4R6TA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
total genus 168
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r6tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r6tA02
3KI9A 2PVWA 8CPAA 3D7HA 2ZEDA 1AMPA 2POKA 2HB6A 4G1PA 3PB9X 1HDUA 1ZG9A 4NGMA 4CPAA 1XMBA 4ONWA 1F57A 2V8VA 4TWEA 2NYQA 4B6ZA 4DYOA 4P10A 4F9VA 3GPGA 1ARLA 4R8FA 3CDXA 1IY7A 3V7ZA 3KQXA 5HIHA 1F2PA 4FAIA 4UIBA 5LRJA 2HC9A 4MHPA 2ZEGA 4RUHA 1QMUA 5D29A 4PXDA 3FVLA 4Z65A 2IQ6A 3SI2A 3PB4X 2WZNA 4GM5A 1PYTB 4R7MA 5AILA 1YW6A 2ANPA 1GYTA 4NGPA 1ZLHA 2PJ9A 4NJRA 1R3NA 2GU2A 2PJ4A 2JEWA 4W9YA 3GUXA 3B35A 4NGQA 4JZ0A 4P4DA 2IMOA 4MHNA 2BO9A 2F7VA 3VARA 1YSJA 2VL1A 3PB6X 4NGRA 3GPQA 1AYEA 2C1CA 2XEFA 3RBUA 4K0CA 4KSIA 2CF4A 5HOLA 1TF8A 2G9DA 3SIGA 2C6PA 2ACFA 2CTCA 3HLPA 4ZX9A 3L2NA 4J5RA 2IJZA 4P4BA 3B3CA 4A39A 1R43A 3CPXA 3V45A 4PXBA 2AFUA 3FX6A 2EEEA 1VHOA 4Q7AA 1VHEA 4OC2A 2AFOA 1JQGA 4NGNA 5JGFA 1TXRA 1Z5RA 3MRUA 2AFWA 2ZEEA 5K8NA 4X8IA 4A38A 5HXDA 4A37A 4OKOA 1TY8A 5CMSA 4H2KA 3NH5A 2GREA 2AFZA 3T8WA 3FECA 2ZENA 1BAVA 3FJUA 1BPNA 5CBMA 2LGRA 4KYBA 1IGBA 1Z8LA 2Q4ZA 3IJ3A 5DUSA 3SI0A 2CTBA 3RZAA 3EKEA 4TU0A 4EMEA 3D7FA 3DLJA 2XD7A 4JLLA 4PPZA 5K8MA 2WYRA 5D8NA 1CBXA 1ELLP 4O23A 1BPMA 5K8PA 4UIAA 2ZEFA 3EWOA 2VRIA 1H8LA 3FF3A 4GVVA 2ZOFA 3ETIA 1CP7A 4P44A 1FNOA 3V2BA 3D7GA 5LRKA 4JCAA 1F2OA 2AFSA 4OC4A 4PQAA 2ZEHA 1SPVA 3NH4A 3ISZA 3GLJA 2PRQA 2ZEPA 3PEIA 4MCQA 2RB7A 3PBEA 3S9LA 1CPSA 4MRIA 4OIWA 2JBKA 4LQGA 4ETKA 3GQEA 1M4LA 1Y0RA 3VATA 4ZY2A 1HEEA 1TKFA 3WC5A 4JGKA 1CP6A 2XEIA 1CG2A 3V38A 3K2KA 2FAVA 4ABKA 2DEAA 3BHXA 3SIHA 1HDQA 2V8HA 4AXVA 4R6TA 1KWMA 3CT9A 2L8RA 1ZR5A 3IFEA 4UF4A 5LRGA 3H8GA 2OOTA 1TF9A 1TXZA 