2L8RA

Solution structure of human protein c6orf130 in complex with adp-ribose
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
SSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein C6orf130
publication title Orphan Macrodomain Protein (Human C6orf130) Is an O-Acyl-ADP-ribose Deacylase: SOLUTION STRUCTURE AND CATALYTIC PROPERTIES.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 43
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2011-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 2l8rA01
3JRUA 1YD9A 2VRIA 1LAPA 1NJRA 5E3BA 3EWOA 5CBMA 2J9AA 4ESSA 4TU0A 3IJ3A 5FSYA 3KQXA 3GQEA 4GUAA 4J5RA 4KSIA 5CMSA 2EEEA 5FSZA 2LGRA 3H8EA 3V45A 4D86A 4ZI6A 1BLLE 2FAVA 4JLLA 4ZY0A 4GVWA 5AILA 2X47A 2XD7A 2BFQA 3GQOA 3GPOA 3EWQA 1HJZA 3VFQA 1BPMA 3T8WA 4ZX8A 3EWPA 1ZR5A 1LCPA 3SIHA 1LANA 4KYBA 5FSVA 4R6TA 3V2BA 4X2TA 2FG1A 3H8FA 4R76A 4ABLA 5FSUA 3IIFA 4UMLA 4ETJA 2BFRA 4IQYA 3ETIA 1ZR3A 5FSXA 4J5SA 5D8NA 4JVVA 3KQZA 4K3NA 2L8RA 3IIDA 2AFCA 4JGKA 3KZWA 3EWRA 4JCAA 4ZX9A 1VHUA 3EKEA 3EW5A 4J4ZA 1SPVA 3EJGA 4ZYQA 3SIIA 2ACFA 4ZY1A 3JZTA 3Q71A 4K0CA 1LAMA 1TY8A 2FXKA 3GPGA 5HOLA 3SIGA 3PEIA 3GPQA 4J5QA 3SIJA 5DUSA 4ABKA 2EWBA 3KR4A 1BPNA 4GVVA 4ZY2A 3KR5A 2DX6A 5CB3A 1GYTA 3EJFA 4ETKA 4R7MA 1TXZA 5HIHA 3Q6ZA 5CB5A 3H8GA
chains in the Genus database with same CATH superfamily
3JRUA 1YD9A 2VRIA 1LAPA 1NJRA 5E3BA 3EWOA 5CBMA 2J9AA 4ESSA 4TU0A 3IJ3A 2RNKA 5FSYA 3KQXA 2JZEA 3GQEA 4GUAA 4J5RA 4KSIA 5CMSA 2EEEA 5FSZA 2LGRA 3H8EA 3V45A 4D86A 4ZI6A 1BLLE 2FAVA 4JLLA 4ZY0A 4GVWA 5AILA 2X47A 2XD7A 2BFQA 3GQOA 2W2GA 3GPOA 3EWQA 1HJZA 3VFQA 1BPMA 3T8WA 4ZX8A 3EWPA 1ZR5A 1LCPA 3SIHA 1LANA 4KYBA 5FSVA 4R6TA 3V2BA 4X2TA 2FG1A 3H8FA 4R76A 2KQVA 4ABLA 5FSUA 3IIFA 4UMLA 4ETJA 2BFRA 4IQYA 3ETIA 1ZR3A 5FSXA 4J5SA 5D8NA 4JVVA 3KQZA 4K3NA 2L8RA 3IIDA 2AFCA 4JGKA 3KZWA 3EWRA 4JCAA 4ZX9A 1VHUA 3EKEA 2JZDA 3EW5A 4J4ZA 1SPVA 3EJGA 4ZYQA 3SIIA 2ACFA 4ZY1A 3JZTA 3Q71A 4K0CA 1LAMA 2WCTA 2JZFA 1TY8A 2FXKA 3GPGA 5HOLA 3SIGA 3PEIA 3GPQA 4J5QA 3SIJA 5DUSA 4ABKA 2EWBA 3KR4A 1BPNA 4GVVA 4ZY2A 3KR5A 2DX6A 5CB3A 1GYTA 3EJFA 4ETKA 4R7MA 1TXZA 5HIHA 3Q6ZA 5CB5A 3H8GA
chains in the Genus database with same CATH topology
