5CBMA

Crystal structure of pfa-m17 with virtual ligand inhibitor
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
519
structure length
519
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Validation of a Potent Dual Inhibitor of the P. falciparum M1 and M17 Aminopeptidases Using Virtual Screening.
pubmed doi rcsb
source organism Plasmodium falciparum vietnam oak-knoll (fvo)
molecule tags Hydrolase
molecule keywords M17 family aminopeptidase
total genus 175
structure length 519
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 5cbmA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5cbmA02
2ZEFA 3MRUA 5AILA 1CBXA 4LQGA 4A38A 4F8ZA 5D8NA 3D7DA 5HVHA 3ISZA 3CT9A 3IJ3A 4MRIA 5LYLA 3NFZA 4OC4A 2PJ4A 7CPAA 1AYEA 5CPAA 5THWA 3PB4X 5K8PA 4ZI6A 3SJXA 1NJRA 3VH9A 4W9YA 2PJ1A 5LYIA 2ZELA 5HOLA 3CPXA 4JZ0A 4EFDA 4PQAA 4MCQA 3ISXA 4MCRA 5I4MA 4PXDA 5K8OA 2ZOFA 2XEGA 3BI0A 3TX8A 4ESSA 1ZG9A 1IGBA 3V2BA 3N5FA 3KQZA 5CMSA 3WT4A 1KWMA 4NGRA 3PB8X 4AXVA 2CF4A 3GQEA 1ZG7A 1TKFA 4UEFA 3GUXA 2PE3A 3PEIA 4IK2A 3D7FA 1ZR5A 3EKEA 4ZX8A 3KHXA 3IIDA 3KR5A 1ZR3A 1YLOA 2PJ3A 3JRUA 2PRQA 2VRIA 5DUSA 1VHUA 1CP7A 3PB9X 5D29A 1XJOA 1YSJA 3SJFA 3SIGA 2L8RA 4MHNA 4P4DA 4Q7AA 3SJGA 1RTQA 4IAVA 2ZEGA 4R8FA 1HDUA 3KASA 3PBEA 4MXUA 3TC8A 2OR4A 3LMSA 3NH5A 5DS0A 4J5RA 3H8EA 1AMPA 3JZTA 3NA6A 4ABLA 4OKOA 1NSAA 4R7MA 3SIJA 4YU9A 3NH4A 4NGPA 3GQOA 3WC5A 4D86A 4ZY2A 3CDXA 4FAIA 4ETJA 1BPMA 4JVVA 2G9DA 3FH4A 1TKJA 1VGYA 1CPXA 5JGFA 3EJFA 2CTBA 2V8HA 1VHOA 2V8VA 1Z2LA 3L2NA 4P4EA 3Q71A 2AFOA 1HJZA 2AFXA 4ONWA 1XFOA 2XEJA 1LAPA 2JBKA 1BPNA 4JYWA 3WC7A 3RAMA 4EMEA 3GPGA 1XMBA 1LCPA 3PRTA 3S9LA 4P10A 3GLJA 4KSIA 4Z65A 3D66A 2PVVA 2BOAA 3KGQA 4OIDA 1FNOA 3D7HA 3PFEA 2DX6A 1R43A 4MCSA 4WJBA 1XRYA 2WYRA 3IFEA 3HUVA 4DUKA 2PJ7A 2ZEOA 2C6PA 3B3CA 4ZY1A 3HLPA 5HXDA 1Y7EA 4J5SA 2POKA 2CIJA 4P6YA 3KZWA 3VATA 1IY7A 4X8IA 2PJ0A 2Q51A 2GREA 3D7GA 3PFOA 1Y0RA 2CTCA 3GB0A 2F7VA 3FECA 1R3NA 5FSUA 5JH9A 1DTDA 4OC5A 2ANPA 3NH8A 4O23A 4R6TA 5ELYA 4UIBA 3RBUA 1ELLP 2HC9A 3EW5A 3IIBA 5K8NA 4GUAA 1F2PA 1Q7LA 2NYQA 2F8HA 3SI2A 4K0CA 4ZYQA 2AFZA 2HB6A 4H2KA 4J4ZA 2EK9A 4MCPA 4OP4A 4OMEA 4TNUA 2C6GA 2PIZA 2PJ6A 3FX6A 2JEWA 1HDQA 4MHYA 6CPAA 1XBUA 5IB9A 2IQ6A 4MMOA 1F2OA 1ARLA 4TU0A 4OC0A 3B35A 1ARMA 2ZEMA 3EWPA 2V8DA 4NGMA 4ZY0A 4R76A 3K2KA 2PJ9A 5F09A 1TXRA 4A39A 3B3WA 4X3RA 2PJCA 2EWBA 1VHEA 2PJBA 1H8LA 2I3CA 4NGNA 3IC1A 5E3BA 3BXMA 2QYVA 2O53A 4UIAA 2PJ2A 4IQYA 5J1QA 4JLLA 2ABZA 3K9TA 3D4UA 4P4BA 3B3SA 5HVFA 5CBMA 1TXZA 2FG1A 3SIHA 1CG2A 2C1CA 5LYFA 4P44A 4FBEA 2BCOA 4IHMA 2EK8A 1QMUA 4UF4A 3B7IA 4GVVA 3IO1A 1GYTA 2J9AA 4NGQA 4UEZA 5FSXA 1YMEA 2XD7A 3BI1A 2AFCA 4P4IA 2LGRA 2GU2A 3EWQA 2XEFA 4ABKA 4FWUA 4NJQA 4TWEA 1BAVA 2AFSA 2OOTA 2Q4ZA 2AFMA 3LWUA 1ZLHA 2FAVA 4YWYA 5HIHA 1LFWA 1LOKA 4A37A 5LYDA 3FMCA 4GM5A 1YW6A 2DEAA 2EEEA 3I1UA 5CB5A 2ZEEA 3KR4A 3KI9A 1YW4A 3SJEA 5HVGA 2QJ8A 4X2TA 1ELMP 2ZENA 4RUHA 3B3VA 4G1PA 2V8GA 2X47A 2Q43A 5JM6A 2PIYA 3H8GA 4PPZA 1JQGA 3CPAA 2XEIA 5FSZA 3EJGA 1LAMA 1PCAA 3B2YA 3DGVA 3KQXA 2GLJA 4OC3A 3D68A 1SPVA 2O4HA 3PB7X 3QNVA 3S9MA 3SI0A 1TF8A 1M4LA 4PXEA 3DLJA 3EWRA 5K8MA 2PCUA 3V7ZA 4KYBA 4DYOA 4F9VA 3VFQA 4FUUA 1FT7A 3V45A 1HEEA 4NJRA 3T8WA 4P45A 1OBRA 1UWYA 2V77A 1Y0YA 1YD9A 4JCAA 4UMLA 2NSMA 4NGTA 4P4FA 3H8FA 3SIIA 2ZOGA 3PB6X 2WZNA 2PJ8A 4OC2A 3BHXA 4MHZA 4GVWA 1BLLE 4OC1A 3ETIA 3GPOA 2IJZA 2BFQA 3WABA 2ZEDA 3KL9A 1Z5RA 3D67A 2ZEPA 2AFWA 5CB3A 2FXKA 2ZEHA 4NGSA 3FEEA 2RFHA 2BO9A 4JGKA 3FVLA 1VIXA 1TY8A 4BD9A 8CPAA 3FJUA 3IIFA 5FSVA 4K3NA 4MHPA 2FVGA 3KHZA 3FF3A 2IMOA 2PJ5A 2JBJA 4CPAA 1TKHA 2QVPA 1PYTB 4B6ZA 2VL1A 4UEEA 5LRGA 4DJLA 1CPSA 3B3TA 4ZX9A 2GLFA 3SI1A 4ETKA 1ZG8A 5LRJA 3Q6ZA 1TF9A 5FSYA 4PXBA 4J5QA 2PVWA 1DE4C 3FEDA 3VARA 4EWTA 3MN8A 1QQ9A 4F9UA 2PJAA 3GPQA 4PXCA 3IEHA 3WC6A 4P4JA 1Z8LA 1F57A 5LRKA 2ACFA 4OIWA 1CP6A 3EWOA 4NFRA 1EE3P 4A94A 2BFRA 3RZAA 1ZLIA 4WWVA 3V38A 3PBBA 2C6CA 3IWWA 1CX8A 1LANA 2AFUA 3S9NA 2RB7A
chains in the Genus database with same CATH superfamily