4MMOA 1XRYA 1LANA 3HUVA 4IK2A 3EWRA 4ZY1A 3NFZA 4EWTA 2Q51A 3EWPA 2JBJA 3SIIA 5DS0A 2EWBA 3QNVA 2O4HA 2OR4A 2ABZA 2Q43A 5FSYA 3GPOA 2EK9A 3ISXA 3B3WA 1Z2LA 5JM6A 2AFXA 3IIFA 4NGSA 2BCOA 2C6GA 1LAMA 3SJXA 1DTDA 1CX8A 1YD9A 2X47A 2AFMA 2ZELA 4MXUA 1LCPA 3PFEA 2PJ1A 1Q7LA 1UWYA 3VH9A 1TKHA 4ESSA 3BI1A 4NFRA 2PJ3A 4IHMA 1XFOA 3KL9A 3EJGA 7CPAA 4P4JA 6CPAA 5J1QA 4MHZA 5I4MA 1QQ9A 1YMEA 5LYLA 3NH8A 4UEEA 4JYWA 4J4ZA 4UEFA 4WWVA 5LYIA 3FMCA 1VIXA 3H8EA 3D66A 3PB8X 3S9NA 4ABLA 3B3TA 4MCPA 4NJQA 3WT4A 1HJZA 5LYFA 3SIJA 2AFCA 2PIZA 5HVGA 2PJCA 3GB0A 4YWYA 5LYDA 3B7IA 3FH4A 2QYVA 3B2YA 3PB7X 3KR4A 3LWUA 2PJ2A 3KGQA 3LMSA 3KQZA 2GLFA 2PIYA 4ZI6A 4P6YA 3GQOA 3IIBA 4MCRA 4J5QA 5CB5A 4EFDA 5CB3A 5ELYA 3KR5A 1PCAA 2PJ6A 4P4EA 4D86A 2QVPA 5IB9A 1ZR3A 4IAVA 3I1UA 5FSZA 2DX6A 4MCSA 4JVVA 1Y0YA 3JRUA 3VFQA 1CPXA 3CPAA 2ZOGA 1LFWA 2F8HA 3N5FA 1Y7EA 4ETJA 2CIJA 3EW5A 1BLLE 3B3SA 3IIDA 4F8ZA 4X2TA 3IWWA 4DJLA 5K8OA 2C6CA 1ARMA 3IEHA 4FUUA 4P4FA 4X3RA 1ZG7A 4BD9A 4OC1A 3D67A 3MN8A 1LOKA 3KZWA 4YU9A 3DGVA 2PE3A 1FT7A 3S9MA 1OBRA 4F9UA 5HVHA 2NSMA 2PVVA 2J9AA 2EK8A 2FG1A 3EWQA 1ELMP 2ZEOA 2BFRA 3B3VA 4GVWA 3NA6A 3WABA 4FBEA 2QJ8A 2V8DA 1YW4A 4OP4A 5HVFA 1ZG8A 1VHUA 1LAPA 4DUKA 4OC3A 1XJOA 2PCUA 3KHXA 3IC1A 1VGYA 2V77A 2BFQA 3KASA 4P4IA 3D4UA 2PJBA 3FEEA 3PFOA 2ZEMA 3D7DA 4FWUA 2XEJA 4ZYQA 2RFHA 3Q6ZA 3BI0A 4J5SA 2GLJA 4P45A 5F09A 3BXMA 2FXKA 2V8GA 3PRTA 1NSAA 3Q71A 2PJ0A 4NGTA 3WC6A 2PJ7A 5FSVA 3PBBA 4OC5A 2PJ5A 3JZTA 3SI1A 3WC7A 2BOAA 1DE4C 4R76A 4OC0A 5FSXA 3TX8A 2I3CA 3EJFA 3TC8A 4ZX8A 4GUAA 3D68A 4MHYA 5JH9A 3SJEA 4K3NA 1XBUA 2FVGA 3FEDA 3RAMA 4A94A 2PJ8A 2PJAA 3SJGA 1TKJA 5THWA 4PXEA 5FSUA 4PXCA 3SJFA 4TNUA 5E3BA 3K9TA 2XEGA 4UMLA 1EE3P 4WJBA 4OMEA 4ZY0A 2O53A 4UEZA 4IQYA 3H8FA 3KHZA 4OIDA 5CPAA 1YLOA 3IO1A 1ZLIA 1RTQA 1NJRA
