5CBMA

Crystal structure of pfa-m17 with virtual ligand inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
519
structure length
519
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 family aminopeptidase
publication title Identification and Validation of a Potent Dual Inhibitor of the P. falciparum M1 and M17 Aminopeptidases Using Virtual Screening.
pubmed doi rcsb
source organism Plasmodium falciparum vietnam oak-knoll (fvo)
molecule tags Hydrolase
total genus 175
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5cbmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5cbmA02
4A37A 2C6PA 2QYVA 2PIYA 4DJLA 3V2BA 3TC8A 3B3CA 4PXEA 4A94A 3KL9A 1XRYA 2PJ3A 5FSXA 2AFXA 3VARA 3B3TA 2ZEEA 3L2NA 1IGBA 4FWUA 2FG1A 3H8EA 4WJBA 4OC3A 2ZEHA 4KSIA 3H8GA 4UEZA 4TWEA 1Y0YA 2AFZA 3Q71A 1LAPA 4UEEA 5K8NA 4MHNA 1XMBA 3SI2A 7CPAA 4LQGA 2NSMA 4OC5A 1LANA 1Z8LA 3D7FA 3RAMA 2V8DA 2QJ8A 3SJFA 5LYFA 2V8HA 3PEIA 2L8RA 1CBXA 4OC0A 5HVHA 2EK8A 2PVVA 2ACFA 5LYIA 5LYLA 3PB8X 3PB4X 3KR4A 3ETIA 3GLJA 4UEFA 3PB6X 1TKFA 1VIXA 3EWQA 4AXVA 1LCPA 3D67A 1R43A 3PBBA 3PB7X 3LWUA 1ZG9A 3V7ZA 4H2KA 5HIHA 4UIAA 5CPAA 3JZTA 4EMEA 1VHUA 4OC1A 4ONWA 1NJRA 2J9AA 1TKHA 4P4EA 4FUUA 2BOAA 3CT9A 4F9UA 2F8HA 3IFEA 3WABA 5THWA 4P4IA 3NA6A 1HJZA 2FXKA 4MHYA 3KHXA 2CIJA 2G9DA 3T8WA 3SI1A 1KWMA 2PJ4A 3D4UA 2PJ5A 2FAVA 1HEEA 2AFUA 4ZY2A 5D29A 3FJUA 3DLJA 4MRIA 5I4MA 1YSJA 3D66A 2BO9A 4Q7AA 3SIIA 1R3NA 2AFWA 4OIWA 1F2OA 4KYBA 4GUAA 1VGYA 2NYQA 1CPSA 3KQZA 2EEEA 1ZR5A 4OIDA 2I3CA 1CG2A 2PJ9A 1CP6A 2ZEPA 4J4ZA 1LAMA 2ZEDA 4UF4A 3K2KA 2GREA 3PFEA 2PIZA 2PJ7A 1Z5RA 2XEGA 4WWVA 4K3NA 2O4HA 4DUKA 2C6CA 2ZEMA 5CMSA 3KI9A 4FAIA 2EWBA 3B35A 4R8FA 4X2TA 2BFRA 3IWWA 1BPNA 3NH5A 4CPAA 3BI1A 4MCQA 5AILA 3MN8A 3CPXA 3S9NA 1YMEA 4GVVA 1VHOA 1PYTB 2PVWA 5ELYA 6CPAA 3RBUA 2BFQA 3PFOA 4X3RA 5IB9A 3WC6A 1ARMA 3B3SA 3PBEA 5J1QA 3GQOA 2ZEOA 2GLJA 3ISXA 4A38A 4EFDA 4P45A 4ZY0A 3SIHA 4IQYA 3N5FA 3SJEA 4P4DA 4OC4A 2C6GA 4MCPA 2POKA 3DGVA 1DE4C 2AFOA 2PJCA 4P10A 3PB9X 4NGPA 5K8OA 2PJ8A 2HC9A 2F7VA 2VRIA 3NH8A 5FSUA 3S9MA 4NJQA 3TX8A 1VHEA 2DEAA 4NFRA 3BXMA 3K9TA 2XD7A 1RTQA 4P4JA 3V38A 2HB6A 2PJ6A 2AFSA 3D68A 2JBJA 3VH9A 2ANPA 3GQEA 4OC2A 4F8ZA 5FSZA 4J5QA 2VL1A 4PQAA 1LOKA 3VFQA 3VATA 4IHMA 4P44A 4DYOA 2PJ2A 4UMLA 5HXDA 2DX6A 1FNOA 3WT4A 4PXDA 2XEFA 4Z65A 4ZI6A 5LRJA 1BPMA 4ABKA 1CX8A 1TF9A 3GUXA 2V8GA 3RZAA 4ZY1A 3B7IA 2PE3A 4EWTA 3KQXA 4GM5A 4NGNA 1TKJA 1PCAA 2PCUA 3SIGA 2Q43A 4MHPA 4GVWA 5DS0A 3FH4A 3MRUA 3D7HA 5JM6A 4TNUA 4K0CA 4NGTA 1OBRA 4NGRA 1AMPA 3LMSA 5LYDA 2JEWA 2PJBA 3I1UA 1YLOA 1DTDA 1FT7A 4ETKA 3QNVA 3SIJA 3IIBA 4J5SA 2EK9A 3SI0A 2CF4A 5JH9A 3V45A 3FF3A 3KASA 4JYWA 1Q7LA 4NGMA 4MCRA 4YU9A 1QQ9A 2AFMA 2ZOFA 5HVFA 4IAVA 5K8MA 1ZG8A 1CPXA 2ZENA 3GPGA 1YD9A 1Z2LA 4OKOA 1SPVA 1TXRA 3EJFA 4P4BA 3IEHA 4JVVA 4G1PA 3IIDA 3IJ3A 3BI0A 4ESSA 2V77A 1ELLP 3B3WA 4JCAA 3B2YA 2Q51A 2CTBA 2ZOGA 2FVGA 4W9YA 2GLFA 2ABZA 5E3BA 2IMOA 3BHXA 4TU0A 4MMOA 3HUVA 1ELMP 3SJGA 1F57A 2ZEFA 1XBUA 2X47A 4P6YA 3B3VA 3KHZA 4R7MA 2ZELA 5FSYA 2BCOA 1TY8A 3FX6A 5CB5A 5LRGA 3EWPA 3GB0A 1ZG7A 1UWYA 1ZLIA 1QMUA 3S9LA 4R6TA 4RUHA 1HDUA 1JQGA 1IY7A 4J5RA 4OP4A 3EWOA 4OMEA 3EW5A 3NH4A 5HVGA 4PXBA 3ISZA 5CB3A 2RB7A 2O53A 3IC1A 3IO1A 3PRTA 4D86A 2XEJA 2WZNA 4X8IA 2PJ0A 1YW6A 4A39A 1ZLHA 4ABLA 4JZ0A 1HDQA 8CPAA 4IK2A 4MCSA 4O23A 2V8VA 3D7DA 2GU2A 2PJ1A 1ARLA 3IIFA 3KR5A 1Y7EA 2IQ6A 2LGRA 2RFHA 2Q4ZA 4NGSA 4FBEA 5FSVA 4JLLA 1TF8A 2CTCA 1LFWA 3KZWA 4JGKA 4R76A 4P4FA 4B6ZA 4PXCA 3FEDA 3JRUA 1CP7A 1EE3P 1Y0RA 3FVLA 4ZX9A 4MHZA 2PRQA 5K8PA 3FEEA 2WYRA 2C1CA 3EJGA 5D8NA 4UIBA 2OOTA 3WC5A 3EWRA 2XEIA 1AYEA 1H8LA 1GYTA 3GPQA 1XJOA 4BD9A 3SJXA 1XFOA 3NFZA 5LRKA 2AFCA 3H8FA 5DUSA 2OR4A 3HLPA 4YWYA 5F09A 1TXZA 3CDXA 1BLLE 1ZR3A 3D7GA 4ETJA 1YW4A 3EKEA 4F9VA 2IJZA 3WC7A 5HOLA 4ZYQA 1BAVA 3FECA 3KGQA 5JGFA 4MXUA 3GPOA 4NGQA 4PPZA 1F2PA 2ZEGA 3Q6ZA 5CBMA 4NJRA 1NSAA 3CPAA 2JBKA 4ZX8A 2PJAA 1M4LA 3FMCA 2QVPA
chains in the Genus database with same CATH superfamily