2QIRA 2ZEFA 5G20A 3MRUA 5AILA 1CBXA 4C2YA 4LQGA 4A38A 4F8ZA 1MJAA 2RC4A 5D8NA 2DXQA 3D7DA 4HNYB 3EXNA 1S5KA 1M1DA 1Y9WA 3ISZA 4CAXA 4QVTA 5HVHA 3CT9A 3IJ3A 2DPTA 4KUBA 2WUUA 1MJ9A 4A30A 4MRIA 4XPDB 4A31A 5LYLA 2B3VA 2JZEA 1XF8A 3NFZA 4OC4A 2PJ4A 7CPAA 1AYEA 5CPAA 5THWA 2Q04A 1S60A 3PB4X 4PSWA 5K8PA 3R9FA 4ZI6A 3SJXA 1NJRA 2OZUA 2PR8A 3VH9A 4MFLA 4OLLA 2G0BA 3SXNA 3W91A 4CAWA 4RI1A 4MHDA 2PJ1A 2GANA 4R87A 4W9YA 1VKCA 5LYIA 2ZELA 2KQVA 5HOLA 4NXYA 3CPXA 4C7IA 4JZ0A 4EFDA 4PQAA 4K30A 3TTHA 3RYOA 1OZPA 4MCQA 1XOVA 2VZYA 3ISXA 4MCRA 3EO4A 4PK2A 4CYQA 5I4MA 3PP9A 2GFQA 3W6XA 4PXDA 5K8OA 1P0HA 4QB9A 3TO9A 4CGPA 1I1DA 2ZOFA 2XEGA 3BI0A 3TX8A 4ESSA 1ZG9A 3BLNA 3D2PA 1IGBA 2BL1A 3H4QA 2RNKA 1B6BA 3V2BA 3N5FA 3KQZA 5CMSA 2Q4YA 5G1ZA 3G8WA 4YFJA 3WT4A 1KWMA 1YR0A 1L0CA 1S7FA 4NEXA 4NGRA 3D8PA 4U5YA 3PB8X 1TIQA 2HQYA 3FB3A 4AVBA 4AXVA 2IL4A 2YNCA 1V0CA 2P6GA 2CF4A 4UA3A 3GQEA 2R7HA 4FD4A 1ZG7A 1TKFA 2FSRA 2EUIA 2I00A 4KVME 4UEFA 3GUXA 2PE3A 3PEIA 4IK2A 1YGHA 3D7FA 4L89A 1ZR5A 3EKEA 4ZX8A 3TO6A 3KHXA 3IIDA 4HKFA 3VWEA 3KR5A 1ZR3A 4UBRA 2REEA 1YLOA 2B5GA 3SXOA 2PJ3A 3DSBA 3JRUA 5LYFA 4M3SA 2Q7SA 2PRQA 3R9EA 2VRIA 4LUAA 5I0CA 3F5BA 5DUSA 1VHUA 1XIXA 1M44A 1CP7A 1S3ZA 3PB9X 4LX9A 5D29A 1XJOA 1YSJA 3SJFA 4NCZA 3SIGA 2L8RA 4MHNA 4P4DA 4Q7AA 3SJGA 2ZW4A 4E2AA 1RTQA 4IAVA 3CXSA 2ZEGA 2FCKA 3QB8A 4R9MA 4KOXA 4R8FA 2B58A 1HDUA 3NE7A 3KASA 3I3GA 3PBEA 3T9YA 4MXUA 1Q2DA 3TC8A 2YNEA 2OR4A 3WR7A 3LMSA 5FVJA 1M4IA 3NH5A 5DS0A 5F48A 4J5RA 4R57A 3H8EA 1AMPA 3D3SA 2ZW5A 3JZTA 3NA6A 1WK4A 4LQ6A 2J8NA 5HMNA 1BOBA 4ABLA 4MY0A 4OKOA 1NSAA 3BJ8A 4R7MA 3SIJA 2ZXVA 3FNCA 5F49A 4YU9A 1NMTA 3NH4A 4JXRA 1Z4RA 4NGPA 4C7HA 5BWAB 4H6ZA 3GQOA 3WC5A 4B5PA 4D86A 4ZY2A 3CDXA 2HV2A 4CAEA 4MI4A 4FAIA 2BEIA 2O28A 2WPXA 4C68A 4ETJA 1BPMA 4JVVA 1YK3A 1Z9UA 1TKJA 1VGYA 2G9DA 1CPXA 2OZHA 2VQYA 3FH4A 3GYAA 4UCNA 5JGFA 3EJFA 2CTBA 3DR8A 3B8GA 1S7NA 2V8HA 1VHOA 2F5IA 2V8VA 1Z2LA 3L2NA 4P4EA 1U6MA 3DNSA 5F47A 3Q71A 2H5MA 2AFOA 4KOTA 4F6AA 1HJZA 3GKRA 2R8VA 2G3TA 3S6HA 4KZTA 4CYOA 2AFXA 2X7BA 4ONWA 1XFOA 1YVOA 2FT0A 2XEJA 1LAPA 4A33A 3S6KA 1N71A 1BPNA 1YLEA 2JBKA 4JYWA 3WC7A 3RAMA 4BMHA 3TFYA 4EMEA 4A2ZA 3GPGA 4C2XA 3CZXA 4CRYB 1XMBA 3E0KA 4KSFA 4R3LA 1LCPA 3DR6A 4AG7A 3PRTA 5A27A 3S9LA 4P10A 3GLJA 1XMTA 4KSIA 4MFJA 4Z65A 1QSNA 3D66A 2PVVA 2BOAA 3P2FA 3KGQA 1Q2YA 1FNOA 3D7HA 3LACA 4OIDA 4QC6A 2OB0A 3PFEA 4MFKA 4PK3A 2DX6A 1R43A 4MCSA 3VWDA 2I79A 4WJBA 4R3KA 1XRYA 2C27A 2WYRA 4KORA 4UCMA 1VHSA 3HUVA 3IFEA 2B4DA 4CYNA 4DUKA 1P4NA 2PJ7A 4JWPA 2ZEOA 1NSLA 2C6PA 3B3CA 3GY9A 2ZW6A 4ZY1A 3HLPA 2CNSA 5HXDA 2CXAA 1Y7EA 4J5SA 2POKA 4UWIA 1YX0A 4FD6A 2Z3PA 2CIJA 4P6YA 5C82A 1X10A 3KZWA 4B14A 1MJBA 5ISVA 3IU1A 2VZZA 1CM0A 3VATA 1IY7A 2FE7A 4X8IA 2PJ0A 2Q51A 4CGNA 2Q0YA 2GREA 3D7GA 3PFOA 2DF5A 3CXPA 2YNCC 5KTDA 1Y0RA 1XEBA 2CTCA 5A28A 3R9GA 3GB0A 2F7VA 2KCWA 4KVOE 3FECA 3TOAA 1R3NA 5FSUA 5JH9A 1DTDA 4OC5A 3QAYA 2ANPA 5F09A 3NH8A 4O23A 4R6TA 5ELYA 4UIBA 3RBUA 1ELLP 2HC9A 3EW5A 2Z3NA 1A2ZA 3IIBA 4XPDC 5K8NA 4GUAA 3H5ZA 1ZO0A 4JXQA 5G21A 4KVXA 1F2PA 1Q7LA 2NYQA 2F8HA 3SI2A 4K0CA 4ZYQA 2PSWA 5DWMA 2AFZA 2HB6A 2VXKA 4H2KA 2R98A 4J4ZA 1FY7A 1S7LA 2EK9A 4DNCA 4MCPA 4OP4A 4OMEA 4M85A 4KUAA 1I21A 4TNUA 4E0AA 4MJ8A 2C6GA 2PIZA 4UCPA 5H86A 2PJ6A 3FX6A 4F0YA 2P6FA 2JEWA 1QSTA 1HDQA 1PU9A 2Z11A 1UFHA 2P6EA 4MHYA 4UFVA 2CY2A 4EVYA 2OU2A 2QMLA 5EC4A 4ZGYB 2FIWA 6CPAA 1XBUA 5IB9A 4BINA 2IQ6A 2VI7A 4H6UA 4MMOA 5IX3A 2ZPAA 1F2OA 1ARLA 2Z3LA 4TU0A 4YRHA 2PQ8A 4OC0A 4H89A 3B35A 1ARMA 2ZEMA 3EWPA 3R95A 3RNZA 3TE4A 2V8DA 4NGMA 4ZY0A 4R76A 1CJWA 2PJ9A 2PRBA 3K2KA 1I12A 3K9UA 1TXRA 3LD2A 4M6GA 2Z0ZA 4A39A 1M4GA 2B5GB 4ZBGA 3B3WA 5AG6A 3QAHA 4X3RA 2PJCA 2EWBA 1VHEA 3PGPA 2PJBA 1H8LA 2I3CA 4B11A 4NF1A 4NGNA 3IC1A 5E3BA 1Y7RA 1IU8A 3NE8A 4HPSA 5GCNA 4GS4A 1KZFA 3BXMA 2QYVA 4OADA 4ORFA 2O53A 5IB0A 4UIAA 2PJ2A 4IQYA 4IUSA 2ARHA 1IYLA 4XNHB 5J1QA 4JLLA 2WPWA 4QBJA 2ABZA 2FL4A 4Y49B 4KOYA 2FIAA 3K9TA 3D4UA 4MBUA 4P4BA 3B3SA 1YREA 5CBMA 5HVFA 1TXZA 2FG1A 4XPLA 3CXQA 5CNPA 1XE4A 4MFZA 4Q38A 3SIHA 1CG2A 2C1CA 2GE3A 5AG4A 5KTAA 4P44A 4ONUA 1KUXA 1IICA 4FBEA 2BCOA 4IHMA 4JJXA 2EK8A 3FRMA 3D2MA 3P2HA 4MFPA 1MK4A 1QMUA 4UF4A 3B7IA 4GVVA 3IO1A 4A32A 4II9A 1GYTA 1WWZA 2J9AA 4NGQA 4UFXA 4KLVA 2PR1A 4UEZA 4HNWB 5FSXA 4XPKA 2JZDA 4CGMA 1S7KA 1ON0A 1YMEA 5AG7A 3EFAA 3FYNA 4B5OA 3JUWA 2XD7A 3BI1A 1IYKA 2AFCA 3F8KA 4E8OA 4P4IA 1IOFA 4KS9A 5F46A 1PUAA 1YVKA 2LGRA 2GU2A 4F0XA 3S6GA 1IOIA 3EWQA 2XEFA 4JD6A 1QSMA 4ABKA 4FWUA 4L8AA 2W2GA 4NJQA 1BAVA 2AFSA 4TWEA 2OOTA 1NE9A 2Q4ZA 2AFMA 3LWUA 5AG5A 1ZLHA 2FAVA 2D4PA 4Y49C 3TOBA 4YWYA 3JTKA 5HIHA 2R1IA 3R96A 1KUYA 1LFWA 1LOKA 2CNMA 4A37A 2JDDA 1RO5A 2VBQA 5LYDA 3FMCA 3BJ7A 1YW6A 4GM5A 