVA 5LYLA 2AFSA 4R6TA 3MRUA 4GVVA 4MCQA 2O4HA 1Y0RA 4MHZA 1VHEA 4ABKA 4WJBA 5HOLA 3VH9A 2ZEPA 1ZR3A 3B7IA 3RAMA 3FH4A 3V2BA 4OC3A 3EJFA 5ELYA 2Q4ZA 2I3CA 1XJOA 2PE3A 3FMCA 1GYTA 2PJ7A 3IIBA 3GPQA 3SIHA 1SPVA 4OC5A 3JZTA 4A94A 4WWVA 5HVHA 2ZEMA 3PRTA 1VHOA 4CPAA 4FAIA 2ZOFA 2XEIA 1PYTB 2F7VA 4F9UA 5I4MA 4NFRA 2ZEGA 2PJBA 2IQ6A 4FUUA 1XBUA 3KHXA 2GLFA 2PJ3A 4UIBA 3LWUA 2C1CA 4A38A 2JBJA 2EWBA 2RFHA 3IIDA 2GLJA 3B3CA 2X47A 3SI2A 4NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Q A;  4EWT A;  5K8N A;  3T8W A;  4NGR A;  4ZX8 A;  4GUA A;  4MCP A;  2EEE A;  1RTQ A;  4TWE A;  4TU0 A;  2AFW A;  3D67 A;  3KAS A;  4GM5 A;  3SI0 A;  3JRU A;  3GQO A;  3GB0 A;  4PXB A;  3SII A;  4PQA A;  3B3S A;  4A39 A;  3KR5 A;  1TXR A;  4NJR A;  2O53 A;  1ZR5 A;  4MHY A;  3FED A;  3VAT A;  4MCS A;  2ZED A;  1YME A;  3MN8 A;  2LGR A;  3KR4 A;  2PIZ A;  2PJC A;  3PB9 X;  3S9M A;  5CPA A;  3KQZ A;  3IO1 A;  1LAP A;  1TXZ A;  2WYR A;  4FBE A;  2IMO A;  4IHM A;  3WAB A;  5LYI A;  4ZX9 A;  1CP6 A;  3CT9 A;  5JGF A;  4P4E A;  3SJX A;  5FSU A;  1CPX A;  2AFU A;  4F9V A;  3PFE A;  2PJ4 A;  1YSJ A;  3B3W A;  3GUX A;  4P4F A;  5FSX A;  2NSM A;  5DUS A;  4MHN A;  3IWW A;  1KWM A;  4P4J A;  4UEE A;  5D8N A;  4P4I A;  1AYE A;  4OME A;  3WT4 A;  2F8H A;  2XEJ A;  4KSI A;  3IC1 A;  3I1U A;  3FJU A;  4EFD A;  2DEA A;  3PB4 X;  3EW5 A;  5CB5 A;  5CMS A;  3FF3 A;  4IAV A;  8CPA A;  3B3V A;  4UF4 A;  4OP4 A;  1ZG9 A;  1HEE A;  4JZ0 A;  1Z8L A;  2L8R A;  1YLO A;  3L2N A;  2AFO A;  4BD9 A;  1FNO A;  4NJQ A;  3IIF A;  4RUH A;  2BOA A;  4P45 A;  3Q6Z A;  4IK2 A;  3PFO A;  1HDU A;  3V38 A;  4PPZ A;  3SJG A;  2J9A A;  4OC4 A;  4DYO A;  4B6Z A;  1EE3 P;  3EKE A;  1CBX A;  2ZEL A;  1H8L A;  5AIL A;  2CTB A;  4PXE A;  4P4B A;  2IJZ A;  2FAV A;  3FEE A;  1VIX A;  2PIY A;  4ZI6 A;  1NJR A;  4J5S A;  3D7H A;  3TX8 A;  3D4U A;  1UWY A;  4GVW A;  5FSZ A;  5HIH A;  3PBB A;  3BI1 A;  1CG2 A;  5LYD A;  4R76 A;  1TKF A;  2PJ1 A;  4YU9 A;  3SI1 A;  3HUV A;  5E3B A;  4K3N A;  3GQE A;  2FG1 A;  3RZA A;  4X3R A;  1LAN A;  2ZEF A;  2PJ5 A;  5CB3 A;  4DUK A;  4MXU A;  2ZEE A;  4JVV A;  3PB7 X;  2QJ8 A;  4MRI A;  2PJ2 A;  1XMB A;  1M4L A;  2AFX A;  3D7F A;  5LYF A;  4JLL A;  1TKJ A;  3K9T A;  3NH8 A;  3NH5 A;  5FSY A;  4P10 A;  4Q7A A;  3VAR A;  3IFE A;  2AFC A;  1CX8 A;  2CIJ A;  5K8P A;  1YW4 A;  2V77 A;  5HVF A;  3CPX A;  3VFQ A;  1F2O A;  3CDX A;  2ZEO A;  4X8I A;  1TF9 A;  5K8O A;  3FEC A;  2C6C A;  3D7D A;  4LQG A;  1Z5R A;  3NH4 A;  3ETI A;  3PB6 X;  3FVL A;  1ELM P;  3LMS A;  4A37 A;  2XEG A;  1BLL E;  1IGB A;  4ESS A;  3GPO