3JUWA 1M4DA 4A37A 2C6PA 2YNEA 1BOBA 4RI1A 1XIXA 2QYVA 2PIYA 2ZXVA 4DJLA 3V2BA 2Z10A 3TC8A 3QB8A 4NCZA 3B3CA 4PXEA 1XEBA 4A94A 3KL9A 1WWZA 1XRYA 2PJ3A 5FSXA 2AFXA 3VARA 1Z8TA 3B3TA 4EVYA 4HPSA 2J8RA 2GANA 2ZEEA 1JWQA 3L2NA 1IGBA 1S7LA 2FG1A 3B8GA 4FD4A 4FWUA 3H8EA 2WPXA 4Y49C 4BBHA 4WJBA 1M4IA 2ZEHA 4OC3A 2B4DB 4KSIA 3H8GA 4UEZA 2BSWA 4UFVA 4TWEA 4CAEA 2YNDA 4XPLA 1Y0YA 2AFZA 3Q71A 1LAPA 4UEEA 1IYKA 5K8NA 2VQYA 4MHNA 3I3GA 1XMBA 2B4BA 3SI2A 7CPAA 2JZDA 2NSMA 4LQGA 4OC5A 5FVJA 1M44A 1LANA 1P0HA 1SQHA 4KORA 4AB7A 5BWAB 1Z8LA 2B3VA 3D7FA 4OADA 4J3GA 3RAMA 2V8DA 2QJ8A 4AG7A 3SJFA 1NE9A 1I1DA 5LYFA 4R57A 2V8HA 3TO7A 3PEIA 2L8RA 2P6FA 1CBXA 4OC0A 5HVHA 2EK8A 2PC1A 1MK4A 2PVVA 4F0YA 4KOTA 3QAYA 2ACFA 5LYIA 4A31A 4BMHA 5KTDA 3PB8X 1S3ZA 4UFWA 3PB4X 5LYLA 3E0KA 3RNZA 4YGOA 5A28A 5F48A 3KR4A 3LD2A 4KOVA 3ETIA 3GLJA 1XE4A 1YREA 2B5GA 2WSAA 4MY3A 4UEFA 1QSTA 4Y49B 4PSXA 5F46A 3PB6X 1TKFA 1VIXA 3EWQA 3GKRA 4ZBGA 4AXVA 4C7IA 3SXNA 4A33A 1LCPA 3D67A 2JLMA 1R43A 3PBBA 3NE7A 3PB7X 3LWUA 3IWEA 1ZG9A 2CNTA 4B5PB 4CGLA 4E8OA 3V7ZA 4H2KA 5HIHA 2OZUA 1LRZA 4JJXA 4CS0B 4UIAA 2I00A 1CM0A 5CPAA 5KTAA 2VEZA 3JZTA 4EMEA 1VHUA 4OC1A 5AG5A 4ONWA 1NJRA 2J9AA 2C27A 2R1IA 1TKHA 2Q7BA 1Z8WA 4P4EA 1B6BA 2BOAA 2ZW6A 2PRBA 3CT9A 4FUUA 4C7HA 4F9UA 5J8CA 4X5KA 2YNCA 1L0CA 3DSBA 3UY5A 2F5IA 4KUAA 4KS9A 4U5YA 4MFLA 1IU8A 3IGRA 2F8HA 2G0BA 3BLNA 3SXOA 1YQEA 3FYNA 3IFEA 3WABA 1B87A 4I49A 5THWA 4FD7A 4A30A 3TE4A 4P4IA 3NA6A 2Q7SA 4M3SA 1HJZA 2FXKA 2D4OA 4B14A 4PV6A 4MHYA 3KHXA 4R3LA 4MFPA 3CXPA 2CIJA 2JDDA 2KCWA 3PZJA 2DPSA 2G9DA 4FD6A 3T8WA 3SI1A 1KWMA 2ZW4A 3TCVA 1YGHA 4L89A 4U9ZA 2PJ4A 3D4UA 2PJ5A 2B4DA 3QAHA 4MBUA 2FAVA 1HEEA 2AFUA 4ZY2A 2BEIA 4MY0A 3FJUA 5D29A 3DLJA 3T9YA 3V8IA 4MRIA 5I4MA 1QSNA 1YSJA 3D66A 2BO9A 4Q7AA 3SIIA 1R3NA 3CZXA 4C2XA 3GYAA 4U9YA 3FB3A 2AFWA 1Q2YA 4OIWA 1F2OA 4KYBA 5HH1A 4GUAA 1VGYA 1YVOA 2JDCA 1FY7A 2NYQA 1CPSA 3KQZA 2EEEA 1ZR5A 1Z9UA 4OIDA 2CNSA 2I3CA 1CG2A 1M4GA 2JZFA 4KOWA 2PJ9A 1CP6A 2H5MA 4J4ZA 2ZEPA 2EUIA 4K30A 1LAMA 3BJ7A 4UBRA 4R3KA 5F49A 4LX9A 4A32A 4CAFA 3JVNA 4RN7A 4H6ZA 2ZEDA 4UF4A 1I21A 1P4NA 2PR8A 3K2KA 2GREA 3PFEA 2PIZA 2PJ7A 4B11A 1Z5RA 1K4JA 2XEGA 4QUSA 4WWVA 4K3NA 2O4HA 3DNSA 4YFJA 3S6FA 4DUKA 3EY5A 2C6CA 4F6AA 2ZEMA 5CMSA 1Z8XA 3KI9A 1IOIA 5EC4A 4BINA 2Q0YA 4H89A 1Z4EA 2OH1A 5C88A 4KVME 4FAIA 4B5PA 2EWBA 3B35A 4PK3A 4X2TA 2BFRA 1YX0A 1RXTA 1Y9WA 4QVTA 4JD6A 3IWWA 5F47A 1GHEA 1BPNA 3NH5A 4HNWB 4CPAA 3BI1A 4MCQA 5AILA 3MN8A 4AG9A 4AVAA 2HQYA 4KVXA 3EXNA 3CPXA 3F0AA 2QIRA 1YMEA 4R9MA 3S9NA 4GVVA 4Q38A 1VHOA 2Z3OA 3N7ZA 1PYTB 2PVWA 5ELYA 4KLWA 2GIVA 2WUUA 3LODA 3R96A 6CPAA 2ATRA 3RBUA 4MI4A 4NEXA 1VKCA 2BFQA 1Z4RA 4XPDC 4YRHA 3PFOA 2FSRA 2Z3LA 4X3RA 4B10A 5IB0A 5IB9A 4PK2A 3WC6A 1ARMA 3B3SA 4ORFA 3R9GA 3PBEA 5GCNA 3EC4A 2W2GA 5J1QA 3GQOA 2ZEOA 2VXKA 2GLJA 3IU1A 3ISXA 3R95A 2HV2A 4A38A 4EFDA 1ZO0A 1PUAA 4P45A 4ZY0A 4B13A 3SIHA 4IQYA 3TO6A 3N5FA 1S60A 4MFQA 4P4DA 2C6GA 1J4JA 4OC4A 3SJEA 2Z3MA 3TOBA 4MCPA 2POKA 3DGVA 1KZFA 3D3SA 3IU2A 4KSFA 1DE4C 2AFOA 2PJCA 4P10A 5IV0A 3PB9X 2IL4A 5DWNA 2HUZA 2R98A 4NGPA 5K8OA 2PJ8A 1RO5A 2HC9A 4QB9A 2F7VA 2VRIA 3NH8A 5FSUA 3LACA 3S9MA 2ZW7A 4NJQA 1Q2CA 1VHEA 2DEAA 4NFRA 3TX8A 4XPDB 1V0CA 3BXMA 3K9TA 2XD7A 1RTQA 1IICA 3D2MA 1NSLA 4P4JA 3V38A 2HB6A 2PJ6A 2AFSA 3D68A 4KLVA 2YGWA 4OAEA 1ON0A 2JBJA 3EO4A 3VH9A 2ANPA 3PP9A 3GQEA 4OC2A 2AJ6A 2VBQA 2Z3KA 3K9UA 1S7NA 4MFZA 4F8ZA 5FSZA 4J5QA 2VL1A 3R9EA 2CNMA 4PQAA 1LOKA 2EO8A 3VFQA 3VATA 1MJAA 2G3AA 4IHMA 2VZZA 2ODFA 4P44A 2PJ2A 4DYOA 1XF8A 4UMLA 5HXDA 2DX6A 2JZEA 1FNOA 2P6GA 3F8KA 4HNXB 4PXDA 2XEFA 3WT4A 4B12A 4Z65A 2Z3PA 2ZPAA 4CGPA 4ZI6A 4CYNA 1A2ZA 5LRJA 1BPMA 4ABKA 1R57A 5JPHA 4C2ZA 2NMTA 1CX8A 1TF9A 2PR1A 3D8PA 3GUXA 4LQ6A 2V8GA 5IX3A 3RZAA 4ZY1A 3B7IA 2PE3A 3JTKA 4PSWA 3RO0A 3KQXA 4GM5A 1TIQA 4NGNA 4EWTA 1TKJA 2WPWA 4UWIA 1PCAA 4CAVA 5KTCA 2PCUA 3SIGA 2Q43A 4MHPA 2WCTA 4NF1A 5J8FA 4GVWA 5DS0A 3FH4A 3MRUA 4NXYA 3D7HA 2FL4A 5JM6A 4TNUA 4JXQA 4K0CA 3TT2A 4NGTA 1OBRA 4NGRA 5ISVA 4QC6A 1AMPA 3DR6A 3LMSA 5LYDA 2JEWA 2PJBA 3I1UA 4A2ZA 1YLOA 1DTDA 4RS2A 3SHPA 1FT7A 3ZZIA 4ETKA 4ZGYB 2Z3NA 3R9FA 4E0AA 5HMNA 3QNVA 3SIJA 2Q44A 3IIBA 4J5SA 2EK9A 3MGDA 3SI0A 2I79A 2CF4A 4FD5A 3VWEA 3V45A 3FF3A 2K5TA 3KASA 4JYWA 5JH9A 1M1DA 1Q7LA 1UFHA 1IB1E 2ARHA 1Y9KA 1NMTA 2B3UA 2DXQA 2Q4VA 4MCRA 4NGMA 5A27A 3H4QA 4YU9A 2G3TA 1QQ9A 2RNKA 2AFMA 2DF5A 2P6EA 2ZOFA 4II9A 1U6MA 5HVFA 4IAVA 5K8MA 2FCKA 4KUBA 4KVOE 3TOAA 1ZG8A 1CPXA 1OZPA 2ZENA 3GPGA 1YD9A 4GXHA 1Z2LA 4OKOA 3W6SA 1SPVA 1TXRA 3S6GA 3EJFA 4P4BA 3IEHA 2EVNA 4JVVA 3BJ8A 5DWMA 4G1PA 1N71A 3IIDA 3IJ3A 4CGMA 2OB0A 3BI0A 3FRMA 4ESSA 2P0WA 1IYLA 2V77A 4Q36A 4JLYA 1ELLP 3B3WA 3GIUA 4L8AA 3TO9A 4DNCA 4JCAA 3B2YA 2Q51A 