4B12A 2DEAA 2EEEA 3I1UA 5CB5A 3KR4A 2ZEEA 3KI9A 1YW4A 4UFWA 3SJEA 3V8IA 3ZZIA 5HVGA 2QJ8A 4X2TA 1ELMP 2ZENA 3TO7A 1JWQA 4RUHA 3F0AA 3B3VA 4G1PA 4CRZB 5JPHA 3EY5A 2PC1A 2V8GA 2X47A 1AUGA 2Q43A 5JM6A 2JZFA 2GIVA 2PIYA 3H8GA 3LODA 4NSQA 1B87A 1RXTA 4X5KA 3PZJA 4FD5A 4PPZA 1JQGA 3JVNA 4AVCA 5KTCA 2OH1A 3CPAA 4CAFA 2B4DB 2XEIA 1YQEA 5FSZA 3R1KA 3EJGA 1LAMA 1PCAA 3B2YA 3DGVA 3T90A 2Y0MA 4GXHA 3KQXA 1Z4EA 2GLJA 3D68A 2FXFA 1SPVA 4OC3A 2PDOA 4KOSA 4PSXA 5J8CA 1Z8XA 3IWEA 2O4HA 4M6HA 1J4JA 3PB7X 3C26A 3QNVA 3S9MA 5DWNA 3SI0A 1TF8A 1M4LA 5E96A 1BO4A 4JLYA 3DLJA 4PXEA 3EWRA 5K8MA 2PCUA 3V7ZA 2EO8A 2A4NA 4KYBA 4B13A 3UY5A 4DYOA 4F9VA 3VFQA 2EVNA 4HNXB 4KOUA 4CGOA 4KOVA 4QUSA 2Z3OA 4RS2A 5JQ4A 4FUUA 4IF5A 1FT7A 3V45A 1HEEA 2Q4VA 4NJRA 3T8WA 4P45A 1OBRA 3ZJ0A 1UWYA 2V77A 1Y0YA 2Q7BA 4BBHA 1Z8TA 1YD9A 2AE6A 2ODFA 3MGDA 4JCAA 4CYPA 4Q36A 4UMLA 2NSMA 2ATRA 3G3SA 4FD7A 2WSAA 4NGTA 2VEZA 2G3AA 4P4FA 3H8FA 3SIIA 4J3GA 4MFQA 2JEVA 2ZOGA 3PB6X 2WZNA 2PJ8A 4OC2A 3BHXA 4MHZA 4GVWA 4RN7A 1BLLE 3DDDA 4OC1A 3ETIA 3GPOA 1IIDA 2IJZA 2BFQA 3FIXA 4KOWA 4PV6A 3WABA 2ZEDA 4B10A 3OWCA 3TT2A 3KL9A 1Z5RA 2OZGA 2REFA 3D67A 2ZEPA 4B5PB 1GHEA 5CB3A 2FXKA 2AFWA 2ZEHA 3FEEA 3N7ZA 4NGSA 1LRZA 2JDCA 2RFHA 5J8FA 2BO9A 4JGKA 2Z3KA 1QSOA 4AB7A 3FVLA 1QSRA 1VIXA 4M6IA 1R57A 3IGRA 1TY8A 4YGOA 4BD9A 2JLMA 8CPAA 2AJ6A 2DPSA 3FJUA 3SHPA 3IIFA 1M4DA 2B3UA 3IWGA 2FS5A 5FSVA 4A95A 4K3NA 4MHPA 4UWJA 2FVGA 3KHZA 1IB1E 4XNHC 3FF3A 2IMOA 2PJ5A 3KKWA 1Y9KA 2JBJA 4CPAA 1TKHA 2QVPA 5EBVA 4CGLA 1PYTB 2YNDA 4B6ZA 2VL1A 4UEEA 4CS0B 4C2ZA 2BSWA 2ZW7A 3FBUA 4KLWA 5LRGA 4DJLA 1CPSA 3RO0A 1K4JA 3B3TA 4ZX9A 2GLFA 1Z8WA 3SI1A 2QECA 5C88A 1Q2CA 4ETKA 1ZG8A 5LRJA 4OAEA 5IV0A 3A9LA 3Q6ZA 1TF9A 2Q44A 2BUEA 5FSYA 4PXBA 2Z10A 1X12A 4U9YA 4J5QA 3GIUA 2PVWA 1DE4C 3EC4A 3FEDA 3VARA 1KUVA 5AGEA 4AVAA 3MN8A 4EWTA 1QQ9A 4F9UA 2P0WA 2PJAA 4CAVA 2D4OA 3GPQA 2Z3MA 4MY3A 3I9SA 2HUZA 3IEHA 4P4JA 4PXCA 3WC6A 2K5TA 4KSAA 1Z8LA 1F57A 5LRKA 4AG9A 4I49A 2ACFA 4OIWA 4U9ZA 1CP6A 3EWOA 4NFRA 1EE3P 4A94A 3W6SA 2BFRA 3RZAA 1SQHA 2EBJA 5HH1A 1ZLIA 2NMTA 4WWVA 5EMIA 3S6FA 2CNTA 3IU2A 2J8RA 2YGWA 2WCTA 5H84A 3FXTA 3PBBA 5G22A 2C6CA 3V38A 2B4BA 1CX8A 3IWWA 1LANA 2AFUA 3TCVA 2J8MA 3S9NA 2RB7A
chains in the Genus database with same CATH topology
2ZEFA 3MRUA 5AILA 1CBXA 4LQGA 4A38A 4F8ZA 5D8NA 3D7DA 5HVHA 3ISZA 3CT9A 3IJ3A 4MRIA 5LYLA 3NFZA 4OC4A 2PJ4A 7CPAA 1AYEA 5CPAA 5THWA 3PB4X 5K8PA 4ZI6A 3SJXA 1NJRA 3VH9A 4W9YA 2PJ1A 5LYIA 2ZELA 5HOLA 3CPXA 4JZ0A 4EFDA 4PQAA 4MCQA 3ISXA 4MCRA 5I4MA 4PXDA 5K8OA 2ZOFA 2XEGA 3BI0A 3TX8A 4ESSA 1ZG9A 1IGBA 3V2BA 3N5FA 3KQZA 5CMSA 3WT4A 1KWMA 4NGRA 3PB8X 4AXVA 2CF4A 3GQEA 1ZG7A 1TKFA 4UEFA 3GUXA 2PE3A 3PEIA 4IK2A 3D7FA 1ZR5A 3EKEA 4ZX8A 3KHXA 3IIDA 3KR5A 1ZR3A 1YLOA 2PJ3A 3JRUA 2PRQA 2VRIA 5DUSA 1VHUA 1CP7A 3PB9X 5D29A 1XJOA 1YSJA 3SJFA 3SIGA 2L8RA 4MHNA 4P4DA 4Q7AA 3SJGA 1RTQA 4IAVA 2ZEGA 4R8FA 1HDUA 3KASA 3PBEA 4MXUA 3TC8A 2OR4A 3LMSA 3NH5A 5DS0A 4J5RA 3H8EA 1AMPA 3JZTA 3NA6A 4ABLA 4OKOA 1NSAA 4R7MA 3SIJA 4YU9A 3NH4A 4NGPA 3GQOA 3WC5A 4D86A 4ZY2A 3CDXA 4FAIA 4ETJA 1BPMA 4JVVA 2G9DA 3FH4A 1TKJA 1VGYA 1CPXA 5JGFA 3EJFA 2CTBA 2V8HA 1VHOA 2V8VA 1Z2LA 3L2NA 4P4EA 3Q71A 2AFOA 1HJZA 2AFXA 4ONWA 1XFOA 2XEJA 1LAPA 2JBKA 1BPNA 4JYWA 3WC7A 3RAMA 4EMEA 3GPGA 1XMBA 1LCPA 3PRTA 3S9LA 4P10A 3GLJA 4KSIA 4Z65A 3D66A 2PVVA 2BOAA 3KGQA 4OIDA 1FNOA 3D7HA 3PFEA 2DX6A 1R43A 4MCSA 4WJBA 1XRYA 2WYRA 3IFEA 3HUVA 4DUKA 2PJ7A 2ZEOA 2C6PA 3B3CA 4ZY1A 3HLPA 5HXDA 1Y7EA 4J5SA 2POKA 2CIJA 4P6YA 3KZWA 3VATA 1IY7A 4X8IA 2PJ0A 2Q51A 2GREA 3D7GA 3PFOA 1Y0RA 2CTCA 3GB0A 2F7VA 3FECA 1R3NA 5FSUA 5JH9A 1DTDA 4OC5A 2ANPA 3NH8A 4O23A 4R6TA 5ELYA 4UIBA 3RBUA 1ELLP 2HC9A 3EW5A 3IIBA 5K8NA 4GUAA 1F2PA 1Q7LA 2NYQA 2F8HA 3SI2A 4K0CA 4ZYQA 2AFZA 2HB6A 4H2KA 4J4ZA 2EK9A 4MCPA 4OP4A 4OMEA 4TNUA 2C6GA 2PIZA 2PJ6A 3FX6A 2JEWA 1HDQA 4MHYA 6CPAA 1XBUA 5IB9A 2IQ6A 4MMOA 1F2OA 1ARLA 4TU0A 4OC0A 3B35A 1ARMA 2ZEMA 3EWPA 2V8DA 4NGMA 4ZY0A 4R76A 3K2KA 2PJ9A 5F09A 1TXRA 4A39A 3B3WA 4X3RA 2PJCA 2EWBA 1VHEA 2PJBA 1H8LA 2I3CA 4NGNA 3IC1A 5E3BA 3BXMA 2QYVA 2O53A 4UIAA 2PJ2A 4IQYA 5J1QA 4JLLA 2ABZA 3K9TA 3D4UA 4P4BA 3B3SA 5HVFA 5CBMA 1TXZA 2FG1A 3SIHA 1CG2A 2C1CA 5LYFA 4P44A 4FBEA 2BCOA 4IHMA 2EK8A 1QMUA 4UF4A 3B7IA 4GVVA 3IO1A 1GYTA 2J9AA 4NGQA 4UEZA 5FSXA 1YMEA 2XD7A 3BI1A 2AFCA 4P4IA 2LGRA 2GU2A 3EWQA 2XEFA 4ABKA 4FWUA 