chains in the Genus database with same CATH superfamily
3KI9A 4CRZB 2PVWA 8CPAA 2FS5A 3D7HA 2Z11A 3RYOA 2ZEDA 1RXTA 1AMPA 3I3GA 2PR8A 2POKA 1XEBA 4RN7A 2B3UA 2I79A 2HB6A 4G1PA 3PB9X 1HDUA 2H5MA 1ZG9A 4NGMA 1K4JA 4CPAA 1XMBA 2QECA 4ONWA 1F57A 2V8VA 4TWEA 2NYQA 1L0CA 4B6ZA 4IUSA 1QSTA 4DYOA 4R9MA 4AVCA 4P10A 4CYOA 5EBVA 4C2YA 4F9VA 3GPGA 1ARLA 5I0CA 4KVXA 3TTHA 2FCKA 4PV6A 3WR7A 4R8FA 3CDXA 1IY7A 3V7ZA 3KQXA 5HIHA 1F2PA 4FAIA 1IU8A 2G0BA 4II9A 3IU2A 2Z3PA 4UIBA 5LRJA 2HC9A 3PZJA 4MHPA 4UFWA 2ZEGA 4FD4A 4RUHA 1QMUA 5D29A 2C27A 4ZGYB 1U6MA 4PXDA 3FVLA 4Z65A 1S7FA 3G3SA 1P4NA 2IQ6A 3PB4X 2WZNA 4GM5A 3SI2A 3R95A 1OZPA 1PYTB 1JWQA 1M4DA 4R7MA 4FD6A 4UA3A 5AILA 3SXNA 1YW6A 2ANPA 2Z0ZA 4ORFA 3RO0A 4B10A 4MFLA 3ZJ0A 3C26A 4HNYB 2IL4A 1GYTA 2B4DA 2GIVA 2HUZA 4NGPA 4B12A 1ZLHA 2PJ9A 4B5OA 2Q4VA 2X7BA 2DPTA 3BJ8A 4LQ6A 4NJRA 1R3NA 2GU2A 2PJ4A 4CGMA 4CYNA 4KLVA 1RO5A 2JEWA 4W9YA 1Y7RA 3GUXA 3B35A 4NGQA 4JZ0A 1Q2CA 2Q7BA 3SXOA 4P4DA 2IMOA 3F8KA 2WCTA 4MI4A 4KOSA 4NCZA 4MHNA 2CXAA 4BBHA 2BO9A 2F7VA 3DDDA 1YSJA 3VARA 4XNHB 2VL1A 3W91A 5J8CA 1YR0A 3PB6X 4NGRA 4CGNA 4MHDA 3GPQA 1AYEA 2C1CA 2XEFA 4C7IA 3RBUA 4K0CA 4KSIA 2CF4A 2JDDA 5HOLA 2EBJA 2EUIA 1SQHA 2FT0A 2JEVA 5F49A 4B14A 1TF8A 4CGLA 2G9DA 2Z3MA 4M6IA 3SIGA 3H5ZA 2PR1A 5H86A 3T9YA 2C6PA 3B8GA 2ACFA 2CTCA 3HLPA 3R9GA 2VQYA 3D8PA 3IWGA 4CS0B 5F46A 1IYKA 4ZX9A 4PSWA 3L2NA 4KZTA 4J5RA 2IJZA 3IU1A 4P4BA 3B3CA 4A39A 5IX3A 1R43A 3CPXA 3I9SA 3F5BA 3V45A 4KSAA 2RC4A 2ZW7A 4PXBA 3QB8A 4KVOE 1YVKA 4JXQA 2OZHA 2AFUA 3FX6A 5F47A 3TE4A 2EEEA 1VHOA 4Q7AA 4E8OA 