2CTBA 1KUYA 4KOUA 2ZOGA 2FVGA 4W9YA 3KKWA 1VHSA 2GLFA 2ABZA 2RC4A 3GY9A 5AGEA 1Q2DA 5E3BA 3H5ZA 4AVCA 2IMOA 4E2AA 3BHXA 4TU0A 4MMOA 3HUVA 2AE6A 3P2HA 2Y0MA 1I12A 1ELMP 3SJGA 1F57A 2ZEFA 1XBUA 2X47A 4P6YA 3WR7A 3B3VA 2FE7A 3TTHA 3KHZA 4R7MA 1X12A 2GFQA 2ZELA 2A4NA 2FS5A 5FSYA 2QECA 2R8VA 3G8WA 2QMLA 2BCOA 1TY8A 1IOFA 4M6IA 2DPTA 4GS4A 5H86A 3T90A 5C82A 3TFYA 3FX6A 3OWCA 5CB5A 3VWDA 5LRGA 2CXAA 2FIAA 3R1KA 4UFXA 3EWPA 3GB0A 1ZG7A 2BUEA 5AG7A 1UWYA 1ZLIA 2Q04A 4KOYA 1QMUA 2EBJA 3S9LA 1YLEA 5G21A 4R6TA 3G3SA 3W91A 4RUHA 1BO4A 1HDUA 1JQGA 3DDDA 1IY7A 4J5RA 3PGPA 4OP4A 4UCMA 3EWOA 5EBVA 4OMEA 4UCNA 3EW5A 3NH4A 1AUGA 5HVGA 4PXBA 3ISZA 5CB3A 2RB7A 4XPKA 1KUXA 5H84A 2O53A 3IC1A 3IO1A 4UA3A 4XNHC 4R8FA 3PRTA 2X7BA 2J8MA 4D86A 4KSAA 2PSWA 2GE3A 4CGNA 2XEJA 4IUSA 2WZNA 4X8IA 2PJ0A 1YW6A 3EFAA 4MFJA 4A39A 4CRZB 1ZLHA 2Z0ZA 4ABLA 4JZ0A 5AG4A 1S7FA 4A95A 1HDQA 2FXFA 4CGOA 8CPAA 2R7HA 4IK2A 4MCSA 2V8VA 4O23A 3D7DA 1MJBA 2OU2A 2GU2A 2PJ1A 2VI7A 1ARLA 3IIFA 3KR5A 1WK4A 1Y7EA 2LGRA 2IQ6A 2RFHA 3FIXA 2JEVA 4M6HA 4M6GA 2Q4ZA 4NGSA 1KUVA 3S6HA 5FSVA 4JLLA 1TF8A 2CTCA 4FBEA 3F5BA 1LFWA 3KZWA 3FXTA 1X10A 4F0XA 4JGKA 4R76A 2REFA 3RYOA 4CYOA 2D4PA 3C26A 2KQVA 4LUAA 4P4FA 5JQ4A 3CXQA 1S5KA 4HNYB 4B6ZA 1QSMA 2OZHA 5G20A 4PXCA 4C68A 3FEDA 4OLLA 4CYQA 3JRUA 4H6UA 3D2PA 4UWJA 1CP7A 1EE3P 1Y0RA 4CRYB 3FVLA 4ZX9A 4XNHB 4MHZA 1YK3A 2PRQA 3FNCA 5K8PA 1XOVA 2WYRA 3FEEA 2C1CA 5G1ZA 3EJGA 2O28A 1MJ9A 5D8NA 4UIBA 2OOTA 3WC5A 4AVBA 3EWRA 2XEIA 2Q4YA 1Y7RA 3S6KA 1AYEA 1H8LA 3DR8A 1GYTA 3GPQA 2CY2A 1XJOA 4BD9A 2J8NA 3SJXA 4UCPA 1XFOA 4M85A 3NFZA 5EMIA 2YNCC 5LRKA 2BL1A 4CYPA 4R87A 2PQ8A 2AFCA 3H8FA 1IIDA 1CJWA 4JXRA 4MJ8A 4KOXA 3ZJ0A 5DUSA 2OR4A 2REEA 4CAWA 5AG6A 4MHDA 3HLPA 4YWYA 3NE8A 5F09A 1TXZA 3CDXA 1S7KA 1QSRA 1BLLE 2B5GB 1ZR3A 3D7GA 3P2FA 4ETJA 4CAXA 1YVKA 1YW4A 3EKEA 4JWPA 2IJZA 4KZTA 4F9VA 3IWGA 4B5OA 3I9SA 5HOLA 3WC7A 4KOSA 2B58A 4ZYQA 4ONUA 5CNPA 1BAVA 3FECA 3KGQA 5JGFA 2FIWA 4MXUA 2VZYA 2PDOA 2Z11A 3GPOA 4NGQA 2OZGA 4PPZA 1F2PA 1QSOA 4NSQA 5E96A 5I0CA 3A9LA 2ZEGA 3Q6ZA 5CBMA 4C2YA 2ZW5A 1XMTA 1NSAA 4NJRA 3CPAA 2JBKA 4MFKA 5G22A 4QBJA 3CXSA 4HKFA 4ZX8A 1PU9A 2PJAA 3W6XA 3FBUA 1M4LA 1YR0A 3FMCA 4IF5A 2QVPA 2FT0A
chains in the Genus database with same CATH topology
4A37A 2C6PA 2QYVA 2PIYA 4DJLA 3V2BA 3TC8A 3B3CA 4PXEA 4A94A 3KL9A 1XRYA 2PJ3A 5FSXA 2AFXA 3VARA 3B3TA 2ZEEA 3L2NA 1IGBA 4FWUA 2FG1A 3H8EA 4WJBA 4OC3A 2ZEHA 4KSIA 3H8GA 4UEZA 4TWEA 1Y0YA 2AFZA 3Q71A 1LAPA 4UEEA 5K8NA 4MHNA 1XMBA 3SI2A 7CPAA 4LQGA 2NSMA 4OC5A 1LANA 1Z8LA 3D7FA 3RAMA 2V8DA 2QJ8A 3SJFA 5LYFA 2V8HA 3PEIA 2L8RA 1CBXA 4OC0A 5HVHA 2EK8A 2PVVA 2ACFA 5LYIA 5LYLA 3PB8X 3PB4X 3KR4A 3ETIA 3GLJA 4UEFA 3PB6X 1TKFA 1VIXA 3EWQA 4AXVA 1LCPA 3D67A 1R43A 3PBBA 3PB7X 3LWUA 1ZG9A 3V7ZA 4H2KA 5HIHA 4UIAA 5CPAA 3JZTA 4EMEA 1VHUA 4OC1A 4ONWA 1NJRA 2J9AA 1TKHA 4P4EA 4FUUA 2BOAA 3CT9A 4F9UA 2F8HA 3IFEA 3WABA 5THWA 4P4IA 3NA6A 1HJZA 2FXKA 4MHYA 3KHXA 2CIJA 2G9DA 3T8WA 3SI1A 1KWMA 2PJ4A 3D4UA 2PJ5A 2FAVA 1HEEA 2AFUA 4ZY2A 5D29A 3FJUA 3DLJA 4MRIA 5I4MA 1YSJA 3D66A 2BO9A 4Q7AA 3SIIA 1R3NA 2AFWA 4OIWA 1F2OA 4KYBA 4GUAA 1VGYA 2NYQA 1CPSA 3KQZA 2EEEA 1ZR5A 4OIDA 2I3CA 1CG2A 2PJ9A 1CP6A 2ZEPA 4J4ZA 1LAMA 2ZEDA 4UF4A 3K2KA 2GREA 3PFEA 2PIZA 2PJ7A 1Z5RA 2XEGA 4WWVA 4K3NA 2O4HA 4DUKA 2C6CA 2ZEMA 5CMSA 3KI9A 4FAIA 2EWBA 3B35A 4R8FA 4X2TA 2BFRA 3IWWA 1BPNA 3NH5A 4CPAA 3BI1A 4MCQA 5AILA 3MN8A 3CPXA 3S9NA 1YMEA 4GVVA 1VHOA 1PYTB 2PVWA 5ELYA 6CPAA 3RBUA 2BFQA 3PFOA 4X3RA 5IB9A 3WC6A 1ARMA 3B3SA 3PBEA 5J1QA 3GQOA 2ZEOA 2GLJA 3ISXA 4A38A 4EFDA 4P45A 4ZY0A 3SIHA 4IQYA 3N5FA 3SJEA 4P4DA 4OC4A 2C6GA 4MCPA 2POKA 3DGVA 1DE4C 2AFOA 2PJCA 4P10A 3PB9X 4NGPA 5K8OA 2PJ8A 2HC9A 2F7VA 2VRIA 3NH8A 5FSUA 3S9MA 4NJQA 3TX8A 1VHEA 2DEAA 4NFRA 3BXMA 3K9TA 2XD7A 1RTQA 4P4JA 3V38A 2HB6A 2PJ6A 2AFSA 3D68A 2JBJA 3VH9A 2ANPA 3GQEA 4OC2A 4F8ZA 5FSZA 4J5QA 2VL1A 4PQAA 1LOKA 3VFQA 3VATA 4IHMA 4P44A 4DYOA 2PJ2A 4UMLA 5HXDA 2DX6A 1FNOA 3WT4A 4PXDA 2XEFA 4Z65A 4ZI6A 5LRJA 1BPMA 4ABKA 1CX8A 1TF9A 3GUXA 2V8GA 3RZAA 4ZY1A 3B7IA 2PE3A 4EWTA 3KQXA 4GM5A 4NGNA 1TKJA 1PCAA 2PCUA 3SIGA 2Q43A 4MHPA 4GVWA 5DS0A 3FH4A 3MRUA 3D7HA 5JM6A 4TNUA 4K0CA 4NGTA 1OBRA 4NGRA 1AMPA 3LMSA 5LYDA 2JEWA 2PJBA 3I1UA 1YLOA 1DTDA 1FT7A 4ETKA 3QNVA 3SIJA 3IIBA 4J5SA 2EK9A 3SI0A 2CF4A 5JH9A 3V45A 3FF3A 3KASA 4JYWA 1Q7LA 4NGMA 4MCRA 4YU9A 1QQ9A 2AFMA 