A;  2HB6 A;  3H8E A;  4PXD A;  4P4D A;  3ISZ A;  1FT7 A;  2EK8 A;  4P44 A;  5HXD A;  2XD7 A;  2V8D A;  2ZEN A;  4OID A;  2RB7 A;  4OKO A;  2V8H A;  4MMO A;  4IQY A;  3K2K A;  3D66 A;  4Z65 A;  3EWP A;  4ZY1 A;  2PJ8 A;  1ZG8 A;  1R3N A;  4NGN A;  3IEH A;  4NGM A;  2QYV A;  2PJ9 A;  4MCR A;  2GRE A;  1Y7E A;  2PJA A;  2ZOG A;  2AFM A;  1VGY A;  1HJZ A;  1TY8 A;  3GLJ A;  4J4Z A;  5CBM A;  5LRK A;  1R43 A;  4F8Z A;  4UML A;  3FX6 A;  1ARL A;  2BCO A;  2JBK A;  5IB9 A;  4D86 A;  2PRQ A;  4JYW A;  3NA6 A;  4J5R A;  2AFZ A;  3EWQ A;  1Z2L A;  3CPA A;  2V8G A;  3N5F A;  4FWU A;  2BO9 A;  4ABL A;  2QVP A;  1LOK A;  1YW6 A;  3ISX A;  1TKH A;  3PBE A;  4G1P A;  2OR4 A;  4R7M A;  1HDQ A;  2PVW A;  3Q71 A;  4NGS A;  4EME A;  2WZN A;  4UIA A;  1OBR A;  3KQX A;  1QMU A;  5JM6 A;  4UEF A;  1BAV A;  3SJE A;  2GU2 A;  2V8V A;  2VRI A;  2Q43 A;  3KI9 A;  4KYB A;  5JH9 A;  4AXV A;  1LFW A;  2NYQ A;  2BFQ A;  2G9D A;  6CPA A;  4MHP A;  2XEF A;  1XRY A;  4PXC A;  1DTD A;  3D68 A;  5LRG A;  5DS0 A;  3GPG A;  1CP7 A;  4OIW A;  4ONW A;  4H2K A;  3PEI A;  1LAM A;  3TC8 A;  1LCP A;  1ZG7 A;  3EWR A;  1F2P A;  4X2T A;  4O23 A;  2PVV A;  4ZY0 A;  5F09 A;  2HC9 A;  2C6G A;  3KHZ A;  4W9Y A;  1YD9 A;  5HVG A;  1ARM A;  4ETK A;  1TF8 A;  4TNU A;  3B2Y A;  2CTC A;  2Q51 A;  4UEZ A;  3S9L A;  3WC7 A;  3H8F A;  3B35 A;  1Q7L A;  1XFO A;  1AMP A;  2PJ6 A;  2PJ0 A;  2VL1 A;  3IJ3 A;  4OC1 A;  5D29 A;  5THW A;  3BI0 A;  1ELL P;  4NGQ A;  1NSA A;  2ZEH A;  3V7Z A;  1F57 A;  3B3T A;  1BPN A;  5K8M A;  4J5Q A;  2POK A;  3KGQ A;  3RBU A;  3EJG A;  2DX6 A;  1QQ9 A;  1DE4 C;  3SJF A;  5FSV A;  4OC2 A;  1PCA A;  5LRJ A;  2ACF A;  1ZLH A;  4ZY2 A;  4ZYQ A;  3NFZ A;  1IY7 A;  4ETJ A;  4P6Y A;  2ANP A;  3H8G A;  4JGK A;  4K0C A;  3V45 A;  2C6P A;  3EWO A;  3KZW A;  4R8F A;  3SIJ A;  3SIG A;  3BXM A;  2BFR A;  2FVG A;  3KL9 A;  3QNV A;  1Y0Y A;  3HLP A;  1VHU A;  2ABZ A;  1ZLI A;  2PCU A;  3WC5 A;  3WC6 A;  4JCA A;  2FXK A;  1BPM A;  4DJL A;  1CPS A;  2CF4 A;  2OOT A;  2JEW A;  2EK9 A;  4NGP A;  4YWY A;  1JQG A;  3DLJ A;  3BHX A;  3S9N A;  3D7G A;  4OC0 A;  7CPA A;  3PB8 X;  3DGV A;  5LYL A;  2AFS A;  4R6T A;  3MRU A;  4GVV A;  4MCQ A;  2O4H A;  1Y0R A;  4MHZ A;  1VHE A;  4ABK A;  4WJB A;  5HOL A;  3VH9 A;  2ZEP A;  1ZR3 A;  3B7I A;  3RAM A;  3FH4 A;  3V2B A;  4OC3 A;  3EJF A;  5ELY A;  2Q4Z A;  2I3C A;  1XJO A;  2PE3 A;  3FMC A;  1GYT A;  2PJ7 A;  3IIB A;  3GPQ A;  3SIH A;  1SPV A;  4OC5 A;  3JZT A;  4A94 A;  4WWV A;  5HVH A;  2ZEM A;  3PRT A;  1VHO A;  4CPA A;  4FAI A;  2ZOF A;  2XEI A;  1PYT B;  2F7V A;  4F9U A;  5I4M A;  4NFR A;  2ZEG A;  2PJB A;  2IQ6 A;  4FUU A;  1XBU A;  3KHX A;  2GLF A;  2PJ3 A;  4UIB A;  3LWU A;  2C1C A;  4A38 A;  2JBJ A;  2EWB A;  2RFH A;  3IID A;  2GLJ A;  3B3C A;  2X47 A;  3SI2 A;  4NGT A; 