1M44A 1IOIA 1VHEA 4F0XA 4OC2A 4CAXA 2AFOA 1JQGA 4NGNA 5JGFA 2DXQA 1XE4A 4R3KA 4MBUA 1TXRA 2OU2A 1Z5RA 2FSRA 2PC1A 2FIWA 3MRUA 2AFWA 2GE3A 2ZEEA 5K8NA 4X8IA 4A38A 3R1KA 4A37A 5HXDA 4QVTA 4OKOA 1TY8A 5CMSA 4H2KA 1ZO0A 3NH5A 4CAFA 2GREA 2AFZA 4DNCA 3T8WA 3FECA 2ZENA 1BAVA 1V0CA 3FJUA 4LUAA 1VHSA 3CZXA 1BO4A 1BPNA 5CBMA 1IIDA 2R98A 3D2MA 2LGRA 4KYBA 1IGBA 1B87A 1Z8LA 1S7NA 3IJ3A 5DUSA 2G3AA 1I12A 2Q4ZA 3MGDA 3SI0A 2CTBA 3RZAA 3EKEA 2ZW5A 4TU0A 4MJ8A 4EMEA 3G8WA 3D7FA 3DLJA 2P0WA 3N7ZA 5F48A 2XD7A 4JLLA 1S7KA 2Q4YA 4H6ZA 4PPZA 5K8MA 3P2HA 2WYRA 5D8NA 2D4PA 3EFAA 4JWPA 4UCMA 1CBXA 1ELLP 2ATRA 4HPSA 3R9EA 2A4NA 3FYNA 1BPMA 2BSWA 4M6HA 4O23A 5K8PA 1IB1E 2FXFA 3D3SA 2RNKA 4UIAA 3S6FA 2JZEA 2Q0YA 2ZEFA 1Z9UA 3T90A 1YX0A 2JLMA 4JJXA 3K9UA 3EWOA 2VRIA 3TO6A 5KTDA 1H8LA 1YLEA 3FF3A 4A31A 2AE6A 4GVVA 2ZOFA 3ETIA 4XPDC 2FIAA 1CP7A 4P44A 1FNOA 2P6GA 3R96A 3V2BA 3CXPA 3D7GA 3TO7A 5LRKA 2WUUA 2B58A 4JCAA 4NSQA 1F2OA 4U5YA 1S3ZA 2AFSA 4OC4A 3S6KA 4A32A 5KTCA 4KOXA 2AJ6A 4LX9A 5AG7A 3OWCA 1YQEA 4PQAA 2G3TA 2ZEHA 1Y9WA 1SPVA 3NH4A 2PSWA 1M1DA 1Q2DA 1X10A 5AG4A 3ISZA 3LACA 1X12A 2YNDA 3GLJA 2PRQA 4CAEA 2ZEPA 4QB9A 4AB7A 4X5KA 3PEIA 2YNCA 4MCQA 1Z8TA 2RB7A 1Z4RA 4UFVA 3PBEA 1KUYA 4KLWA 3S9LA 1CPSA 4KUBA 3ZZIA 4MRIA 5J8FA 4OIWA 2JBKA 4LQGA 3BJ7A 4MY3A 4ETKA 3TCVA 1NSLA 3GQEA 3R9FA 1M4LA 1YK3A 3VWDA 1Y0RA 3VATA 4ZY2A 3TOAA 5AGEA 2VZZA 3EXNA 1HEEA 2OZGA 4KOWA 4L89A 3PP9A 1WK4A 3DNSA 1TKFA 3V8IA 1S7LA 4JGKA 2Z3OA 2Y0MA 3WC5A 2F5IA 1CP6A 2XEIA 1CG2A 3V38A 3K2KA 1XIXA 2FAVA 4ABKA 1MJ9A 2DEAA 3SIHA 1HDQA 2V8HA 3BHXA 3IGRA 4AXVA 2NMTA 4NF1A 5EC4A 4R6TA 2BEIA 1KWMA 3CT9A 2L8RA 1ZR5A 3IFEA 4UF4A 5LRGA 2J8NA 3H8GA 4QBJA 5AG6A 1TF9A 