4NJQA 4TWEA 1BAVA 2AFSA 2OOTA 2Q4ZA 2AFMA 3LWUA 1ZLHA 2FAVA 4YWYA 5HIHA 1LFWA 1LOKA 4A37A 5LYDA 3FMCA 4GM5A 1YW6A 2DEAA 2EEEA 3I1UA 5CB5A 2ZEEA 3KR4A 3KI9A 1YW4A 3SJEA 5HVGA 2QJ8A 4X2TA 1ELMP 2ZENA 4RUHA 3B3VA 4G1PA 2V8GA 2X47A 2Q43A 5JM6A 2PIYA 3H8GA 4PPZA 1JQGA 3CPAA 2XEIA 5FSZA 3EJGA 1LAMA 1PCAA 3B2YA 3DGVA 3KQXA 2GLJA 4OC3A 3D68A 1SPVA 2O4HA 3PB7X 3QNVA 3S9MA 3SI0A 1TF8A 1M4LA 4PXEA 3DLJA 3EWRA 5K8MA 2PCUA 3V7ZA 4KYBA 4DYOA 4F9VA 3VFQA 4FUUA 1FT7A 3V45A 1HEEA 4NJRA 3T8WA 4P45A 1OBRA 1UWYA 2V77A 1Y0YA 1YD9A 4JCAA 4UMLA 2NSMA 4NGTA 4P4FA 3H8FA 3SIIA 2ZOGA 3PB6X 2WZNA 2PJ8A 4OC2A 3BHXA 4MHZA 4GVWA 1BLLE 4OC1A 3ETIA 3GPOA 2IJZA 2BFQA 3WABA 2ZEDA 3KL9A 1Z5RA 3D67A 2ZEPA 2AFWA 5CB3A 2FXKA 2ZEHA 4NGSA 3FEEA 2RFHA 2BO9A 4JGKA 3FVLA 1VIXA 1TY8A 4BD9A 8CPAA 3FJUA 3IIFA 5FSVA 4K3NA 4MHPA 2FVGA 3KHZA 3FF3A 2IMOA 2PJ5A 2JBJA 4CPAA 1TKHA 2QVPA 1PYTB 4B6ZA 2VL1A 4UEEA 5LRGA 4DJLA 1CPSA 3B3TA 4ZX9A 2GLFA 3SI1A 4ETKA 1ZG8A 5LRJA 3Q6ZA 1TF9A 5FSYA 4PXBA 4J5QA 2PVWA 1DE4C 3FEDA 3VARA 4EWTA 3MN8A 1QQ9A 4F9UA 2PJAA 3GPQA 4PXCA 3IEHA 3WC6A 4P4JA 1Z8LA 1F57A 5LRKA 2ACFA 4OIWA 1CP6A 3EWOA 4NFRA 1EE3P 4A94A 2BFRA 3RZAA 1ZLIA 4WWVA 3V38A 3PBBA 2C6CA 3IWWA 1CX8A 1LANA 2AFUA 3S9NA 2RB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEF A;  3MRU A;  5AIL A;  1CBX A;  4LQG A;  4A38 A;  4F8Z A;  5D8N A;  3D7D A;  5HVH A;  3ISZ A;  3CT9 A;  3IJ3 A;  4MRI A;  5LYL A;  3NFZ A;  4OC4 A;  2PJ4 A;  7CPA A;  1AYE A;  5CPA A;  5THW A;  3PB4 X;  5K8P A;  4ZI6 A;  3SJX A;  1NJR A;  3VH9 A;  4W9Y A;  2PJ1 A;  5LYI A;  2ZEL A;  5HOL A;  3CPX A;  4JZ0 A;  4EFD A;  4PQA A;  4MCQ A;  3ISX A;  4MCR A;  5I4M A;  4PXD A;  5K8O A;  2ZOF A;  2XEG A;  3BI0 A;  3TX8 A;  4ESS A;  1ZG9 A;  1IGB A;  3V2B A;  3N5F A;  3KQZ A;  5CMS A;  3WT4 A;  1KWM A;  4NGR A;  3PB8 X;  4AXV A;  2CF4 A;  3GQE A;  1ZG7 A;  1TKF A;  4UEF A;  3GUX A;  2PE3 A;  3PEI A;  4IK2 A;  3D7F A;  1ZR5 A;  3EKE A;  4ZX8 A;  3KHX A;  3IID A;  3KR5 A;  1ZR3 A;  1YLO A;  2PJ3 A;  3JRU A;  2PRQ A;  2VRI A;  5DUS A;  1VHU A;  1CP7 A;  3PB9 X;  5D29 A;  1XJO A;  1YSJ A;  3SJF A;  3SIG A;  2L8R A;  4MHN A;  4P4D A;  4Q7A A;  3SJG A;  1RTQ A;  4IAV A;  2ZEG A;  4R8F A;  1HDU A;  3KAS A;  3PBE A;  4MXU A;  3TC8 A;  2OR4 A;  3LMS A;  3NH5 A;  5DS0 A;  4J5R A;  3H8E A;  1AMP A;  3JZT A;  3NA6 A;  4ABL A;  4OKO A;  1NSA A;  4R7M A;  3SIJ A;  4YU9 A;  3NH4 A;  4NGP A;  3GQO A;  3WC5 A;  4D86 A;  4ZY2 A;  3CDX A;  4FAI A;  4ETJ A;  1BPM A;  4JVV A;  2G9D A;  3FH4 A;  1TKJ A;  1VGY A;  1CPX A;  5JGF A;  3EJF A;  2CTB A;  2V8H A;  1VHO A;  2V8V A;  1Z2L A;  3L2N A;  4P4E A;  3Q71 A;  2AFO A;  1HJZ A;  2AFX A;  4ONW A;  1XFO A;  2XEJ A;  1LAP A;  2JBK A;  1BPN A;  4JYW A;  3WC7 A;  3RAM A;  4EME A;  3GPG A;  1XMB A;  1LCP A;  3PRT A;  3S9L A;  4P10 A;  3GLJ A;  4KSI A;  4Z65 A;  3D66 A;  2PVV A;  2BOA A;  3KGQ A;  4OID A;  1FNO A;  3D7H A;  3PFE A;  2DX6 A;  1R43 A;  4MCS A;  4WJB A;  1XRY A;  2WYR A;  3IFE A;  3HUV A;  4DUK A;  2PJ7 A;  2ZEO A;  2C6P A;  3B3C A;  4ZY1 A;  3HLP A;  5HXD A;  1Y7E A;  4J5S A;  2POK A;  2CIJ A;  4P6Y A;  3KZW A;  3VAT A;  1IY7 A;  4X8I A;  2PJ0 A;  2Q51 A;  2GRE A;  3D7G A;  3PFO A;  1Y0R A;  2CTC A;  3GB0 A;  2F7V A;  3FEC A;  1R3N A;  5FSU A;  5JH9 A;  1DTD A;  4OC5 A;  2ANP A;  3NH8 A;  4O23 A;  4R6T A;  5ELY A;  4UIB A;  3RBU A;  1ELL P;  2HC9 A;  3EW5 A;  3IIB A;  5K8N A;  4GUA A;  1F2P A;  1Q7L A;  2NYQ A;  2F8H A;  3SI2 A;  4K0C A;  4ZYQ A;  2AFZ A;  2HB6 A;  4H2K A;  4J4Z A;  2EK9 A;  4MCP A;  4OP4 A;  4OME A;  4TNU A;  2C6G A;  2PIZ A;  2PJ6 A;  3FX6 A;  2JEW A;  1HDQ A;  4MHY A;  6CPA A;  1XBU A;  5IB9 A;  2IQ6 A;  4MMO A;  1F2O A;  1ARL A;  4TU0 A;  4OC0 A;  3B35 A;  1ARM A;  2ZEM A;  3EWP A;  2V8D A;  4NGM A;  4ZY0 A;  4R76 A;  3K2K A;  2PJ9 A;  5F09 A;  1TXR A;  4A39 A;  3B3W A;  4X3R A;  2PJC A;  2EWB A;  1VHE A;  2PJB A;  1H8L A;  2I3C A;  4NGN A;  3IC1 A;  5E3B A;  3BXM A;  2QYV A;  2O53 A;  4UIA A;  2PJ2 A;  4IQY A;  5J1Q A;  4JLL A;  2ABZ A;  3K9T A;  3D4U A;  4P4B A;  3B3S A;  5HVF A;  5CBM A;  1TXZ A;  2FG1 A;  3SIH A;  1CG2 A;  2C1C A;  5LYF A;  4P44 A;  4FBE A;  2BCO A;  4IHM A;  2EK8 A;  1QMU A;  4UF4 A;  3B7I A;  4GVV A;  3IO1 A;  1GYT A;  2J9A A;  4NGQ A;  4UEZ A;  5FSX A;  1YME A;  2XD7 A;  3BI1 A;  2AFC A;  4P4I A;  2LGR A;  