#chains in the Genus database with same CATH topology
 1Y9W A;  2BEI A;  5J1Q A;  2DPT A;  4B5P B;  4EWT A;  4NXY A;  2KCW A;  2ZXV A;  1AUG A;  4UFW A;  5K8N A;  4MFZ A;  1IYK A;  1YGH A;  2D4P A;  1XIX A;  3T8W A;  4U5Y A;  5C88 A;  4C68 A;  4NGR A;  3BJ7 A;  2PR8 A;  4B5O A;  4ZX8 A;  4GUA A;  4MCP A;  2EEE A;  1RTQ A;  4TWE A;  5J8C A;  4A32 A;  4TU0 A;  3MGD A;  4AVC A;  1XEB A;  2AFW A;  2R7H A;  3D67 A;  3KAS A;  4GM5 A;  4X5K A;  3JRU A;  3GQO A;  3SI0 A;  3CXQ A;  3GB0 A;  4PXB A;  4A95 A;  3SII A;  2WUU A;  4PQA A;  2WCT A;  2AE6 A;  3B3S A;  3H5Z A;  4ORF A;  4A39 A;  3KR5 A;  5AG6 A;  4AG7 A;  1TXR A;  4OLL A;  3TOB A;  4NJR A;  2O53 A;  1ZR5 A;  2Z3L A;  3SXN A;  5J8F A;  1QSO A;  1I1D A;  4PSX A;  4MJ8 A;  4A31 A;  4MHY A;  3FED A;  3VAT A;  1OZP A;  2FT0 A;  4OAE A;  4GXH A;  4MCS A;  3A9L A;  3JTK A;  2ZED A;  3KKW A;  1RXT A;  1YME A;  3MN8 A;  1KUV A;  3SHP A;  3R9E A;  2LGR A;  3KR4 A;  2PIZ A;  2PJC A;  3PB9 X;  3S9M A;  5CPA A;  3KQZ A;  3IO1 A;  1LAP A;  1TXZ A;  5IB0 A;  4JXR A;  2WYR A;  4FBE A;  3R9G A;  2IMO A;  1JWQ A;  4IHM A;  4PK2 A;  4PV6 A;  4UCM A;  3WAB A;  2FS5 A;  2J8N A;  1CJW A;  3P2F A;  4ZX9 A;  1CP6 A;  3CT9 A;  4FD5 A;  5H84 A;  2JEV A;  4P4E A;  5LYI A;  3D8P A;  5FSU A;  3SJX A;  3PZJ A;  1CPX A;  2YND A;  4UWI A;  2AFU A;  1QSN A;  4F9V A;  1N71 A;  4UBR A;  3G3S A;  1YQE A;  1YK3 A;  3PFE A;  2PJ4 A;  5A28 A;  3GY9 A;  1YSJ A;  2ZW6 A;  3B3W A;  3GUX A;  3R1K A;  3LOD A;  2OH1 A;  2Q7B A;  4P4F A;  2B4D B;  4R57 A;  5FSX A;  3RYO A;  2NSM A;  2D4O A;  5DUS A;  2HQY A;  3SXO A;  4MHN A;  2B4D A;  3R9F A;  3IWW A;  1KWM A;  5EC4 A;  2RC4 A;  4BMH A;  4P4J A;  2QIR A;  2O28 A;  2PQ8 A;  3F8K A;  5D8N A;  3DR6 A;  4UEE A;  5AG4 A;  4P4I A;  4R9M A;  4J3G A;  5EBV A;  1AYE A;  4OME A;  3WT4 A;  2F8H A;  2XEJ A;  4KSI A;  3IC1 A;  3I1U A;  3CXP A;  3FJU A;  4EFD A;  2FXF A;  4MFK A;  2DEA A;  3PB4 X;  1XMT A;  3EW5 A;  4KOU A;  5CB5 A;  1NSL A;  5CMS A;  2PC1 A;  3FF3 A;  2ODF A;  2VI7 A;  4IAV A;  8CPA A;  3TFY A;  4CAX A;  3B3V A;  4UF4 A;  4CYO A;  3CXS A;  4OP4 A;  3TE4 A;  1ZG9 A;  1HEE A;  2G0B A;  4JZ0 A;  3SI2 A;  5JQ4 A;  4A30 A;  1S7F A;  3GYA A;  1Z8L A;  4P4D A;  2AJ6 A;  2L8R A;  1YLO A;  2Z10 A;  3L2N A;  4GS4 A;  2AFO A;  4HNY B;  4K30 A;  4BD9 A;  1FNO A;  2Q04 A;  4NJQ A;  4CYP A;  1BO4 A;  1SQH A;  