1Y9KA 1TXZA 4FD5A 4UCPA 2OOTA 1Z4EA 4MY0A 1CM0A 4MMOA 1XRYA 2PQ8A 1LANA 3HUVA 4YFJA 4IK2A 3EWRA 4ZY1A 3NFZA 4OADA 4EWTA 1TIQA 1CJWA 2Q51A 3EWPA 1KZFA 2GANA 3JUWA 1IICA 3SIIA 2JBJA 5GCNA 2JDCA 1IYLA 2VZYA 5DS0A 2EWBA 3QNVA 2O4HA 4FD7A 2HQYA 4B11A 2OR4A 5ISVA 2ABZA 2Q43A 2Q7SA 5FSYA 3GPOA 1FY7A 2EK9A 3DR6A 4MFPA 3ISXA 3B3WA 1Z2LA 5JM6A 2AFXA 3IIFA 4NGSA 1VKCA 4KUAA 3UY5A 2BCOA 2C6GA 1LAMA 4C7HA 3SJXA 1DTDA 1CX8A 1YD9A 4HNWB 2X47A 4IF5A 3CXSA 4MFZA 2AFMA 2ZELA 1UFHA 4MXUA 1LCPA 5A27A 3PFEA 5FVJA 2B3VA 2PJ1A 1Q7LA 1UWYA 4GXHA 3VH9A 4Y49C 1TKHA 4ESSA 3BI1A 4NFRA 4UBRA 4UWJA 2PDOA 3A9LA 4M6GA 3FXTA 2P6FA 2FL4A 4AVAA 2ZW6A 4CGOA 2PJ3A 1NE9A 4IHMA 1S60A 1XFOA 4Q36A 3KL9A 3EJGA 5DWMA 7CPAA 4P4JA 6CPAA 5AG5A 3TO9A 3LODA 5J1QA 4MHZA 4MFKA 4A30A 2KQVA 1QQ9A 1YMEA 5H84A 5I4MA 2W2GA 5LYLA 4C2XA 4A33A 2CNSA 3NH8A 2Q04A 3P2FA 4UEEA 4JYWA 4J4ZA 3E0KA 2J8MA 4UEFA 3PGPA 4WWVA 5LYIA 5BWAB 3FMCA 1R57A 1VIXA 2ODFA 4R57A 3H8EA 1XMTA 3D66A 3PB8X 5HH1A 3EC4A 1YGHA 3S9NA 1Z8WA 4ABLA 4H6UA 1XOVA 3B3TA 4MCPA 4NJQA 3WT4A 1HJZA 5LYFA 3SIJA 2AFCA 4AVBA 4CYPA 2PIZA 5HVGA 4CRYB 2PJCA 4BINA 3GB0A 2FE7A 4YWYA 4K30A 1ON0A 1QSOA 5LYDA 3B7IA 2ZXVA 3FH4A 2QYVA 4NEXA 3B2YA 3PB7X 3KR4A 2K5TA 2PJ2A 2YGWA 3FNCA 3KGQA 3LWUA 3LMSA 3KQZA 2GLFA 3FBUA 2PIYA 3H4QA 1S5KA 5A28A 4ZI6A 3GIUA 2JZDA 3GQOA 4J3GA 4KOTA 4KS9A 4P6YA 3IIBA 2GFQA 3TOBA 4MCRA 4J5QA 4HKFA 2OB0A 5CB5A 5G22A 1YREA 4EFDA 3IWEA 2OH1A 5CB3A 5ELYA 4JLYA 3KR5A 1KUXA 4PK3A 4E2AA 2P6EA 4YGOA 1PCAA 2PJ6A 4P4EA 4XPKA 4D86A 4F0YA 2QVPA 5IB9A 1ZR3A 4IAVA 3CXQA 4JXRA 3I1UA 5FSZA 2DX6A 4MCSA 4JVVA 1Y0YA 2D4OA 3JRUA 1Q2YA 2YNEA 3NE8A 4MFQA 5CNPA 3VFQA 5G21A 1CPXA 1QSMA 3CPAA 2WPXA 1P0HA 