2GU2 A;  3EWQ A;  2XEF A;  4ABK A;  4FWU A;  4NJQ A;  4TWE A;  1BAV A;  2AFS A;  2OOT A;  2Q4Z A;  2AFM A;  3LWU A;  1ZLH A;  2FAV A;  4YWY A;  5HIH A;  1LFW A;  1LOK A;  4A37 A;  5LYD A;  3FMC A;  4GM5 A;  1YW6 A;  2DEA A;  2EEE A;  3I1U A;  5CB5 A;  2ZEE A;  3KR4 A;  3KI9 A;  1YW4 A;  3SJE A;  5HVG A;  2QJ8 A;  4X2T A;  1ELM P;  2ZEN A;  4RUH A;  3B3V A;  4G1P A;  2V8G A;  2X47 A;  2Q43 A;  5JM6 A;  2PIY A;  3H8G A;  4PPZ A;  1JQG A;  3CPA A;  2XEI A;  5FSZ A;  3EJG A;  1LAM A;  1PCA A;  3B2Y A;  3DGV A;  3KQX A;  2GLJ A;  4OC3 A;  3D68 A;  1SPV A;  2O4H A;  3PB7 X;  3QNV A;  3S9M A;  3SI0 A;  1TF8 A;  1M4L A;  4PXE A;  3DLJ A;  3EWR A;  5K8M A;  2PCU A;  3V7Z A;  4KYB A;  4DYO A;  4F9V A;  3VFQ A;  4FUU A;  1FT7 A;  3V45 A;  1HEE A;  4NJR A;  3T8W A;  4P45 A;  1OBR A;  1UWY A;  2V77 A;  1Y0Y A;  1YD9 A;  4JCA A;  4UML A;  2NSM A;  4NGT A;  4P4F A;  3H8F A;  3SII A;  2ZOG A;  3PB6 X;  2WZN A;  2PJ8 A;  4OC2 A;  3BHX A;  4MHZ A;  4GVW A;  1BLL E;  4OC1 A;  3ETI A;  3GPO A;  2IJZ A;  2BFQ A;  3WAB A;  2ZED A;  3KL9 A;  1Z5R A;  3D67 A;  2ZEP A;  2AFW A;  5CB3 A;  2FXK A;  2ZEH A;  4NGS A;  3FEE A;  2RFH A;  2BO9 A;  4JGK A;  3FVL A;  1VIX A;  1TY8 A;  4BD9 A;  8CPA A;  3FJU A;  3IIF A;  5FSV A;  4K3N A;  4MHP A;  2FVG A;  3KHZ A;  3FF3 A;  2IMO A;  2PJ5 A;  2JBJ A;  4CPA A;  1TKH A;  2QVP A;  1PYT B;  4B6Z A;  2VL1 A;  4UEE A;  5LRG A;  4DJL A;  1CPS A;  3B3T A;  4ZX9 A;  2GLF A;  3SI1 A;  4ETK A;  1ZG8 A;  5LRJ A;  3Q6Z A;  1TF9 A;  5FSY A;  4PXB A;  4J5Q A;  2PVW A;  1DE4 C;  3FED A;  3VAR A;  4EWT A;  3MN8 A;  1QQ9 A;  4F9U A;  2PJA A;  3GPQ A;  4PXC A;  3IEH A;  3WC6 A;  4P4J A;  1Z8L A;  1F57 A;  5LRK A;  2ACF A;  4OIW A;  1CP6 A;  3EWO A;  4NFR A;  1EE3 P;  4A94 A;  2BFR A;  3RZA A;  1ZLI A;  4WWV A;  3V38 A;  3PBB A;  2C6C A;  3IWW A;  1CX8 A;  1LAN A;  2AFU A;  3S9N A;  2RB7 A; 
#chains in the Genus database with same CATH topology
 2QIR A;  2ZEF A;  5G20 A;  3MRU A;  5AIL A;  1CBX A;  4C2Y A;  4LQG A;  4A38 A;  4F8Z A;  1MJA A;  2RC4 A;  5D8N A;  2DXQ A;  3D7D A;  4HNY B;  3EXN A;  1S5K A;  1M1D A;  1Y9W A;  3ISZ A;  4CAX A;  4QVT A;  5HVH A;  3CT9 A;  3IJ3 A;  2DPT A;  4KUB A;  2WUU A;  1MJ9 A;  4A30 A;  4MRI A;  4XPD B;  4A31 A;  5LYL A;  2B3V A;  2JZE A;  1XF8 A;  3NFZ A;  4OC4 A;  2PJ4 A;  7CPA A;  1AYE A;  5CPA A;  5THW A;  2Q04 A;  1S60 A;  3PB4 X;  4PSW A;  5K8P A;  3R9F A;  4ZI6 A;  3SJX A;  1NJR A;  2OZU A;  2PR8 A;  3VH9 A;  4MFL A;  4OLL A;  2G0B A;  3SXN A;  3W91 A;  4CAW A;  4RI1 A;  4MHD A;  2PJ1 A;  2GAN A;  4R87 A;  4W9Y A;  1VKC A;  5LYI A;  2ZEL A;  2KQV A;  5HOL A;  4NXY A;  3CPX A;  4C7I A;  4JZ0 A;  4EFD A;  4PQA A;  4K30 A;  3TTH A;  3RYO A;  1OZP A;  4MCQ A;  1XOV A;  2VZY A;  3ISX A;  4MCR A;  3EO4 A;  4PK2 A;  4CYQ A;  5I4M A;  3PP9 A;  2GFQ A;  3W6X A;  4PXD A;  5K8O A;  1P0H A;  4QB9 A;  3TO9 A;  4CGP A;  1I1D A;  2ZOF A;  2XEG A;  3BI0 A;  3TX8 A;  4ESS A;  1ZG9 A;  3BLN A;  3D2P A;  1IGB A;  2BL1 A;  3H4Q A;  2RNK A;  1B6B A;  3V2B A;  3N5F A;  3KQZ A;  5CMS A;  2Q4Y A;  5G1Z A;  3G8W A;  4YFJ A;  3WT4 A;  1KWM A;  1YR0 A;  1L0C A;  1S7F A;  4NEX A;  4NGR A;  3D8P A;  4U5Y A;  3PB8 X;  1TIQ A;  2HQY A;  3FB3 A;  4AVB A;  4AXV A;  2IL4 A;  2YNC A;  1V0C A;  2P6G A;  2CF4 A;  4UA3 A;  3GQE A;  2R7H A;  4FD4 A;  1ZG7 A;  1TKF A;  2FSR A;  2EUI A;  2I00 A;  4KVM E;  4UEF A;  3GUX A;  2PE3 A;  3PEI A;  4IK2 A;  1YGH A;  3D7F A;  4L89 A;  1ZR5 A;  3EKE A;  4ZX8 A;  3TO6 A;  3KHX A;  3IID A;  4HKF A;  3VWE A;  3KR5 A;  1ZR3 A;  4UBR A;  2REE A;  1YLO A;  2B5G A;  3SXO A;  2PJ3 A;  3DSB A;  3JRU A;  5LYF A;  4M3S A;  2Q7S A;  2PRQ A;  3R9E A;  2VRI A;  4LUA A;  5I0C A;  3F5B A;  5DUS A;  1VHU A;  1XIX A;  1M44 A;  1CP7 A;  1S3Z A;  3PB9 X;  4LX9 A;  5D29 A;  1XJO A;  1YSJ A;  3SJF A;  4NCZ A;  3SIG A;  2L8R A;  4MHN A;  4P4D A;  4Q7A A;  3SJG A;  2ZW4 A;  4E2A A;  1RTQ A;  4IAV A;  3CXS A;  2ZEG A;  2FCK A;  3QB8 A;  4R9M A;  4KOX A;  4R8F A;  2B58 A;  1HDU A;  3NE7 A;  3KAS A;  3I3G A;  3PBE A;  3T9Y A;  4MXU A;  1Q2D A;  3TC8 A;  2YNE A;  2OR4 A;  3WR7 A;  3LMS A;  5FVJ A;  1M4I A;  3NH5 A;  5DS0 A;  5F48 A;  4J5R A;  4R57 A;  3H8E A;  1AMP A;  3D3S A;  2ZW5 A;  3JZT A;  3NA6 A;  1WK4 A;  4LQ6 A;  2J8N A;  5HMN A;  1BOB A;  4ABL A;  4MY0 A;  4OKO A;  1NSA A;  