5JGF A;  3IIF A;  4RUH A;  2BOA A;  4KSA A;  4P45 A;  3Q6Z A;  4MFQ A;  3C26 A;  4IK2 A;  3PFO A;  4RN7 A;  1MJB A;  1HDU A;  4H6U A;  3V38 A;  4PPZ A;  4U9Y A;  2A4N A;  4KLW A;  4CYQ A;  3S6F A;  4MI4 A;  3SJG A;  2J9A A;  4HNX B;  4OC4 A;  1A2Z A;  4E0A A;  4DYO A;  4B6Z A;  1EE3 P;  3EKE A;  2QML A;  1CBX A;  2ZEL A;  3F5B A;  1H8L A;  4DNC A;  4CYN A;  2FE7 A;  5AIL A;  5IX3 A;  2CTB A;  2P6G A;  4PXE A;  4P4B A;  2GIV A;  5HH1 A;  2IJZ A;  2FAV A;  2R1I A;  3BJ8 A;  3FEE A;  1VIX A;  4UCP A;  4II9 A;  3DSB A;  2PIY A;  1M4D A;  4ZI6 A;  4KOW A;  4CAV A;  1NJR A;  4YRH A;  4J5S A;  3D7H A;  4L8A A;  1Y7R A;  2YNE A;  1UWY A;  1TIQ A;  3D4U A;  4GVW A;  1WK4 A;  5FSZ A;  1PU9 A;  5HIH A;  5AG5 A;  3PBB A;  4CRY B;  2EUI A;  2VZY A;  3BI1 A;  4XNH C;  5DWM A;  1CG2 A;  1R57 A;  5LYD A;  4R76 A;  4QVT A;  1TKF A;  1Z8T A;  3V8I A;  5KTC A;  2PJ1 A;  4YU9 A;  5KTD A;  3IWG A;  2P0W A;  3PP9 A;  1YR0 A;  3F0A A;  3SI1 A;  3HUV A;  2NMT A;  4B12 A;  5E3B A;  4K3N A;  3FXT A;  3GQE A;  4CS0 B;  2FG1 A;  1RO5 A;  3RZA A;  4X3R A;  1IB1 E;  2Z3O A;  1LAN A;  2OZU A;  2ZEF A;  3FNC A;  2PJ5 A;  3BLN A;  5CB3 A;  4KOY A;  4DUK A;  4MXU A;  3CZX A;  1M4I A;  4UFX A;  4Y49 C;  4CAE A;  2ZEE A;  5EMI A;  2FCK A;  4JVV A;  3PB7 X;  2QJ8 A;  4MRI A;  2PJ2 A;  4M6G A;  1S5K A;  1M4L A;  1XMB A;  2AFX A;  2JLM A;  3D7F A;  4H89 A;  5LYF A;  4JLL A;  3VWE A;  5BWA B;  1TKJ A;  3K9T A;  3NH8 A;  3NH5 A;  3N7Z A;  5FSY A;  4P10 A;  5KTA A;  2Z11 A;  4Q7A A;  4AB7 A;  3VAR A;  3IFE A;  2AFC A;  1IOF A;  1CX8 A;  2CIJ A;  1XOV A;  2EBJ A;  4AVB A;  4B13 A;  1YW4 A;  5K8P A;  2V77 A;  5HVF A;  3RO0 A;  3CPX A;  2G3T A;  2ZW5 A;  3VFQ A;  1F2O A;  3CDX A;  2Z3N A;  4XNH B;  2ZEO A;  4KOR A;  1TF9 A;  4X8I A;  2ZW4 A;  3FEC A;  4XPK A;  2C6C A;  5K8O A;  3D7D A;  1FY7 A;  3D2M A;  4LQG A;  1NMT A;  1Z5R A;  3NH4 A;  3ETI A;  3PB6 X;  2REF A;  4OAD A;  2QEC A;  4MY3 A;  2GE3 A;  3EO4 A;  3DDD A;  3FVL A;  1ELM P;  3LMS A;  3GIU A;  4A37 A;  1BLL E;  1IGB A;  4ESS A;  2XEG A;  3RNZ A;  3GPO A;  2FL4 A;  2HB6 A;  4QB9 A;  4KVM E;  3H8E A;  3DNS A;  4PXD A;  3FB3 A;  2G3A A;  1FT7 A;  2EK8 A;  3EFA A;  3ISZ A;  4P44 A;  2XD7 A;  1Z9U A;  2X7B A;  2V8D A;  2ZEN A;  4LUA A;  4ZBG A;  2K5T A;  3TO9 A;  4OID A;  2RB7 A;  4OKO A;  2V8H A;  4MMO A;  4EVY A;  4IQY A;  3K2K A;  1KUY A;  1Z8X A;  3D66 A;  5JPH A;  2DPS A;  4Z65 A;  5G1Z A;  2KQV A;  3EWP A;  4ZY1 A;  1K4J A;  2PJ8 A;  4CGM A;  2PR1 A;  4MBU A;  4B10 A;  2F5I A;  4F6A A;  1ZG8 A;  1R3N A;  4NGN A;  3IEH A;  2Q44 A;  4NGM A;  1MJ9 A;  