2ZOFA 5HVFA 4IAVA 5K8MA 1ZG8A 1CPXA 2ZENA 3GPGA 1YD9A 1Z2LA 4OKOA 1SPVA 1TXRA 3EJFA 4P4BA 3IEHA 4JVVA 4G1PA 3IIDA 3IJ3A 3BI0A 4ESSA 2V77A 1ELLP 3B3WA 4JCAA 3B2YA 2Q51A 2CTBA 2ZOGA 2FVGA 4W9YA 2GLFA 2ABZA 5E3BA 2IMOA 3BHXA 4TU0A 4MMOA 3HUVA 1ELMP 3SJGA 1F57A 2ZEFA 1XBUA 2X47A 4P6YA 3B3VA 3KHZA 4R7MA 2ZELA 5FSYA 2BCOA 1TY8A 3FX6A 5CB5A 5LRGA 3EWPA 3GB0A 1ZG7A 1UWYA 1ZLIA 1QMUA 3S9LA 4R6TA 4RUHA 1HDUA 1JQGA 1IY7A 4J5RA 4OP4A 3EWOA 4OMEA 3EW5A 3NH4A 5HVGA 4PXBA 3ISZA 5CB3A 2RB7A 2O53A 3IC1A 3IO1A 3PRTA 4D86A 2XEJA 2WZNA 4X8IA 2PJ0A 1YW6A 4A39A 1ZLHA 4ABLA 4JZ0A 1HDQA 8CPAA 4IK2A 4MCSA 4O23A 2V8VA 3D7DA 2GU2A 2PJ1A 1ARLA 3IIFA 3KR5A 1Y7EA 2IQ6A 2LGRA 2RFHA 2Q4ZA 4NGSA 4FBEA 5FSVA 4JLLA 1TF8A 2CTCA 1LFWA 3KZWA 4JGKA 4R76A 4P4FA 4B6ZA 4PXCA 3FEDA 3JRUA 1CP7A 1EE3P 1Y0RA 3FVLA 4ZX9A 4MHZA 2PRQA 5K8PA 3FEEA 2WYRA 2C1CA 3EJGA 5D8NA 4UIBA 2OOTA 3WC5A 3EWRA 2XEIA 1AYEA 1H8LA 1GYTA 3GPQA 1XJOA 4BD9A 3SJXA 1XFOA 3NFZA 5LRKA 2AFCA 3H8FA 5DUSA 2OR4A 3HLPA 4YWYA 5F09A 1TXZA 3CDXA 1BLLE 1ZR3A 3D7GA 4ETJA 1YW4A 3EKEA 4F9VA 2IJZA 3WC7A 5HOLA 4ZYQA 1BAVA 3FECA 3KGQA 5JGFA 4MXUA 3GPOA 4NGQA 4PPZA 1F2PA 2ZEGA 3Q6ZA 5CBMA 4NJRA 1NSAA 3CPAA 2JBKA 4ZX8A 2PJAA 1M4LA 3FMCA 2QVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A37 A;  2C6P A;  2QYV A;  2PIY A;  4DJL A;  3V2B A;  3TC8 A;  3B3C A;  4PXE A;  4A94 A;  3KL9 A;  1XRY A;  2PJ3 A;  5FSX A;  2AFX A;  3VAR A;  3B3T A;  2ZEE A;  3L2N A;  1IGB A;  4FWU A;  2FG1 A;  3H8E A;  4WJB A;  4OC3 A;  2ZEH A;  4KSI A;  3H8G A;  4UEZ A;  4TWE A;  1Y0Y A;  2AFZ A;  3Q71 A;  1LAP A;  4UEE A;  5K8N A;  4MHN A;  1XMB A;  3SI2 A;  7CPA A;  4LQG A;  2NSM A;  4OC5 A;  1LAN A;  1Z8L A;  3D7F A;  3RAM A;  2V8D A;  2QJ8 A;  3SJF A;  5LYF A;  2V8H A;  3PEI A;  2L8R A;  1CBX A;  4OC0 A;  5HVH A;  2EK8 A;  2PVV A;  2ACF A;  5LYI A;  5LYL A;  3PB8 X;  3PB4 X;  3KR4 A;  3ETI A;  3GLJ A;  4UEF A;  3PB6 X;  1TKF A;  1VIX A;  3EWQ A;  4AXV A;  1LCP A;  3D67 A;  1R43 A;  3PBB A;  3PB7 X;  3LWU A;  1ZG9 A;  3V7Z A;  4H2K A;  5HIH A;  4UIA A;  5CPA A;  3JZT A;  4EME A;  1VHU A;  4OC1 A;  4ONW A;  1NJR A;  2J9A A;  1TKH A;  4P4E A;  4FUU A;  2BOA A;  3CT9 A;  4F9U A;  2F8H A;  3IFE A;  3WAB A;  5THW A;  4P4I A;  3NA6 A;  1HJZ A;  2FXK A;  4MHY A;  3KHX A;  2CIJ A;  2G9D A;  3T8W A;  3SI1 A;  1KWM A;  2PJ4 A;  3D4U A;  2PJ5 A;  2FAV A;  1HEE A;  2AFU A;  4ZY2 A;  5D29 A;  3FJU A;  3DLJ A;  4MRI A;  5I4M A;  1YSJ A;  3D66 A;  2BO9 A;  4Q7A A;  3SII A;  1R3N A;  2AFW A;  4OIW A;  1F2O A;  4KYB A;  4GUA A;  1VGY A;  2NYQ A;  1CPS A;  3KQZ A;  2EEE A;  1ZR5 A;  4OID A;  2I3C A;  1CG2 A;  2PJ9 A;  1CP6 A;  2ZEP A;  4J4Z A;  1LAM A;  2ZED A;  4UF4 A;  3K2K A;  2GRE A;  3PFE A;  2PIZ A;  2PJ7 A;  1Z5R A;  2XEG A;  4WWV A;  4K3N A;  2O4H A;  4DUK A;  2C6C A;  2ZEM A;  5CMS A;  3KI9 A;  4FAI A;  2EWB A;  3B35 A;  4R8F A;  4X2T A;  2BFR A;  3IWW A;  1BPN A;  3NH5 A;  4CPA A;  3BI1 A;  4MCQ A;  5AIL A;  3MN8 A;  3CPX A;  3S9N A;  1YME A;  4GVV A;  1VHO A;  1PYT B;  2PVW A;  5ELY A;  6CPA A;  3RBU A;  2BFQ A;  3PFO A;  4X3R A;  5IB9 A;  3WC6 A;  1ARM A;  3B3S A;  3PBE A;  5J1Q A;  3GQO A;  2ZEO A;  2GLJ A;  3ISX A;  4A38 A;  4EFD A;  4P45 A;  4ZY0 A;  3SIH A;  4IQY A;  3N5F A;  3SJE A;  4P4D A;  4OC4 A;  2C6G A;  4MCP A;  2POK A;  3DGV A;  1DE4 C;  2AFO A;  2PJC A;  4P10 A;  3PB9 X;  4NGP A;  5K8O A;  2PJ8 A;  2HC9 A;  2F7V A;  2VRI A;  3NH8 A;  5FSU A;  3S9M A;  4NJQ A;  3TX8 A;  1VHE A;  2DEA A;  4NFR A;  3BXM A;  3K9T A;  2XD7 A;  1RTQ A;  4P4J A;  3V38 A;  2HB6 A;  2PJ6 A;  2AFS A;  3D68 A;  2JBJ A;  3VH9 A;  2ANP A;  3GQE A;  4OC2 A;  4F8Z A;  5FSZ A;  4J5Q A;  2VL1 A;  4PQA A;  1LOK A;  3VFQ A;  3VAT A;  4IHM A;  4P44 A;  4DYO A;  2PJ2 A;  4UML A;  5HXD A;  2DX6 A;  1FNO A;  3WT4 A;  4PXD A;  2XEF A;  4Z65 A;  4ZI6 A;  5LRJ A;  1BPM A;  4ABK A;  1CX8 A;  1TF9 A;  3GUX A;  2V8G A;  3RZA A;  4ZY1 A;  3B7I A;  2PE3 A;  4EWT A;  3KQX A;  4GM5 A;  4NGN A;  1TKJ A;  1PCA A;  2PCU A;  3SIG A;  2Q43 A;  4MHP A;  4GVW A;  5DS0 A;  3FH4 A;  3MRU A;  3D7H A;  5JM6 A;  4TNU A;  4K0C A;  4NGT A;  1OBR A;  4NGR A;  1AMP A;  3LMS A;  5LYD A;  2JEW A;  2PJB A;  3I1U A;  1YLO A;  1DTD A;  1FT7 A;  4ETK A;  3QNV A;  3SIJ A;  3IIB A;  4J5S A;  2EK9 A;  3SI0 A;  2CF4 A;  5JH9 A;  3V45 A;  3FF3 A;  3KAS A;  4JYW A;  