3BJ8 A;  4R7M A;  3SIJ A;  2ZXV A;  3FNC A;  5F49 A;  4YU9 A;  1NMT A;  3NH4 A;  4JXR A;  1Z4R A;  4NGP A;  4C7H A;  5BWA B;  4H6Z A;  3GQO A;  3WC5 A;  4B5P A;  4D86 A;  4ZY2 A;  3CDX A;  2HV2 A;  4CAE A;  4MI4 A;  4FAI A;  2BEI A;  2O28 A;  2WPX A;  4C68 A;  4ETJ A;  1BPM A;  4JVV A;  1YK3 A;  1Z9U A;  1TKJ A;  1VGY A;  2G9D A;  1CPX A;  2OZH A;  2VQY A;  3FH4 A;  3GYA A;  4UCN A;  5JGF A;  3EJF A;  2CTB A;  3DR8 A;  3B8G A;  1S7N A;  2V8H A;  1VHO A;  2F5I A;  2V8V A;  1Z2L A;  3L2N A;  4P4E A;  1U6M A;  3DNS A;  5F47 A;  3Q71 A;  2H5M A;  2AFO A;  4KOT A;  4F6A A;  1HJZ A;  3GKR A;  2R8V A;  2G3T A;  3S6H A;  4KZT A;  4CYO A;  2AFX A;  2X7B A;  4ONW A;  1XFO A;  1YVO A;  2FT0 A;  2XEJ A;  1LAP A;  4A33 A;  3S6K A;  1N71 A;  1BPN A;  1YLE A;  2JBK A;  4JYW A;  3WC7 A;  3RAM A;  4BMH A;  3TFY A;  4EME A;  4A2Z A;  3GPG A;  4C2X A;  3CZX A;  4CRY B;  1XMB A;  3E0K A;  4KSF A;  4R3L A;  1LCP A;  3DR6 A;  4AG7 A;  3PRT A;  5A27 A;  3S9L A;  4P10 A;  3GLJ A;  1XMT A;  4KSI A;  4MFJ A;  4Z65 A;  1QSN A;  3D66 A;  2PVV A;  2BOA A;  3P2F A;  3KGQ A;  1Q2Y A;  1FNO A;  3D7H A;  3LAC A;  4OID A;  4QC6 A;  2OB0 A;  3PFE A;  4MFK A;  4PK3 A;  2DX6 A;  1R43 A;  4MCS A;  3VWD A;  2I79 A;  4WJB A;  4R3K A;  1XRY A;  2C27 A;  2WYR A;  4KOR A;  4UCM A;  1VHS A;  3HUV A;  3IFE A;  2B4D A;  4CYN A;  4DUK A;  1P4N A;  2PJ7 A;  4JWP A;  2ZEO A;  1NSL A;  2C6P A;  3B3C A;  3GY9 A;  2ZW6 A;  4ZY1 A;  3HLP A;  2CNS A;  5HXD A;  2CXA A;  1Y7E A;  4J5S A;  2POK A;  4UWI A;  1YX0 A;  4FD6 A;  2Z3P A;  2CIJ A;  4P6Y A;  5C82 A;  1X10 A;  3KZW A;  4B14 A;  1MJB A;  5ISV A;  3IU1 A;  2VZZ A;  1CM0 A;  3VAT A;  1IY7 A;  2FE7 A;  4X8I A;  2PJ0 A;  2Q51 A;  4CGN A;  2Q0Y A;  2GRE A;  3D7G A;  3PFO A;  2DF5 A;  3CXP A;  2YNC C;  5KTD A;  1Y0R A;  1XEB A;  2CTC A;  5A28 A;  3R9G A;  3GB0 A;  2F7V A;  2KCW A;  4KVO E;  3FEC A;  3TOA A;  1R3N A;  5FSU A;  5JH9 A;  1DTD A;  4OC5 A;  3QAY A;  2ANP A;  5F09 A;  3NH8 A;  4O23 A;  4R6T A;  5ELY A;  4UIB A;  3RBU A;  1ELL P;  2HC9 A;  3EW5 A;  2Z3N A;  1A2Z A;  3IIB A;  4XPD C;  5K8N A;  4GUA A;  3H5Z A;  1ZO0 A;  4JXQ A;  5G21 A;  4KVX A;  1F2P A;  1Q7L A;  2NYQ A;  2F8H A;  3SI2 A;  4K0C A;  4ZYQ A;  2PSW A;  5DWM A;  2AFZ A;  2HB6 A;  2VXK A;  4H2K A;  2R98 A;  4J4Z A;  1FY7 A;  1S7L A;  2EK9 A;  4DNC A;  4MCP A;  4OP4 A;  4OME A;  4M85 A;  4KUA A;  1I21 A;  4TNU A;  4E0A A;  4MJ8 A;  2C6G A;  2PIZ A;  4UCP A;  5H86 A;  2PJ6 A;  3FX6 A;  4F0Y A;  2P6F A;  2JEW A;  1QST A;  1HDQ A;  1PU9 A;  2Z11 A;  1UFH A;  2P6E A;  4MHY A;  4UFV A;  2CY2 A;  4EVY A;  2OU2 A;  2QML A;  5EC4 A;  4ZGY B;  2FIW A;  6CPA A;  1XBU A;  5IB9 A;  4BIN A;  2IQ6 A;  2VI7 A;  4H6U A;  4MMO A;  5IX3 A;  2ZPA A;  1F2O A;  1ARL A;  2Z3L A;  4TU0 A;  4YRH A;  2PQ8 A;  4OC0 A;  4H89 A;  3B35 A;  1ARM A;  2ZEM A;  3EWP A;  3R95 A;  3RNZ A;  3TE4 A;  2V8D A;  4NGM A;  4ZY0 A;  4R76 A;  1CJW A;  2PJ9 A;  2PRB A;  3K2K A;  1I12 A;  3K9U A;  1TXR A;  3LD2 A;  4M6G A;  2Z0Z A;  4A39 A;  1M4G A;  2B5G B;  4ZBG A;  3B3W A;  5AG6 A;  3QAH A;  4X3R A;  2PJC A;  2EWB A;  1VHE A;  3PGP A;  2PJB A;  1H8L A;  2I3C A;  4B11 A;  4NF1 A;  4NGN A;  3IC1 A;  5E3B A;  1Y7R A;  1IU8 A;  3NE8 A;  4HPS A;  5GCN A;  4GS4 A;  1KZF A;  3BXM A;  2QYV A;  4OAD A;  4ORF A;  2O53 A;  5IB0 A;  4UIA A;  2PJ2 A;  4IQY A;  4IUS A;  2ARH A;  1IYL A;  4XNH B;  5J1Q A;  4JLL A;  2WPW A;  4QBJ A;  2ABZ A;  2FL4 A;  4Y49 B;  4KOY A;  2FIA A;  3K9T A;  3D4U A;  4MBU A;  4P4B A;  3B3S A;  1YRE A;  5CBM A;  5HVF A;  1TXZ A;  2FG1 A;  4XPL A;  3CXQ A;  5CNP A;  1XE4 A;  4MFZ A;  4Q38 A;  3SIH A;  1CG2 A;  2C1C A;  2GE3 A;  5AG4 A;  5KTA A;  4P44 A;  4ONU A;  1KUX A;  1IIC A;  4FBE A;  2BCO A;  4IHM A;  4JJX A;  2EK8 A;  3FRM A;  3D2M A;  3P2H A;  4MFP A;  1MK4 A;  1QMU A;  4UF4 A;  3B7I A;  4GVV A;  3IO1 A;  4A32 A;  4II9 A;  1GYT A;  1WWZ A;  2J9A A;  4NGQ A;  4UFX A;  4KLV A;  2PR1 A;  4UEZ A;  4HNW B;  5FSX A;  4XPK A;  2JZD A;  4CGM A;  1S7K A;  1ON0 A;  1YME A;  5AG7 A;  3EFA A;  3FYN A;  4B5O A;  3JUW A;  2XD7 A;  3BI1 A;  1IYK A;  2AFC A;  3F8K A;  4E8O A;  4P4I A;  1IOF A;  4KS9 A;  5F46 A;  1PUA A;  1YVK A;  2LGR A;  2GU2 A;  4F0X A;  3S6G A;  1IOI A;  3EWQ A;  2XEF A;  4JD6 A;  1QSM A;  4ABK A;  4FWU A;  4L8A A;  2W2G A;  4NJQ A;  1BAV A;  