3JRUA 1YD9A 2VRIA 1LAPA 1NJRA 5E3BA 3EWOA 5CBMA 2J9AA 4ESSA 4TU0A 3IJ3A 5FSYA 3KQXA 3GQEA 4GUAA 4J5RA 4KSIA 5CMSA 2EEEA 5FSZA 2LGRA 3H8EA 3V45A 4D86A 4ZI6A 1BLLE 2FAVA 4JLLA 4ZY0A 4GVWA 5AILA 2X47A 2XD7A 2BFQA 3GQOA 3GPOA 3EWQA 1HJZA 3VFQA 1BPMA 3T8WA 4ZX8A 3EWPA 1ZR5A 1LCPA 3SIHA 1LANA 4KYBA 5FSVA 4R6TA 3V2BA 4X2TA 2FG1A 3H8FA 4R76A 4ABLA 5FSUA 3IIFA 4UMLA 4ETJA 2BFRA 4IQYA 3ETIA 1ZR3A 5FSXA 4J5SA 5D8NA 4JVVA 3KQZA 4K3NA 2L8RA 3IIDA 2AFCA 4JGKA 3KZWA 3EWRA 4JCAA 4ZX9A 1VHUA 3EKEA 3EW5A 4J4ZA 1SPVA 3EJGA 4ZYQA 3SIIA 2ACFA 4ZY1A 3JZTA 3Q71A 4K0CA 1LAMA 1TY8A 2FXKA 3GPGA 5HOLA 3SIGA 3PEIA 3GPQA 4J5QA 3SIJA 5DUSA 4ABKA 2EWBA 3KR4A 1BPNA 4GVVA 4ZY2A 3KR5A 2DX6A 5CB3A 1GYTA 3EJFA 4ETKA 4R7MA 1TXZA 5HIHA 3Q6ZA 5CB5A 3H8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRU A;  1YD9 A;  2VRI A;  1LAP A;  1NJR A;  5E3B A;  3EWO A;  5CBM A;  2J9A A;  4ESS A;  4TU0 A;  3IJ3 A;  5FSY A;  3KQX A;  3GQE A;  4GUA A;  4J5R A;  4KSI A;  5CMS A;  2EEE A;  5FSZ A;  2LGR A;  3H8E A;  3V45 A;  4D86 A;  4ZI6 A;  1BLL E;  2FAV A;  4JLL A;  4ZY0 A;  4GVW A;  5AIL A;  2X47 A;  2XD7 A;  2BFQ A;  3GQO A;  3GPO A;  3EWQ A;  1HJZ A;  3VFQ A;  1BPM A;  3T8W A;  4ZX8 A;  3EWP A;  1ZR5 A;  1LCP A;  3SIH A;  1LAN A;  4KYB A;  5FSV A;  4R6T A;  3V2B A;  4X2T A;  2FG1 A;  3H8F A;  4R76 A;  4ABL A;  5FSU A;  3IIF A;  4UML A;  4ETJ A;  2BFR A;  4IQY A;  3ETI A;  1ZR3 A;  5FSX A;  4J5S A;  5D8N A;  4JVV A;  3KQZ A;  4K3N A;  2L8R A;  3IID A;  2AFC A;  4JGK A;  3KZW A;  3EWR A;  4JCA A;  4ZX9 A;  1VHU A;  3EKE A;  3EW5 A;  4J4Z A;  1SPV A;  3EJG A;  4ZYQ A;  3SII A;  2ACF A;  4ZY1 A;  3JZT A;  3Q71 A;  4K0C A;  1LAM A;  1TY8 A;  2FXK A;  3GPG A;  5HOL A;  3SIG A;  3PEI A;  3GPQ A;  4J5Q A;  3SIJ A;  5DUS A;  4ABK A;  2EWB A;  3KR4 A;  1BPN A;  4GVV A;  4ZY2 A;  3KR5 A;  2DX6 A;  5CB3 A;  1GYT A;  3EJF A;  4ETK A;  4R7M A;  1TXZ A;  5HIH A;  3Q6Z A;  5CB5 A;  3H8G A; 
#chains in the Genus database with same CATH topology