1Q7L A;  4NGM A;  4MCR A;  4YU9 A;  1QQ9 A;  2AFM A;  2ZOF A;  5HVF A;  4IAV A;  5K8M A;  1ZG8 A;  1CPX A;  2ZEN A;  3GPG A;  1YD9 A;  1Z2L A;  4OKO A;  1SPV A;  1TXR A;  3EJF A;  4P4B A;  3IEH A;  4JVV A;  4G1P A;  3IID A;  3IJ3 A;  3BI0 A;  4ESS A;  2V77 A;  1ELL P;  3B3W A;  4JCA A;  3B2Y A;  2Q51 A;  2CTB A;  2ZOG A;  2FVG A;  4W9Y A;  2GLF A;  2ABZ A;  5E3B A;  2IMO A;  3BHX A;  4TU0 A;  4MMO A;  3HUV A;  1ELM P;  3SJG A;  1F57 A;  2ZEF A;  1XBU A;  2X47 A;  4P6Y A;  3B3V A;  3KHZ A;  4R7M A;  2ZEL A;  5FSY A;  2BCO A;  1TY8 A;  3FX6 A;  5CB5 A;  5LRG A;  3EWP A;  3GB0 A;  1ZG7 A;  1UWY A;  1ZLI A;  1QMU A;  3S9L A;  4R6T A;  4RUH A;  1HDU A;  1JQG A;  1IY7 A;  4J5R A;  4OP4 A;  3EWO A;  4OME A;  3EW5 A;  3NH4 A;  5HVG A;  4PXB A;  3ISZ A;  5CB3 A;  2RB7 A;  2O53 A;  3IC1 A;  3IO1 A;  3PRT A;  4D86 A;  2XEJ A;  2WZN A;  4X8I A;  2PJ0 A;  1YW6 A;  4A39 A;  1ZLH A;  4ABL A;  4JZ0 A;  1HDQ A;  8CPA A;  4IK2 A;  4MCS A;  4O23 A;  2V8V A;  3D7D A;  2GU2 A;  2PJ1 A;  1ARL A;  3IIF A;  3KR5 A;  1Y7E A;  2IQ6 A;  2LGR A;  2RFH A;  2Q4Z A;  4NGS A;  4FBE A;  5FSV A;  4JLL A;  1TF8 A;  2CTC A;  1LFW A;  3KZW A;  4JGK A;  4R76 A;  4P4F A;  4B6Z A;  4PXC A;  3FED A;  3JRU A;  1CP7 A;  1EE3 P;  1Y0R A;  3FVL A;  4ZX9 A;  4MHZ A;  2PRQ A;  5K8P A;  3FEE A;  2WYR A;  2C1C A;  3EJG A;  5D8N A;  4UIB A;  2OOT A;  3WC5 A;  3EWR A;  2XEI A;  1AYE A;  1H8L A;  1GYT A;  3GPQ A;  1XJO A;  4BD9 A;  3SJX A;  1XFO A;  3NFZ A;  5LRK A;  2AFC A;  3H8F A;  5DUS A;  2OR4 A;  3HLP A;  4YWY A;  5F09 A;  1TXZ A;  3CDX A;  1BLL E;  1ZR3 A;  3D7G A;  4ETJ A;  1YW4 A;  3EKE A;  4F9V A;  2IJZ A;  3WC7 A;  5HOL A;  4ZYQ A;  1BAV A;  3FEC A;  3KGQ A;  5JGF A;  4MXU A;  3GPO A;  4NGQ A;  4PPZ A;  1F2P A;  2ZEG A;  3Q6Z A;  5CBM A;  4NJR A;  1NSA A;  3CPA A;  2JBK A;  4ZX8 A;  2PJA A;  1M4L A;  3FMC A;  2QVP A; 
#chains in the Genus database with same CATH topology
 3JUW A;  1M4D A;  4A37 A;  2C6P A;  2YNE A;  1BOB A;  4RI1 A;  1XIX A;  2QYV A;  2PIY A;  2ZXV A;  4DJL A;  3V2B A;  2Z10 A;  3TC8 A;  3QB8 A;  4NCZ A;  3B3C A;  4PXE A;  1XEB A;  4A94 A;  3KL9 A;  1WWZ A;  1XRY A;  2PJ3 A;  5FSX A;  2AFX A;  3VAR A;  1Z8T A;  3B3T A;  4EVY A;  4HPS A;  2J8R A;  2GAN A;  2ZEE A;  1JWQ A;  3L2N A;  1IGB A;  1S7L A;  2FG1 A;  3B8G A;  4FD4 A;  4FWU A;  3H8E A;  2WPX A;  4Y49 C;  4BBH A;  4WJB A;  1M4I A;  2ZEH A;  4OC3 A;  2B4D B;  4KSI A;  3H8G A;  4UEZ A;  2BSW A;  4UFV A;  4TWE A;  4CAE A;  2YND A;  4XPL A;  1Y0Y A;  2AFZ A;  3Q71 A;  1LAP A;  4UEE A;  1IYK A;  5K8N A;  2VQY A;  4MHN A;  3I3G A;  1XMB A;  2B4B A;  3SI2 A;  7CPA A;  2JZD A;  2NSM A;  4LQG A;  4OC5 A;  5FVJ A;  1M44 A;  1LAN A;  1P0H A;  1SQH A;  4KOR A;  4AB7 A;  5BWA B;  1Z8L A;  2B3V A;  3D7F A;  4OAD A;  4J3G A;  3RAM A;  2V8D A;  2QJ8 A;  4AG7 A;  3SJF A;  1NE9 A;  1I1D A;  5LYF A;  4R57 A;  2V8H A;  3TO7 A;  3PEI A;  2L8R A;  2P6F A;  1CBX A;  4OC0 A;  5HVH A;  2EK8 A;  2PC1 A;  1MK4 A;  2PVV A;  4F0Y A;  4KOT A;  3QAY A;  2ACF A;  5LYI A;  4A31 A;  4BMH A;  5KTD A;  3PB8 X;  1S3Z A;  4UFW A;  3PB4 X;  5LYL A;  3E0K A;  3RNZ A;  4YGO A;  5A28 A;  5F48 A;  3KR4 A;  3LD2 A;  4KOV A;  3ETI A;  3GLJ A;  1XE4 A;  1YRE A;  2B5G A;  2WSA A;  4MY3 A;  4UEF A;  1QST A;  4Y49 B;  4PSX A;  5F46 A;  3PB6 X;  1TKF A;  1VIX A;  3EWQ A;  3GKR A;  4ZBG A;  4AXV A;  4C7I A;  3SXN A;  4A33 A;  1LCP A;  3D67 A;  2JLM A;  1R43 A;  3PBB A;  3NE7 A;  3PB7 X;  3LWU A;  3IWE A;  1ZG9 A;  2CNT A;  4B5P B;  4CGL A;  4E8O A;  3V7Z A;  4H2K A;  5HIH A;  2OZU A;  1LRZ A;  4JJX A;  4CS0 B;  4UIA A;  2I00 A;  1CM0 A;  5CPA A;  5KTA A;  2VEZ A;  3JZT A;  4EME A;  1VHU A;  4OC1 A;  5AG5 A;  4ONW A;  1NJR A;  2J9A A;  2C27 A;  2R1I A;  1TKH A;  2Q7B A;  1Z8W A;  4P4E A;  1B6B A;  2BOA A;  2ZW6 A;  2PRB A;  3CT9 A;  4FUU A;  4C7H A;  4F9U A;  5J8C A;  4X5K A;  2YNC A;  1L0C A;  3DSB A;  3UY5 A;  2F5I A;  4KUA A;  4KS9 A;  4U5Y A;  4MFL A;  1IU8 A;  3IGR A;  2F8H A;  2G0B A;  3BLN A;  3SXO A;  1YQE A;  3FYN A;  3IFE A;  3WAB A;  1B87 A;  4I49 A;  5THW A;  4FD7 A;  4A30 A;  3TE4 A;  4P4I A;  3NA6 A;  2Q7S A;  4M3S A;  1HJZ A;  2FXK A;  2D4O A;  4B14 A;  4PV6 A;  4MHY A;  3KHX A;  4R3L A;  4MFP A;  3CXP A;  2CIJ A;  2JDD A;  2KCW A;  3PZJ A;  2DPS A;  2G9D A;  4FD6 A;  3T8W A;  3SI1 A;  1KWM