2AFS A;  4TWE A;  2OOT A;  1NE9 A;  2Q4Z A;  2AFM A;  3LWU A;  5AG5 A;  1ZLH A;  2FAV A;  2D4P A;  4Y49 C;  3TOB A;  4YWY A;  3JTK A;  5HIH A;  2R1I A;  3R96 A;  1KUY A;  1LFW A;  1LOK A;  2CNM A;  4A37 A;  2JDD A;  1RO5 A;  2VBQ A;  5LYD A;  3FMC A;  3BJ7 A;  1YW6 A;  4GM5 A;  4B12 A;  2DEA A;  2EEE A;  3I1U A;  5CB5 A;  3KR4 A;  2ZEE A;  3KI9 A;  1YW4 A;  4UFW A;  3SJE A;  3V8I A;  3ZZI A;  5HVG A;  2QJ8 A;  4X2T A;  1ELM P;  2ZEN A;  3TO7 A;  1JWQ A;  4RUH A;  3F0A A;  3B3V A;  4G1P A;  4CRZ B;  5JPH A;  3EY5 A;  2PC1 A;  2V8G A;  2X47 A;  1AUG A;  2Q43 A;  5JM6 A;  2JZF A;  2GIV A;  2PIY A;  3H8G A;  3LOD A;  4NSQ A;  1B87 A;  1RXT A;  4X5K A;  3PZJ A;  4FD5 A;  4PPZ A;  1JQG A;  3JVN A;  4AVC A;  5KTC A;  2OH1 A;  3CPA A;  4CAF A;  2B4D B;  2XEI A;  1YQE A;  5FSZ A;  3R1K A;  3EJG A;  1LAM A;  1PCA A;  3B2Y A;  3DGV A;  3T90 A;  2Y0M A;  4GXH A;  3KQX A;  1Z4E A;  2GLJ A;  3D68 A;  2FXF A;  1SPV A;  4OC3 A;  2PDO A;  4KOS A;  4PSX A;  5J8C A;  1Z8X A;  3IWE A;  2O4H A;  4M6H A;  1J4J A;  3PB7 X;  3C26 A;  3QNV A;  3S9M A;  5DWN A;  3SI0 A;  1TF8 A;  1M4L A;  5E96 A;  1BO4 A;  4JLY A;  3DLJ A;  4PXE A;  3EWR A;  5K8M A;  2PCU A;  3V7Z A;  2EO8 A;  2A4N A;  4KYB A;  4B13 A;  3UY5 A;  4DYO A;  4F9V A;  3VFQ A;  2EVN A;  4HNX B;  4KOU A;  4CGO A;  4KOV A;  4QUS A;  2Z3O A;  4RS2 A;  5JQ4 A;  4FUU A;  4IF5 A;  1FT7 A;  3V45 A;  1HEE A;  2Q4V A;  4NJR A;  3T8W A;  4P45 A;  1OBR A;  3ZJ0 A;  1UWY A;  2V77 A;  1Y0Y A;  2Q7B A;  4BBH A;  1Z8T A;  1YD9 A;  2AE6 A;  2ODF A;  3MGD A;  4JCA A;  4CYP A;  4Q36 A;  4UML A;  2NSM A;  2ATR A;  3G3S A;  4FD7 A;  2WSA A;  4NGT A;  2VEZ A;  2G3A A;  4P4F A;  3H8F A;  3SII A;  4J3G A;  4MFQ A;  2JEV A;  2ZOG A;  3PB6 X;  2WZN A;  2PJ8 A;  4OC2 A;  3BHX A;  4MHZ A;  4GVW A;  4RN7 A;  1BLL E;  3DDD A;  4OC1 A;  3ETI A;  3GPO A;  1IID A;  2IJZ A;  2BFQ A;  3FIX A;  4KOW A;  4PV6 A;  3WAB A;  2ZED A;  4B10 A;  3OWC A;  3TT2 A;  3KL9 A;  1Z5R A;  2OZG A;  2REF A;  3D67 A;  2ZEP A;  4B5P B;  1GHE A;  5CB3 A;  2FXK A;  2AFW A;  2ZEH A;  3FEE A;  3N7Z A;  4NGS A;  1LRZ A;  2JDC A;  2RFH A;  5J8F A;  2BO9 A;  4JGK A;  2Z3K A;  1QSO A;  4AB7 A;  3FVL A;  1QSR A;  1VIX A;  4M6I A;  1R57 A;  3IGR A;  1TY8 A;  4YGO A;  4BD9 A;  2JLM A;  8CPA A;  2AJ6 A;  2DPS A;  3FJU A;  3SHP A;  3IIF A;  1M4D A;  2B3U A;  3IWG A;  2FS5 A;  5FSV A;  4A95 A;  4K3N A;  4MHP A;  4UWJ A;  2FVG A;  3KHZ A;  1IB1 E;  4XNH C;  3FF3 A;  2IMO A;  2PJ5 A;  3KKW A;  1Y9K A;  2JBJ A;  4CPA A;  1TKH A;  2QVP A;  5EBV A;  4CGL A;  1PYT B;  2YND A;  4B6Z A;  2VL1 A;  4UEE A;  4CS0 B;  4C2Z A;  2BSW A;  2ZW7 A;  3FBU A;  4KLW A;  5LRG A;  4DJL A;  1CPS A;  3RO0 A;  1K4J A;  3B3T A;  4ZX9 A;  2GLF A;  1Z8W A;  3SI1 A;  2QEC A;  5C88 A;  1Q2C A;  4ETK A;  1ZG8 A;  5LRJ A;  4OAE A;  5IV0 A;  3A9L A;  3Q6Z A;  1TF9 A;  2Q44 A;  2BUE A;  5FSY A;  4PXB A;  2Z10 A;  1X12 A;  4U9Y A;  4J5Q A;  3GIU A;  2PVW A;  1DE4 C;  3EC4 A;  3FED A;  3VAR A;  1KUV A;  5AGE A;  4AVA A;  3MN8 A;  4EWT A;  1QQ9 A;  4F9U A;  2P0W A;  2PJA A;  4CAV A;  2D4O A;  3GPQ A;  2Z3M A;  4MY3 A;  3I9S A;  2HUZ A;  3IEH A;  4P4J A;  4PXC A;  3WC6 A;  2K5T A;  4KSA A;  1Z8L A;  1F57 A;  5LRK A;  4AG9 A;  4I49 A;  2ACF A;  4OIW A;  4U9Z A;  1CP6 A;  3EWO A;  4NFR A;  1EE3 P;  4A94 A;  3W6S A;  2BFR A;  3RZA A;  1SQH A;  2EBJ A;  5HH1 A;  1ZLI A;  2NMT A;  4WWV A;  5EMI A;  3S6F A;  2CNT A;  3IU2 A;  2J8R A;  2YGW A;  2WCT A;  5H84 A;  3FXT A;  3PBB A;  5G22 A;  2C6C A;  3V38 A;  2B4B A;  1CX8 A;  3IWW A;  1LAN A;  2AFU A;  3TCV A;  2J8M A;  3S9N A;  2RB7 A; 
#chains in the Genus database with same CATH homology
 2ZEF A;  3MRU A;  5AIL A;  1CBX A;  4LQG A;  4A38 A;  4F8Z A;  5D8N A;  3D7D A;  5HVH A;  3ISZ A;  3CT9 A;  3IJ3 A;  4MRI A;  5LYL A;  3NFZ A;  4OC4 A;  2PJ4 A;  7CPA A;  1AYE A;  5CPA A;  5THW A;  3PB4 X;  5K8P A;  4ZI6 A;  3SJX A;  1NJR A;  3VH9 A;  4W9Y A;  2PJ1 A;  5LYI A;  2ZEL A;  5HOL A;  3CPX A;  4JZ0 A;  4EFD A;  4PQA A;  4MCQ A;  3ISX A;  4MCR A;  5I4M A;  4PXD A;  5K8O A;  2ZOF A;  2XEG A;  3BI0 A;  3TX8 A;  4ESS A;  1ZG9 A;  1IGB A;  3V2B A;  3N5F A;  3KQZ A;  5CMS A;  3WT4 A;  1KWM A;  4NGR A;  3PB8 X;  4AXV A;  2CF4 A;  3GQE A;  1ZG7 A;  1TKF A;  4UEF A;  3GUX A;  2PE3 A;  3PEI A;  4IK2 A;  3D7F A;  1ZR5 A;  3EKE