2QYV A;  1X10 A;  4PK3 A;  2PJ9 A;  4UCN A;  4MCR A;  4YFJ A;  2GRE A;  2H5M A;  1Y7E A;  4KS9 A;  2PJA A;  2ZOG A;  4LX9 A;  4UFV A;  4M6I A;  4F0Y A;  2WSA A;  2FIA A;  2AFM A;  3FIX A;  1QST A;  5GCN A;  3TO7 A;  2HUZ A;  2JZF A;  1VGY A;  1HJZ A;  1TY8 A;  3GLJ A;  3EC4 A;  4J4Z A;  3TX8 A;  3IWE A;  4Q38 A;  5CBM A;  4RI1 A;  5LRK A;  4BIN A;  1R43 A;  1CM0 A;  4F8Z A;  3FYN A;  4UML A;  2JDD A;  3R96 A;  3FX6 A;  1ARL A;  4KOS A;  5AG7 A;  1J4J A;  1M44 A;  3EY5 A;  2BCO A;  2JBK A;  2B5G B;  4D86 A;  5IB9 A;  2PRQ A;  1V0C A;  4JYW A;  3NA6 A;  1WWZ A;  4J5R A;  2AFZ A;  2B5G A;  3EWQ A;  1Z2L A;  2VBQ A;  1Z4R A;  3CPA A;  2V8G A;  2OZH A;  3N5F A;  4YGO A;  4B14 A;  3QAY A;  4FWU A;  4ZGY B;  2BO9 A;  4FD4 A;  3S6G A;  4ABL A;  2QVP A;  5I0C A;  1LOK A;  1YW6 A;  3NE8 A;  1YRE A;  4U9Z A;  4C2Y A;  3ISX A;  1TKH A;  4JWP A;  3PBE A;  1KUX A;  4G1P A;  2OR4 A;  4R7M A;  1HDQ A;  4XPD C;  1M1D A;  4MHD A;  2I00 A;  1X12 A;  3IGR A;  2PVW A;  3Q71 A;  4NGS A;  4EME A;  4C2X A;  2WZN A;  4F0X A;  1LRZ A;  1OBR A;  2ZW7 A;  1Q2Y A;  2YNC C;  1XF8 A;  2BL1 A;  3D3S A;  4UIA A;  3TO6 A;  2VQY A;  4R3L A;  4CRZ B;  2PRB A;  3KQX A;  1QMU A;  5JM6 A;  2Q4V A;  4UEF A;  4CGO A;  1BAV A;  3SJE A;  2GU2 A;  2V8V A;  4MFP A;  2GAN A;  2VRI A;  3FRM A;  2Q43 A;  3W6S A;  2Q0Y A;  3K9U A;  4KYB A;  2Q7S A;  3KI9 A;  1MJA A;  5JH9 A;  4CGL A;  4AXV A;  3E0K A;  4R87 A;  1LFW A;  2NYQ A;  4IF5 A;  4L89 A;  4NF1 A;  2BFQ A;  4B11 A;  2G9D A;  6CPA A;  4MHP A;  2XEF A;  1XRY A;  4KOT A;  1DTD A;  4JD6 A;  4PXC A;  2DXQ A;  2BSW A;  3D68 A;  4R3K A;  5LRG A;  5DS0 A;  3GPG A;  2J8M A;  1GHE A;  4MFJ A;  1U6M A;  2DF5 A;  1CP7 A;  3TOA A;  1Z4E A;  3I9S A;  4OIW A;  4RS2 A;  4ONW A;  4XPL A;  3UY5 A;  1Z8W A;  4KVX A;  4H2K A;  1P0H A;  3PEI A;  1LAM A;  4M6H A;  1LCP A;  3TC8 A;  1ZG7 A;  4CGP A;  4XPD B;  1Q2C A;  3EWR A;  1PUA A;  1F2P A;  3P2H A;  1S60 A;  4X2T A;  4O23 A;  2PVV A;  4ZY0 A;  1B6B A;  5F09 A;  1IU8 A;  2HC9 A;  4JJX A;  4QC6 A;  4B5P A;  2C6G A;  2FSR A;  3KHZ A;  1YD9 A;  4NEX A;  2YNC A;  4W9Y A;  1ARM A;  1IID A;  2ATR A;  5HVG A;  2I79 A;  4ETK A;  1M4G A;  5F48 A;  1NE9 A;  2CNM A;  1TF8 A;  1I12 A;  4TNU A;  3B2Y A;  4HNW B;  2CTC A;  2ARH A;  2Q51 A;  4UEZ A;  3EXN A;  4UWJ A;  3S9L A;  4I49 A;  3WC7 A;  4Q36 A;  2WPW A;  3H8F A;  3B35 A;  1S3Z A;  1Q7L A;  1XFO A;  1AMP A;  2BUE A;  2CXA A;  2PJ6 A;  4FD6 A;  3IU1 A;  1VKC A;  2PJ0 A;  2VL1 A;  3IJ3 A;  3NE7 A;  3OWC A;  4OC1 A;  5D29 A;  5H86 A;  5THW A;  3B8G A;  3BI0 A;  3VWD A;  5F49 A;  4A2Z A;  