A;  2ZW4 A;  3TCV A;  1YGH A;  4L89 A;  4U9Z A;  2PJ4 A;  3D4U A;  2PJ5 A;  2B4D A;  3QAH A;  4MBU A;  2FAV A;  1HEE A;  2AFU A;  4ZY2 A;  2BEI A;  4MY0 A;  3FJU A;  5D29 A;  3DLJ A;  3T9Y A;  3V8I A;  4MRI A;  5I4M A;  1QSN A;  1YSJ A;  3D66 A;  2BO9 A;  4Q7A A;  3SII A;  1R3N A;  3CZX A;  4C2X A;  3GYA A;  4U9Y A;  3FB3 A;  2AFW A;  1Q2Y A;  4OIW A;  1F2O A;  4KYB A;  5HH1 A;  4GUA A;  1VGY A;  1YVO A;  2JDC A;  1FY7 A;  2NYQ A;  1CPS A;  3KQZ A;  2EEE A;  1ZR5 A;  1Z9U A;  4OID A;  2CNS A;  2I3C A;  1CG2 A;  1M4G A;  2JZF A;  4KOW A;  2PJ9 A;  1CP6 A;  2H5M A;  4J4Z A;  2ZEP A;  2EUI A;  4K30 A;  1LAM A;  3BJ7 A;  4UBR A;  4R3K A;  5F49 A;  4LX9 A;  4A32 A;  4CAF A;  3JVN A;  4RN7 A;  4H6Z A;  2ZED A;  4UF4 A;  1I21 A;  1P4N A;  2PR8 A;  3K2K A;  2GRE A;  3PFE A;  2PIZ A;  2PJ7 A;  4B11 A;  1Z5R A;  1K4J A;  2XEG A;  4QUS A;  4WWV A;  4K3N A;  2O4H A;  3DNS A;  4YFJ A;  3S6F A;  4DUK A;  3EY5 A;  2C6C A;  4F6A A;  2ZEM A;  5CMS A;  1Z8X A;  3KI9 A;  1IOI A;  5EC4 A;  4BIN A;  2Q0Y A;  4H89 A;  1Z4E A;  2OH1 A;  5C88 A;  4KVM E;  4FAI A;  4B5P A;  2EWB A;  3B35 A;  4PK3 A;  4X2T A;  2BFR A;  1YX0 A;  1RXT A;  1Y9W A;  4QVT A;  4JD6 A;  3IWW A;  5F47 A;  1GHE A;  1BPN A;  3NH5 A;  4HNW B;  4CPA A;  3BI1 A;  4MCQ A;  5AIL A;  3MN8 A;  4AG9 A;  4AVA A;  2HQY A;  4KVX A;  3EXN A;  3CPX A;  3F0A A;  2QIR A;  1YME A;  4R9M A;  3S9N A;  4GVV A;  4Q38 A;  1VHO A;  2Z3O A;  3N7Z A;  1PYT B;  2PVW A;  5ELY A;  4KLW A;  2GIV A;  2WUU A;  3LOD A;  3R96 A;  6CPA A;  2ATR A;  3RBU A;  4MI4 A;  4NEX A;  1VKC A;  2BFQ A;  1Z4R A;  4XPD C;  4YRH A;  3PFO A;  2FSR A;  2Z3L A;  4X3R A;  4B10 A;  5IB0 A;  5IB9 A;  4PK2 A;  3WC6 A;  1ARM A;  3B3S A;  4ORF A;  3R9G A;  3PBE A;  5GCN A;  3EC4 A;  2W2G A;  5J1Q A;  3GQO A;  2ZEO A;  2VXK A;  2GLJ A;  3IU1 A;  3ISX A;  3R95 A;  2HV2 A;  4A38 A;  4EFD A;  1ZO0 A;  1PUA A;  4P45 A;  4ZY0 A;  4B13 A;  3SIH A;  4IQY A;  3TO6 A;  3N5F A;  1S60 A;  4MFQ A;  4P4D A;  2C6G A;  1J4J A;  4OC4 A;  3SJE A;  2Z3M A;  3TOB A;  4MCP A;  2POK A;  3DGV A;  1KZF A;  3D3S A;  3IU2 A;  4KSF A;  1DE4 C;  2AFO A;  2PJC A;  4P10 A;  5IV0 A;  3PB9 X;  2IL4 A;  5DWN A;  2HUZ A;  2R98 A;  4NGP A;  5K8O A;  2PJ8 A;  1RO5 A;  2HC9 A;  4QB9 A;  2F7V A;  2VRI A;  3NH8 A;  5FSU A;  3LAC A;  3S9M A;  2ZW7 A;  4NJQ A;  1Q2C A;  1VHE A;  2DEA A;  4NFR A;  3TX8 A;  4XPD B;  1V0C A;  3BXM A;  3K9T A;  2XD7 A;  1RTQ A;  1IIC A;  3D2M A;  1NSL A;  4P4J A;  3V38 A;  2HB6 A;  2PJ6 A;  2AFS A;  3D68 A;  4KLV A;  2YGW A;  4OAE A;  1ON0 A;  2JBJ A;  3EO4 A;  3VH9 A;  2ANP A;  3PP9 A;  3GQE A;  4OC2 A;  2AJ6 A;  2VBQ A;  2Z3K A;  3K9U A;  1S7N A;  4MFZ A;  4F8Z A;  5FSZ A;  4J5Q A;  2VL1 A;  3R9E A;  2CNM A;  4PQA A;  1LOK A;  2EO8 A;  3VFQ A;  3VAT A;  1MJA A;  2G3A A;  4IHM A;  2VZZ A;  2ODF A;  4P44 A;  2PJ2 A;  4DYO A;  1XF8 A;  4UML A;  5HXD A;  2DX6 A;  2JZE A;  1FNO A;  2P6G A;  3F8K A;  4HNX B;  4PXD A;  2XEF A;  3WT4 A;  4B12 A;  4Z65 A;  2Z3P A;  2ZPA A;  4CGP A;  4ZI6 A;  4CYN A;  1A2Z A;  5LRJ A;  1BPM A;  4ABK A;  1R57 A;  5JPH A;  4C2Z A;  2NMT A;  1CX8 A;  1TF9 A;  2PR1 A;  3D8P A;  3GUX A;  4LQ6 A;  2V8G A;  5IX3 A;  3RZA A;  4ZY1 A;  3B7I A;  2PE3 A;  3JTK A;  4PSW A;  3RO0 A;  3KQX A;  4GM5 A;  1TIQ A;  4NGN A;  4EWT A;  1TKJ A;  2WPW A;  4UWI A;  1PCA A;  4CAV A;  5KTC A;  2PCU A;  3SIG A;  2Q43 A;  4MHP A;  2WCT A;  4NF1 A;  5J8F A;  4GVW A;  5DS0 A;  3FH4 A;  3MRU A;  4NXY A;  3D7H A;  2FL4 A;  5JM6 A;  4TNU A;  4JXQ A;  4K0C A;  3TT2 A;  4NGT A;  1OBR A;  4NGR A;  5ISV A;  4QC6 A;  1AMP A;  3DR6 A;  3LMS A;  5LYD A;  2JEW A;  2PJB A;  3I1U A;  4A2Z A;  1YLO A;  1DTD A;  4RS2 A;  3SHP A;  1FT7 A;  3ZZI A;  4ETK A;  4ZGY B;  2Z3N A;  3R9F A;  4E0A A;  5HMN A;  3QNV A;  3SIJ A;  2Q44 A;  3IIB A;  4J5S A;  2EK9 A;  3MGD A;  3SI0 A;  2I79 A;  2CF4 A;  4FD5 A;  3VWE A;  3V45 A;  3FF3 A;  2K5T A;  3KAS A;  4JYW A;  5JH9 A;  1M1D A;  1Q7L A;  1UFH A;  1IB1 E;  2ARH A;  1Y9K A;  1NMT A;  2B3U A;  2DXQ A;  2Q4V A;  4MCR A;  4NGM A;  5A27 A;  3H4Q A;  4YU9 A;  2G3T A;  1QQ9 A;  2RNK A;  2AFM A;  2DF5 A;  2P6E A;  2ZOF A;  4II9 A;  1U6M A;  5HVF A;  4IAV A;  5K8M A;  2FCK A;  4KUB A;  4KVO E;  3TOA A;  1ZG8 A;  1CPX A;  1OZP A;  2ZEN A;  3GPG A;  1YD9 A;  4GXH A;  1Z2L A;  4OKO A;  3W6S A;  