A;  4ZX8 A;  3KHX A;  3IID A;  3KR5 A;  1ZR3 A;  1YLO A;  2PJ3 A;  3JRU A;  2PRQ A;  2VRI A;  5DUS A;  1VHU A;  1CP7 A;  3PB9 X;  5D29 A;  1XJO A;  1YSJ A;  3SJF A;  3SIG A;  2L8R A;  4MHN A;  4P4D A;  4Q7A A;  3SJG A;  1RTQ A;  4IAV A;  2ZEG A;  4R8F A;  1HDU A;  3KAS A;  3PBE A;  4MXU A;  3TC8 A;  2OR4 A;  3LMS A;  3NH5 A;  5DS0 A;  4J5R A;  3H8E A;  1AMP A;  3JZT A;  3NA6 A;  4ABL A;  4OKO A;  1NSA A;  4R7M A;  3SIJ A;  4YU9 A;  3NH4 A;  4NGP A;  3GQO A;  3WC5 A;  4D86 A;  4ZY2 A;  3CDX A;  4FAI A;  4ETJ A;  1BPM A;  4JVV A;  2G9D A;  3FH4 A;  1TKJ A;  1VGY A;  1CPX A;  5JGF A;  3EJF A;  2CTB A;  2V8H A;  1VHO A;  2V8V A;  1Z2L A;  3L2N A;  4P4E A;  3Q71 A;  2AFO A;  1HJZ A;  2AFX A;  4ONW A;  1XFO A;  2XEJ A;  1LAP A;  2JBK A;  1BPN A;  4JYW A;  3WC7 A;  3RAM A;  4EME A;  3GPG A;  1XMB A;  1LCP A;  3PRT A;  3S9L A;  4P10 A;  3GLJ A;  4KSI A;  4Z65 A;  3D66 A;  2PVV A;  2BOA A;  3KGQ A;  4OID A;  1FNO A;  3D7H A;  3PFE A;  2DX6 A;  1R43 A;  4MCS A;  4WJB A;  1XRY A;  2WYR A;  3IFE A;  3HUV A;  4DUK A;  2PJ7 A;  2ZEO A;  2C6P A;  3B3C A;  4ZY1 A;  3HLP A;  5HXD A;  1Y7E A;  4J5S A;  2POK A;  2CIJ A;  4P6Y A;  3KZW A;  3VAT A;  1IY7 A;  4X8I A;  2PJ0 A;  2Q51 A;  2GRE A;  3D7G A;  3PFO A;  1Y0R A;  2CTC A;  3GB0 A;  2F7V A;  3FEC A;  1R3N A;  5FSU A;  5JH9 A;  1DTD A;  4OC5 A;  2ANP A;  3NH8 A;  4O23 A;  4R6T A;  5ELY A;  4UIB A;  3RBU A;  1ELL P;  2HC9 A;  3EW5 A;  3IIB A;  5K8N A;  4GUA A;  1F2P A;  1Q7L A;  2NYQ A;  2F8H A;  3SI2 A;  4K0C A;  4ZYQ A;  2AFZ A;  2HB6 A;  4H2K A;  4J4Z A;  2EK9 A;  4MCP A;  4OP4 A;  4OME A;  4TNU A;  2C6G A;  2PIZ A;  2PJ6 A;  3FX6 A;  2JEW A;  1HDQ A;  4MHY A;  6CPA A;  1XBU A;  5IB9 A;  2IQ6 A;  4MMO A;  1F2O A;  1ARL A;  4TU0 A;  4OC0 A;  3B35 A;  1ARM A;  2ZEM A;  3EWP A;  2V8D A;  4NGM A;  4ZY0 A;  4R76 A;  3K2K A;  2PJ9 A;  5F09 A;  1TXR A;  4A39 A;  3B3W A;  4X3R A;  2PJC A;  2EWB A;  1VHE A;  2PJB A;  1H8L A;  2I3C A;  4NGN A;  3IC1 A;  5E3B A;  3BXM A;  2QYV A;  2O53 A;  4UIA A;  2PJ2 A;  4IQY A;  5J1Q A;  4JLL A;  2ABZ A;  3K9T A;  3D4U A;  4P4B A;  3B3S A;  5HVF A;  5CBM A;  1TXZ A;  2FG1 A;  3SIH A;  1CG2 A;  2C1C A;  5LYF A;  4P44 A;  4FBE A;  2BCO A;  4IHM A;  2EK8 A;  1QMU A;  4UF4 A;  3B7I A;  4GVV A;  3IO1 A;  1GYT A;  2J9A A;  4NGQ A;  4UEZ A;  5FSX A;  1YME A;  2XD7 A;  3BI1 A;  2AFC A;  4P4I A;  2LGR A;  2GU2 A;  3EWQ A;  2XEF A;  4ABK A;  4FWU A;  4NJQ A;  4TWE A;  1BAV A;  2AFS A;  2OOT A;  2Q4Z A;  2AFM A;  3LWU A;  1ZLH A;  2FAV A;  4YWY A;  5HIH A;  1LFW A;  1LOK A;  4A37 A;  5LYD A;  3FMC A;  4GM5 A;  1YW6 A;  2DEA A;  2EEE A;  3I1U A;  5CB5 A;  2ZEE A;  3KR4 A;  3KI9 A;  1YW4 A;  3SJE A;  5HVG A;  2QJ8 A;  4X2T A;  1ELM P;  2ZEN A;  4RUH A;  3B3V A;  4G1P A;  2V8G A;  2X47 A;  2Q43 A;  5JM6 A;  2PIY A;  3H8G A;  4PPZ A;  1JQG A;  3CPA A;  2XEI A;  5FSZ A;  3EJG A;  1LAM A;  1PCA A;  3B2Y A;  3DGV A;  3KQX A;  2GLJ A;  4OC3 A;  3D68 A;  1SPV A;  2O4H A;  3PB7 X;  3QNV A;  3S9M A;  3SI0 A;  1TF8 A;  1M4L A;  4PXE A;  3DLJ A;  3EWR A;  5K8M A;  2PCU A;  3V7Z A;  4KYB A;  4DYO A;  4F9V A;  3VFQ A;  4FUU A;  1FT7 A;  3V45 A;  1HEE A;  4NJR A;  3T8W A;  4P45 A;  1OBR A;  1UWY A;  2V77 A;  1Y0Y A;  1YD9 A;  4JCA A;  4UML A;  2NSM A;  4NGT A;  4P4F A;  3H8F A;  3SII A;  2ZOG A;  3PB6 X;  2WZN A;  2PJ8 A;  4OC2 A;  3BHX A;  4MHZ A;  4GVW A;  1BLL E;  4OC1 A;  3ETI A;  3GPO A;  2IJZ A;  2BFQ A;  3WAB A;  2ZED A;  3KL9 A;  1Z5R A;  3D67 A;  2ZEP A;  2AFW A;  5CB3 A;  2FXK A;  2ZEH A;  4NGS A;  3FEE A;  2RFH A;  2BO9 A;  4JGK A;  3FVL A;  1VIX A;  1TY8 A;  4BD9 A;  8CPA A;  3FJU A;  3IIF A;  5FSV A;  4K3N A;  4MHP A;  2FVG A;  3KHZ A;  3FF3 A;  2IMO A;  2PJ5 A;  2JBJ A;  4CPA A;  1TKH A;  2QVP A;  1PYT B;  4B6Z A;  2VL1 A;  4UEE A;  5LRG A;  4DJL A;  1CPS A;  3B3T A;  4ZX9 A;  2GLF A;  3SI1 A;  4ETK A;  1ZG8 A;  5LRJ A;  3Q6Z A;  1TF9 A;  5FSY A;  4PXB A;  4J5Q A;  2PVW A;  1DE4 C;  3FED A;  3VAR A;  4EWT A;  3MN8 A;  1QQ9 A;  4F9U A;  2PJA A;  3GPQ A;  4PXC A;  3IEH A;  3WC6 A;  4P4J A;  1Z8L A;  1F57 A;  5LRK A;  2ACF A;  4OIW A;  1CP6 A;  3EWO A;  4NFR A;  1EE3 P;  4A94 A;  2BFR A;  3RZA A;  1ZLI A;  4WWV A;  3V38 A;  3PBB A;  2C6C A;  3IWW A;  1CX8 A;  1LAN A;  2AFU A;  3S9N A;  2RB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...