1ELL P;  4NGQ A;  1NSA A;  2ZEH A;  3V7Z A;  2OZG A;  2VXK A;  1I21 A;  1F57 A;  3B3T A;  4KOV A;  1BPN A;  1UFH A;  2REE A;  1BOB A;  5K8M A;  1XE4 A;  5ISV A;  4J5Q A;  2POK A;  3KGQ A;  4Y49 B;  3LD2 A;  3RBU A;  3EJG A;  3T90 A;  2DX6 A;  1QQ9 A;  1QSM A;  1S7K A;  4KZT A;  1DE4 C;  4A33 A;  3SJF A;  5FSV A;  2FIW A;  4OC2 A;  4AG9 A;  1PCA A;  5LRJ A;  2ACF A;  2JZE A;  4JLY A;  4CAF A;  1ZLH A;  5G22 A;  4KUA A;  4ZY2 A;  2HV2 A;  2R8V A;  2J8R A;  5F47 A;  4CAW A;  1KZF A;  4ZYQ A;  3PGP A;  3NFZ A;  1IY7 A;  5HMN A;  4ETJ A;  3W6X A;  3LAC A;  4P6Y A;  3TT2 A;  2P6E A;  2ANP A;  2OU2 A;  4KOX A;  3H8G A;  4JGK A;  1VHS A;  5CNP A;  4ONU A;  4K0C A;  3V45 A;  2C6P A;  2R98 A;  4JXQ A;  3WR7 A;  1YX0 A;  4E8O A;  3EWO A;  4C7I A;  3KZW A;  4R8F A;  4H6Z A;  3SIJ A;  3SIG A;  3BXM A;  4UA3 A;  5A27 A;  4IUS A;  2B3U A;  2BFR A;  2FVG A;  2PSW A;  3KL9 A;  5AGE A;  5HXD A;  4M3S A;  3QNV A;  1Y0Y A;  3H4Q A;  2WPX A;  3HLP A;  1YLE A;  1VHU A;  4FD7 A;  2ABZ A;  4E2A A;  1ZLI A;  2PCU A;  2B58 A;  1Y9K A;  3QAH A;  2B3V A;  3WC5 A;  1MK4 A;  2Q4Y A;  3WC6 A;  4JCA A;  3ZZI A;  2FXK A;  1BPM A;  4PSW A;  4DJL A;  1CPS A;  4KVO E;  4CGN A;  2CF4 A;  2OOT A;  2JEW A;  2EK9 A;  4KUB A;  1ZO0 A;  4NGP A;  4QUS A;  4NSQ A;  4YWY A;  4C2Z A;  3FBU A;  3TCV A;  3JUW A;  1JQG A;  3DLJ A;  1Q2D A;  3BHX A;  4AVA A;  3S9N A;  3D7G A;  4OC0 A;  7CPA A;  5IV0 A;  3PB8 X;  2GFQ A;  3DGV A;  5LYL A;  2AFS A;  4R6T A;  2YGW A;  3MRU A;  3S6K A;  3T9Y A;  4GVV A;  4MCQ A;  2O4H A;  2Z3P A;  1L0C A;  1Y0R A;  1VHE A;  4ABK A;  4MHZ A;  4MY0 A;  1P4N A;  3DR8 A;  4WJB A;  5HOL A;  4KSF A;  3ZJ0 A;  3VH9 A;  2JZD A;  2ZEP A;  1ZR3 A;  3B7I A;  3RAM A;  1S7N A;  2VEZ A;  3D2P A;  3FH4 A;  3V2B A;  1ON0 A;  2CNT A;  3EJF A;  4OC3 A;  5ELY A;  2Z3M A;  5C82 A;  2CY2 A;  2OB0 A;  2W2G A;  2PDO A;  2Q4Z A;  2Y0M A;  2B4B A;  4NCZ A;  5G20 A;  2I3C A;  2EVN A;  4MFL A;  4KLV A;  1XJO A;  3QB8 A;  2PE3 A;  3S6H A;  2CNS A;  1IYL A;  3FMC A;  1GYT A;  3G8W A;  2PJ7 A;  3IIB A;  3JVN A;  2RNK A;  3GPQ A;  1YVK A;  3SIH A;  1SPV A;  1YVO A;  3I3G A;  1S7L A;  4HKF A;  4OC5 A;  3TTH A;  3JZT A;  1IOI A;  5DWN A;  5FVJ A;  2IL4 A;  4WWV A;  5G21 A;  4A94 A;  5HVH A;  5E96 A;  2ZEM A;  3PRT A;  1VHO A;  3IU2 A;  4CPA A;  4FAI A;  2ZOF A;  3GKR A;  4C7H A;  2XEI A;  1B87 A;  2Z0Z A;  3W91 A;  2JDC A;  1PYT B;  5F46 A;  4LQ6 A;  2F7V A;  4F9U A;  4BBH A;  5I4M A;  2ZPA A;  4NFR A;  2ZEG A;  2PJB A;  2IQ6 A;  2EO8 A;  4FUU A;  1XBU A;  2VZZ A;  1QSR A;  3KHX A;  4HPS A;  2GLF A;  2PJ3 A;  2P6F A;  4UIB A;  2C27 A;  3LWU A;  2C1C A;  4A38 A;  2JBJ A;  2EWB A;  2RFH A;  3IID A;  3R95 A;  4QBJ A;  2GLJ A;  3B3C A;  2X47 A;  2Z3K A;  1IIC A;  4NGT A;  4M85 A; 