1SPV A;  1TXR A;  3S6G A;  3EJF A;  4P4B A;  3IEH A;  2EVN A;  4JVV A;  3BJ8 A;  5DWM A;  4G1P A;  1N71 A;  3IID A;  3IJ3 A;  4CGM A;  2OB0 A;  3BI0 A;  3FRM A;  4ESS A;  2P0W A;  1IYL A;  2V77 A;  4Q36 A;  4JLY A;  1ELL P;  3B3W A;  3GIU A;  4L8A A;  3TO9 A;  4DNC A;  4JCA A;  3B2Y A;  2Q51 A;  2CTB A;  1KUY A;  4KOU A;  2ZOG A;  2FVG A;  4W9Y A;  3KKW A;  1VHS A;  2GLF A;  2ABZ A;  2RC4 A;  3GY9 A;  5AGE A;  1Q2D A;  5E3B A;  3H5Z A;  4AVC A;  2IMO A;  4E2A A;  3BHX A;  4TU0 A;  4MMO A;  3HUV A;  2AE6 A;  3P2H A;  2Y0M A;  1I12 A;  1ELM P;  3SJG A;  1F57 A;  2ZEF A;  1XBU A;  2X47 A;  4P6Y A;  3WR7 A;  3B3V A;  2FE7 A;  3TTH A;  3KHZ A;  4R7M A;  1X12 A;  2GFQ A;  2ZEL A;  2A4N A;  2FS5 A;  5FSY A;  2QEC A;  2R8V A;  3G8W A;  2QML A;  2BCO A;  1TY8 A;  1IOF A;  4M6I A;  2DPT A;  4GS4 A;  5H86 A;  3T90 A;  5C82 A;  3TFY A;  3FX6 A;  3OWC A;  5CB5 A;  3VWD A;  5LRG A;  2CXA A;  2FIA A;  3R1K A;  4UFX A;  3EWP A;  3GB0 A;  1ZG7 A;  2BUE A;  5AG7 A;  1UWY A;  1ZLI A;  2Q04 A;  4KOY A;  1QMU A;  2EBJ A;  3S9L A;  1YLE A;  5G21 A;  4R6T A;  3G3S A;  3W91 A;  4RUH A;  1BO4 A;  1HDU A;  1JQG A;  3DDD A;  1IY7 A;  4J5R A;  3PGP A;  4OP4 A;  4UCM A;  3EWO A;  5EBV A;  4OME A;  4UCN A;  3EW5 A;  3NH4 A;  1AUG A;  5HVG A;  4PXB A;  3ISZ A;  5CB3 A;  2RB7 A;  4XPK A;  1KUX A;  5H84 A;  2O53 A;  3IC1 A;  3IO1 A;  4UA3 A;  4XNH C;  4R8F A;  3PRT A;  2X7B A;  2J8M A;  4D86 A;  4KSA A;  2PSW A;  2GE3 A;  4CGN A;  2XEJ A;  4IUS A;  2WZN A;  4X8I A;  2PJ0 A;  1YW6 A;  3EFA A;  4MFJ A;  4A39 A;  4CRZ B;  1ZLH A;  2Z0Z A;  4ABL A;  4JZ0 A;  5AG4 A;  1S7F A;  4A95 A;  1HDQ A;  2FXF A;  4CGO A;  8CPA A;  2R7H A;  4IK2 A;  4MCS A;  2V8V A;  4O23 A;  3D7D A;  1MJB A;  2OU2 A;  2GU2 A;  2PJ1 A;  2VI7 A;  1ARL A;  3IIF A;  3KR5 A;  1WK4 A;  1Y7E A;  2LGR A;  2IQ6 A;  2RFH A;  3FIX A;  2JEV A;  4M6H A;  4M6G A;  2Q4Z A;  4NGS A;  1KUV A;  3S6H A;  5FSV A;  4JLL A;  1TF8 A;  2CTC A;  4FBE A;  3F5B A;  1LFW A;  3KZW A;  3FXT A;  1X10 A;  4F0X A;  4JGK A;  4R76 A;  2REF A;  3RYO A;  4CYO A;  2D4P A;  3C26 A;  2KQV A;  4LUA A;  4P4F A;  5JQ4 A;  3CXQ A;  1S5K A;  4HNY B;  4B6Z A;  1QSM A;  2OZH A;  5G20 A;  4PXC A;  4C68 A;  3FED A;  4OLL A;  4CYQ A;  3JRU A;  4H6U A;  3D2P A;  4UWJ A;  1CP7 A;  1EE3 P;  1Y0R A;  4CRY B;  3FVL A;  4ZX9 A;  4XNH B;  4MHZ A;  1YK3 A;  2PRQ A;  3FNC A;  5K8P A;  1XOV A;  2WYR A;  3FEE A;  2C1C A;  5G1Z A;  3EJG A;  2O28 A;  1MJ9 A;  5D8N A;  4UIB A;  2OOT A;  3WC5 A;  4AVB A;  3EWR A;  2XEI A;  2Q4Y A;  1Y7R A;  3S6K A;  1AYE A;  1H8L A;  3DR8 A;  1GYT A;  3GPQ A;  2CY2 A;  1XJO A;  4BD9 A;  2J8N A;  3SJX A;  4UCP A;  1XFO A;  4M85 A;  3NFZ A;  5EMI A;  2YNC C;  5LRK A;  2BL1 A;  4CYP A;  4R87 A;  2PQ8 A;  2AFC A;  3H8F A;  1IID A;  1CJW A;  4JXR A;  4MJ8 A;  4KOX A;  3ZJ0 A;  5DUS A;  2OR4 A;  2REE A;  4CAW A;  5AG6 A;  4MHD A;  3HLP A;  4YWY A;  3NE8 A;  5F09 A;  1TXZ A;  3CDX A;  1S7K A;  1QSR A;  1BLL E;  2B5G B;  1ZR3 A;  3D7G A;  3P2F A;  4ETJ A;  4CAX A;  1YVK A;  1YW4 A;  3EKE A;  4JWP A;  2IJZ A;  4KZT A;  4F9V A;  3IWG A;  4B5O A;  3I9S A;  5HOL A;  3WC7 A;  4KOS A;  2B58 A;  4ZYQ A;  4ONU A;  5CNP A;  1BAV A;  3FEC A;  3KGQ A;  5JGF A;  2FIW A;  4MXU A;  2VZY A;  2PDO A;  2Z11 A;  3GPO A;  4NGQ A;  2OZG A;  4PPZ A;  1F2P A;  1QSO A;  4NSQ A;  5E96 A;  5I0C A;  3A9L A;  2ZEG A;  3Q6Z A;  5CBM A;  4C2Y A;  2ZW5 A;  1XMT A;  1NSA A;  4NJR A;  3CPA A;  2JBK A;  4MFK A;  5G22 A;  4QBJ A;  3CXS A;  4HKF A;  4ZX8 A;  1PU9 A;  2PJA A;  3W6X A;  3FBU A;  1M4L A;  1YR0 A;  3FMC A;  4IF5 A;  2QVP A;  2FT0 A; 
#chains in the Genus database with same CATH homology
 4A37 A;  2C6P A;  2QYV A;  2PIY A;  4DJL A;  3V2B A;  3TC8 A;  3B3C A;  4PXE A;  4A94 A;  3KL9 A;  1XRY A;  2PJ3 A;  5FSX A;  2AFX A;  3VAR A;  3B3T A;  2ZEE A;  3L2N A;  1IGB A;  4FWU A;  2FG1 A;  3H8E A;  4WJB A;  4OC3 A;  2ZEH A;  4KSI A;  3H8G A;  4UEZ A;  4TWE A;  1Y0Y A;  2AFZ A;  3Q71 A;  1LAP A;  4UEE A;  5K8N A;  4MHN A;  1XMB A;  3SI2 A;  7CPA A;  4LQG A;  2NSM A;  4OC5 A;  1LAN A;  1Z8L A;  3D7F A;  3RAM A;  2V8D A;  2QJ8 A;  3SJF A;  5LYF A;  2V8H A;  3PEI A;  2L8R A;  1CBX A;  4OC0 A;  5HVH A;  2EK8 A;  2PVV A;  2ACF A;  5LYI A;  5LYL A;  3PB8 X;  3PB4 X;  3KR4 A;  3ETI A;  3GLJ A;  4UEF A;  3PB6 X;  1TKF A;  1VIX A;  