 3JRU A;  1YD9 A;  2VRI A;  1LAP A;  1NJR A;  5E3B A;  3EWO A;  5CBM A;  2J9A A;  4ESS A;  4TU0 A;  3IJ3 A;  2RNK A;  5FSY A;  3KQX A;  2JZE A;  3GQE A;  4GUA A;  4J5R A;  4KSI A;  5CMS A;  2EEE A;  5FSZ A;  2LGR A;  3H8E A;  3V45 A;  4D86 A;  4ZI6 A;  1BLL E;  2FAV A;  4JLL A;  4ZY0 A;  4GVW A;  5AIL A;  2X47 A;  2XD7 A;  2BFQ A;  3GQO A;  2W2G A;  3GPO A;  3EWQ A;  1HJZ A;  3VFQ A;  1BPM A;  3T8W A;  4ZX8 A;  3EWP A;  1ZR5 A;  1LCP A;  3SIH A;  1LAN A;  4KYB A;  5FSV A;  4R6T A;  3V2B A;  4X2T A;  2FG1 A;  3H8F A;  4R76 A;  2KQV A;  4ABL A;  5FSU A;  3IIF A;  4UML A;  4ETJ A;  2BFR A;  4IQY A;  3ETI A;  1ZR3 A;  5FSX A;  4J5S A;  5D8N A;  4JVV A;  3KQZ A;  4K3N A;  2L8R A;  3IID A;  2AFC A;  4JGK A;  3KZW A;  3EWR A;  4JCA A;  4ZX9 A;  1VHU A;  3EKE A;  2JZD A;  3EW5 A;  4J4Z A;  1SPV A;  3EJG A;  4ZYQ A;  3SII A;  2ACF A;  4ZY1 A;  3JZT A;  3Q71 A;  4K0C A;  1LAM A;  2WCT A;  2JZF A;  1TY8 A;  2FXK A;  3GPG A;  5HOL A;  3SIG A;  3PEI A;  3GPQ A;  4J5Q A;  3SIJ A;  5DUS A;  4ABK A;  2EWB A;  3KR4 A;  1BPN A;  4GVV A;  4ZY2 A;  3KR5 A;  2DX6 A;  5CB3 A;  1GYT A;  3EJF A;  4ETK A;  4R7M A;  1TXZ A;  5HIH A;  3Q6Z A;  5CB5 A;  3H8G A; 
#chains in the Genus database with same CATH homology
 3JRU A;  1YD9 A;  2VRI A;  1LAP A;  1NJR A;  5E3B A;  3EWO A;  5CBM A;  2J9A A;  4ESS A;  4TU0 A;  3IJ3 A;  5FSY A;  3KQX A;  3GQE A;  4GUA A;  4J5R A;  4KSI A;  5CMS A;  2EEE A;  5FSZ A;  2LGR A;  3H8E A;  3V45 A;  4D86 A;  4ZI6 A;  1BLL E;  2FAV A;  4JLL A;  4ZY0 A;  4GVW A;  5AIL A;  2X47 A;  2XD7 A;  2BFQ A;  3GQO A;  3GPO A;  3EWQ A;  1HJZ A;  3VFQ A;  1BPM A;  3T8W A;  4ZX8 A;  3EWP A;  1ZR5 A;  1LCP A;  3SIH A;  1LAN A;  4KYB A;  5FSV A;  4R6T A;  3V2B A;  4X2T A;  2FG1 A;  3H8F A;  4R76 A;  4ABL A;  5FSU A;  3IIF A;  4UML A;  4ETJ A;  2BFR A;  4IQY A;  3ETI A;  1ZR3 A;  5FSX A;  4J5S A;  5D8N A;  4JVV A;  3KQZ A;  4K3N A;  2L8R A;  3IID A;  2AFC A;  4JGK A;  3KZW A;  3EWR A;  4JCA A;  4ZX9 A;  1VHU A;  3EKE A;  3EW5 A;  4J4Z A;  1SPV A;  3EJG A;  4ZYQ A;  3SII A;  2ACF A;  4ZY1 A;  3JZT A;  3Q71 A;  4K0C A;  1LAM A;  1TY8 A;  2FXK A;  3GPG A;  5HOL A;  3SIG A;  3PEI A;  3GPQ A;  4J5Q A;  3SIJ A;  5DUS A;  4ABK A;  2EWB A;  3KR4 A;  1BPN A;  4GVV A;  4ZY2 A;  3KR5 A;  2DX6 A;  5CB3 A;  1GYT A;  3EJF A;  4ETK A;  4R7M A;  1TXZ A;  5HIH A;  3Q6Z A;  5CB5 A;  3H8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...