#chains in the Genus database with same CATH homology
 5J1Q A;  4EWT A;  5K8N A;  3T8W A;  4NGR A;  4ZX8 A;  4GUA A;  4MCP A;  2EEE A;  1RTQ A;  4TWE A;  4TU0 A;  2AFW A;  3D67 A;  3KAS A;  4GM5 A;  3SI0 A;  3JRU A;  3GQO A;  3GB0 A;  4PXB A;  3SII A;  4PQA A;  3B3S A;  4A39 A;  3KR5 A;  1TXR A;  4NJR A;  2O53 A;  1ZR5 A;  4MHY A;  3FED A;  3VAT A;  4MCS A;  2ZED A;  1YME A;  3MN8 A;  2LGR A;  3KR4 A;  2PIZ A;  2PJC A;  3PB9 X;  3S9M A;  5CPA A;  3KQZ A;  3IO1 A;  1LAP A;  1TXZ A;  2WYR A;  4FBE A;  2IMO A;  4IHM A;  3WAB A;  5LYI A;  4ZX9 A;  1CP6 A;  3CT9 A;  5JGF A;  4P4E A;  3SJX A;  5FSU A;  1CPX A;  2AFU A;  4F9V A;  3PFE A;  2PJ4 A;  1YSJ A;  3B3W A;  3GUX A;  4P4F A;  5FSX A;  2NSM A;  5DUS A;  4MHN A;  3IWW A;  1KWM A;  4P4J A;  4UEE A;  5D8N A;  4P4I A;  1AYE A;  4OME A;  3WT4 A;  2F8H A;  2XEJ A;  4KSI A;  3IC1 A;  3I1U A;  3FJU A;  4EFD A;  2DEA A;  3PB4 X;  3EW5 A;  5CB5 A;  5CMS A;  3FF3 A;  4IAV A;  8CPA A;  3B3V A;  4UF4 A;  4OP4 A;  1ZG9 A;  1HEE A;  4JZ0 A;  1Z8L A;  2L8R A;  1YLO A;  3L2N A;  2AFO A;  4BD9 A;  1FNO A;  4NJQ A;  3IIF A;  4RUH A;  2BOA A;  4P45 A;  3Q6Z A;  4IK2 A;  3PFO A;  1HDU A;  3V38 A;  4PPZ A;  3SJG A;  2J9A A;  4OC4 A;  4DYO A;  4B6Z A;  1EE3 P;  3EKE A;  1CBX A;  2ZEL A;  1H8L A;  5AIL A;  2CTB A;  4PXE A;  4P4B A;  2IJZ A;  2FAV A;  3FEE A;  1VIX A;  2PIY A;  4ZI6 A;  1NJR A;  4J5S A;  3D7H A;  3TX8 A;  3D4U A;  1UWY A;  4GVW A;  5FSZ A;  5HIH A;  3PBB A;  3BI1 A;  1CG2 A;  5LYD A;  4R76 A;  1TKF A;  2PJ1 A;  4YU9 A;  3SI1 A;  3HUV A;  5E3B A;  4K3N A;  3GQE A;  2FG1 A;  3RZA A;  4X3R A;  1LAN A;  2ZEF A;  2PJ5 A;  5CB3 A;  4DUK A;  4MXU A;  2ZEE A;  4JVV A;  3PB7 X;  2QJ8 A;  4MRI A;  2PJ2 A;  1XMB A;  1M4L A;  2AFX A;  3D7F A;  5LYF A;  4JLL A;  1TKJ A;  3K9T A;  3NH8 A;  3NH5 A;  5FSY A;  4P10 A;  4Q7A A;  3VAR A;  3IFE A;  2AFC A;  1CX8 A;  2CIJ A;  5K8P A;  1YW4 A;  2V77 A;  5HVF A;  3CPX A;  3VFQ A;  1F2O A;  3CDX A;  2ZEO A;  4X8I A;  1TF9 A;  5K8O A;  3FEC A;  2C6C A;  3D7D A;  4LQG A;  1Z5R A;  3NH4 A;  3ETI A;  3PB6 X;  3FVL A;  1ELM P;  3LMS A;  4A37 A;  2XEG A;  1BLL E;  1IGB A;  4ESS A;  3GPO A;  2HB6 A;  3H8E A;  4PXD A;  4P4D A;  3ISZ A;  1FT7 A;  2EK8 A;  4P44 A;  5HXD A;  2XD7 A;  2V8D A;  2ZEN A;  4OID A;  2RB7 A;  4OKO A;  2V8H A;  4MMO A;  4IQY A;  3K2K A;  3D66 A;  4Z65 A;  3EWP A;  4ZY1 A;  2PJ8 A;  1ZG8 A;  1R3N A;  4NGN A;  3IEH A;  4NGM