3EWQ A;  4AXV A;  1LCP A;  3D67 A;  1R43 A;  3PBB A;  3PB7 X;  3LWU A;  1ZG9 A;  3V7Z A;  4H2K A;  5HIH A;  4UIA A;  5CPA A;  3JZT A;  4EME A;  1VHU A;  4OC1 A;  4ONW A;  1NJR A;  2J9A A;  1TKH A;  4P4E A;  4FUU A;  2BOA A;  3CT9 A;  4F9U A;  2F8H A;  3IFE A;  3WAB A;  5THW A;  4P4I A;  3NA6 A;  1HJZ A;  2FXK A;  4MHY A;  3KHX A;  2CIJ A;  2G9D A;  3T8W A;  3SI1 A;  1KWM A;  2PJ4 A;  3D4U A;  2PJ5 A;  2FAV A;  1HEE A;  2AFU A;  4ZY2 A;  5D29 A;  3FJU A;  3DLJ A;  4MRI A;  5I4M A;  1YSJ A;  3D66 A;  2BO9 A;  4Q7A A;  3SII A;  1R3N A;  2AFW A;  4OIW A;  1F2O A;  4KYB A;  4GUA A;  1VGY A;  2NYQ A;  1CPS A;  3KQZ A;  2EEE A;  1ZR5 A;  4OID A;  2I3C A;  1CG2 A;  2PJ9 A;  1CP6 A;  2ZEP A;  4J4Z A;  1LAM A;  2ZED A;  4UF4 A;  3K2K A;  2GRE A;  3PFE A;  2PIZ A;  2PJ7 A;  1Z5R A;  2XEG A;  4WWV A;  4K3N A;  2O4H A;  4DUK A;  2C6C A;  2ZEM A;  5CMS A;  3KI9 A;  4FAI A;  2EWB A;  3B35 A;  4R8F A;  4X2T A;  2BFR A;  3IWW A;  1BPN A;  3NH5 A;  4CPA A;  3BI1 A;  4MCQ A;  5AIL A;  3MN8 A;  3CPX A;  3S9N A;  1YME A;  4GVV A;  1VHO A;  1PYT B;  2PVW A;  5ELY A;  6CPA A;  3RBU A;  2BFQ A;  3PFO A;  4X3R A;  5IB9 A;  3WC6 A;  1ARM A;  3B3S A;  3PBE A;  5J1Q A;  3GQO A;  2ZEO A;  2GLJ A;  3ISX A;  4A38 A;  4EFD A;  4P45 A;  4ZY0 A;  3SIH A;  4IQY A;  3N5F A;  3SJE A;  4P4D A;  4OC4 A;  2C6G A;  4MCP A;  2POK A;  3DGV A;  1DE4 C;  2AFO A;  2PJC A;  4P10 A;  3PB9 X;  4NGP A;  5K8O A;  2PJ8 A;  2HC9 A;  2F7V A;  2VRI A;  3NH8 A;  5FSU A;  3S9M A;  4NJQ A;  3TX8 A;  1VHE A;  2DEA A;  4NFR A;  3BXM A;  3K9T A;  2XD7 A;  1RTQ A;  4P4J A;  3V38 A;  2HB6 A;  2PJ6 A;  2AFS A;  3D68 A;  2JBJ A;  3VH9 A;  2ANP A;  3GQE A;  4OC2 A;  4F8Z A;  5FSZ A;  4J5Q A;  2VL1 A;  4PQA A;  1LOK A;  3VFQ A;  3VAT A;  4IHM A;  4P44 A;  4DYO A;  2PJ2 A;  4UML A;  5HXD A;  2DX6 A;  1FNO A;  3WT4 A;  4PXD A;  2XEF A;  4Z65 A;  4ZI6 A;  5LRJ A;  1BPM A;  4ABK A;  1CX8 A;  1TF9 A;  3GUX A;  2V8G A;  3RZA A;  4ZY1 A;  3B7I A;  2PE3 A;  4EWT A;  3KQX A;  4GM5 A;  4NGN A;  1TKJ A;  1PCA A;  2PCU A;  3SIG A;  2Q43 A;  4MHP A;  4GVW A;  5DS0 A;  3FH4 A;  3MRU A;  3D7H A;  5JM6 A;  4TNU A;  4K0C A;  4NGT A;  1OBR A;  4NGR A;  1AMP A;  3LMS A;  5LYD A;  2JEW A;  2PJB A;  3I1U A;  1YLO A;  1DTD A;  1FT7 A;  4ETK A;  3QNV A;  3SIJ A;  3IIB A;  4J5S A;  2EK9 A;  3SI0 A;  2CF4 A;  5JH9 A;  3V45 A;  3FF3 A;  3KAS A;  4JYW A;  1Q7L A;  4NGM A;  4MCR A;  4YU9 A;  1QQ9 A;  2AFM A;  2ZOF A;  5HVF A;  4IAV A;  5K8M A;  1ZG8 A;  1CPX A;  2ZEN A;  3GPG A;  1YD9 A;  1Z2L A;  4OKO A;  1SPV A;  1TXR A;  3EJF A;  4P4B A;  3IEH A;  4JVV A;  4G1P A;  3IID A;  3IJ3 A;  3BI0 A;  4ESS A;  2V77 A;  1ELL P;  3B3W A;  4JCA A;  3B2Y A;  2Q51 A;  2CTB A;  2ZOG A;  2FVG A;  4W9Y A;  2GLF A;  2ABZ A;  5E3B A;  2IMO A;  3BHX A;  4TU0 A;  4MMO A;  3HUV A;  1ELM P;  3SJG A;  1F57 A;  2ZEF A;  1XBU A;  2X47 A;  4P6Y A;  3B3V A;  3KHZ A;  4R7M A;  2ZEL A;  5FSY A;  2BCO A;  1TY8 A;  3FX6 A;  5CB5 A;  5LRG A;  3EWP A;  3GB0 A;  1ZG7 A;  1UWY A;  1ZLI A;  1QMU A;  3S9L A;  4R6T A;  4RUH A;  1HDU A;  1JQG A;  1IY7 A;  4J5R A;  4OP4 A;  3EWO A;  4OME A;  3EW5 A;  3NH4 A;  5HVG A;  4PXB A;  3ISZ A;  5CB3 A;  2RB7 A;  2O53 A;  3IC1 A;  3IO1 A;  3PRT A;  4D86 A;  2XEJ A;  2WZN A;  4X8I A;  2PJ0 A;  1YW6 A;  4A39 A;  1ZLH A;  4ABL A;  4JZ0 A;  1HDQ A;  8CPA A;  4IK2 A;  4MCS A;  4O23 A;  2V8V A;  3D7D A;  2GU2 A;  2PJ1 A;  1ARL A;  3IIF A;  3KR5 A;  1Y7E A;  2IQ6 A;  2LGR A;  2RFH A;  2Q4Z A;  4NGS A;  4FBE A;  5FSV A;  4JLL A;  1TF8 A;  2CTC A;  1LFW A;  3KZW A;  4JGK A;  4R76 A;  4P4F A;  4B6Z A;  4PXC A;  3FED A;  3JRU A;  1CP7 A;  1EE3 P;  1Y0R A;  3FVL A;  4ZX9 A;  4MHZ A;  2PRQ A;  5K8P A;  3FEE A;  2WYR A;  2C1C A;  3EJG A;  5D8N A;  4UIB A;  2OOT A;  3WC5 A;  3EWR A;  2XEI A;  1AYE A;  1H8L A;  1GYT A;  3GPQ A;  1XJO A;  4BD9 A;  3SJX A;  1XFO A;  3NFZ A;  5LRK A;  2AFC A;  3H8F A;  5DUS A;  2OR4 A;  3HLP A;  4YWY A;  5F09 A;  1TXZ A;  3CDX A;  1BLL E;  1ZR3 A;  3D7G A;  4ETJ A;  1YW4 A;  3EKE A;  4F9V A;  2IJZ A;  3WC7 A;  5HOL A;  4ZYQ A;  1BAV A;  3FEC A;  3KGQ A;  5JGF A;  4MXU A;  3GPO A;  4NGQ A;  4PPZ A;  1F2P A;  2ZEG A;  3Q6Z A;  5CBM A;  4NJR A;  1NSA A;  3CPA A;  2JBK A;  4ZX8 A;  2PJA A;  1M4L A;  3FMC A;  2QVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...