A;  2QYV A;  2PJ9 A;  4MCR A;  2GRE A;  1Y7E A;  2PJA A;  2ZOG A;  2AFM A;  1VGY A;  1HJZ A;  1TY8 A;  3GLJ A;  4J4Z A;  5CBM A;  5LRK A;  1R43 A;  4F8Z A;  4UML A;  3FX6 A;  1ARL A;  2BCO A;  2JBK A;  5IB9 A;  4D86 A;  2PRQ A;  4JYW A;  3NA6 A;  4J5R A;  2AFZ A;  3EWQ A;  1Z2L A;  3CPA A;  2V8G A;  3N5F A;  4FWU A;  2BO9 A;  4ABL A;  2QVP A;  1LOK A;  1YW6 A;  3ISX A;  1TKH A;  3PBE A;  4G1P A;  2OR4 A;  4R7M A;  1HDQ A;  2PVW A;  3Q71 A;  4NGS A;  4EME A;  2WZN A;  4UIA A;  1OBR A;  3KQX A;  1QMU A;  5JM6 A;  4UEF A;  1BAV A;  3SJE A;  2GU2 A;  2V8V A;  2VRI A;  2Q43 A;  3KI9 A;  4KYB A;  5JH9 A;  4AXV A;  1LFW A;  2NYQ A;  2BFQ A;  2G9D A;  6CPA A;  4MHP A;  2XEF A;  1XRY A;  4PXC A;  1DTD A;  3D68 A;  5LRG A;  5DS0 A;  3GPG A;  1CP7 A;  4OIW A;  4ONW A;  4H2K A;  3PEI A;  1LAM A;  3TC8 A;  1LCP A;  1ZG7 A;  3EWR A;  1F2P A;  4X2T A;  4O23 A;  2PVV A;  4ZY0 A;  5F09 A;  2HC9 A;  2C6G A;  3KHZ A;  4W9Y A;  1YD9 A;  5HVG A;  1ARM A;  4ETK A;  1TF8 A;  4TNU A;  3B2Y A;  2CTC A;  2Q51 A;  4UEZ A;  3S9L A;  3WC7 A;  3H8F A;  3B35 A;  1Q7L A;  1XFO A;  1AMP A;  2PJ6 A;  2PJ0 A;  2VL1 A;  3IJ3 A;  4OC1 A;  5D29 A;  5THW A;  3BI0 A;  1ELL P;  4NGQ A;  1NSA A;  2ZEH A;  3V7Z A;  1F57 A;  3B3T A;  1BPN A;  5K8M A;  4J5Q A;  2POK A;  3KGQ A;  3RBU A;  3EJG A;  2DX6 A;  1QQ9 A;  1DE4 C;  3SJF A;  5FSV A;  4OC2 A;  1PCA A;  5LRJ A;  2ACF A;  1ZLH A;  4ZY2 A;  4ZYQ A;  3NFZ A;  1IY7 A;  4ETJ A;  4P6Y A;  2ANP A;  3H8G A;  4JGK A;  4K0C A;  3V45 A;  2C6P A;  3EWO A;  3KZW A;  4R8F A;  3SIJ A;  3SIG A;  3BXM A;  2BFR A;  2FVG A;  3KL9 A;  3QNV A;  1Y0Y A;  3HLP A;  1VHU A;  2ABZ A;  1ZLI A;  2PCU A;  3WC5 A;  3WC6 A;  4JCA A;  2FXK A;  1BPM A;  4DJL A;  1CPS A;  2CF4 A;  2OOT A;  2JEW A;  2EK9 A;  4NGP A;  4YWY A;  1JQG A;  3DLJ A;  3BHX A;  3S9N A;  3D7G A;  4OC0 A;  7CPA A;  3PB8 X;  3DGV A;  5LYL A;  2AFS A;  4R6T A;  3MRU A;  4GVV A;  4MCQ A;  2O4H A;  1Y0R A;  4MHZ A;  1VHE A;  4ABK A;  4WJB A;  5HOL A;  3VH9 A;  2ZEP A;  1ZR3 A;  3B7I A;  3RAM A;  3FH4 A;  3V2B A;  4OC3 A;  3EJF A;  5ELY A;  2Q4Z A;  2I3C A;  1XJO A;  2PE3 A;  3FMC A;  1GYT A;  2PJ7 A;  3IIB A;  3GPQ A;  3SIH A;  1SPV A;  4OC5 A;  3JZT A;  4A94 A;  4WWV A;  5HVH A;  2ZEM A;  3PRT A;  1VHO A;  4CPA A;  4FAI A;  2ZOF A;  2XEI A;  1PYT B;  2F7V A;  4F9U A;  5I4M A;  4NFR A;  2ZEG A;  2PJB A;  2IQ6 A;  4FUU A;  1XBU A;  3KHX A;  2GLF A;  2PJ3 A;  4UIB A;  3LWU A;  2C1C A;  4A38 A;  2JBJ A;  2EWB A;  2RFH A;  3IID A;  2GLJ A;  3B3C A;  2X47 A;  3SI2 A;  4NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...