1LFWA 2F8HA 2ZOGA 3GYAA 3N5FA 5EMIA 1Y7EA 4I49A 4ETJA 2CIJA 3EW5A 5KTAA 2Z3NA 4CAVA 1BLLE 3S6GA 3B3SA 3IIDA 4XPDB 4F8ZA 4X2TA 3IWWA 4DJLA 4JD6A 5K8OA 4L8AA 2C6CA 1ARMA 3IEHA 4FUUA 4GS4A 4P4FA 4X3RA 4AG7A 3D2PA 1ZG7A 4XNHC 3GKRA 4BD9A 3F0AA 4OC1A 3EY5A 3D67A 1MK4A 3MN8A 1LOKA 1N71A 3KZWA 4OLLA 3DGVA 4YU9A 3SHPA 2PE3A 3FIXA 1M4GA 1FT7A 3S9MA 1OBRA 1PU9A 4F9UA 5IV0A 5HVHA 2NSMA 3W6SA 2PVVA 2ZPAA 2J9AA 4R3LA 2EK8A 2FG1A 3EWQA 1ELMP 2ZEOA 2BFRA 3B3VA 4GVWA 2R8VA 3NA6A 4H89A 1XF8A 5IB0A 1Z8XA 4NXYA 1I1DA 4E0AA 1AUGA 1WWZA 2EVNA 3WABA 4AG9A 2QJ8A 2V8DA 1YW4A 4OP4A 5HVFA 4FBEA 4KOVA 5G1ZA 4U9ZA 4F6AA 4BMHA 5C82A 1ZG8A 4KSFA 5E96A 1VHUA 1J4JA 2J8RA 2B5GB 4A95A 1LAPA 4ONUA 4DUKA 4C68A 4OC3A 1XJOA 2PCUA 3KHXA 3IC1A 1VGYA 2V77A 3S6HA 4UFXA 3VWEA 2BFQA 3KASA 4P4IA 3D4UA 2PJBA 2B4BA 2Q44A 3GY9A 3FEEA 3PFOA 3QAYA 3DR8A 1I21A 4PSXA 3BLNA 2ZEMA 1B6BA 3D7DA 4FWUA 4M85A 5DWNA 5HMNA 2JZFA 2XEJA 2CNMA 3DSBA 4UCNA 2OZUA 4Q38A 4ZYQA 2RFHA 1KUVA 4B13A 3Q6ZA 4B5PB 3BI0A 4J5SA 2GLJA 1QSRA 4P45A 5F09A 3BXMA 4YRHA 2FXKA 2V8GA 2YNCC 2ZW4A 3PRTA 2Z10A 2QIRA 1NSAA 3FB3A 4CGPA 3QAHA 3RNZA 4RI1A 3Q71A 2PJ0A 4NGTA 3LD2A 3WC6A 2DPSA 2PJ7A 4A2ZA 4U9YA 1PUAA 4RS2A 5FSVA 3PBBA 2Z3LA 3KKWA 3JTKA 2EO8A 1IOFA 1BOBA 1QSNA 4KVME 4OC5A 2PJ5A 2WSAA 3JZTA 4XPLA 3SI1A 3WC7A 2BOAA 1DE4C 2CNTA 4R76A 2O28A 4OC0A 4KOYA 5FSXA 3TX8A 2I3CA 3EJFA 2ARHA 2CY2A 4MFJA 4EVYA 3TC8A 4C2ZA 2REFA 1MJAA 4ZX8A 1GHEA 2WPWA 3FRMA 5G20A 2REEA 4GUAA 3EO4A 3D68A 3W6XA 4KORA 4UWIA 4MHYA 5JH9A 2HV2A 4PK2A 4CYQA 2Z3KA 2PRBA 3SJEA 4K3NA 1XBUA 2FVGA 3FEDA 3RAMA 1MJBA 4A94A 2PJ8A 1M4IA 5JPHA 1NMTA 2R1IA 2PJAA 4Y49B 3SJGA 1TKJA 2VEZA 5THWA 1A2ZA 4PXEA 2KCWA 2B4DB 2R7HA 2B5GA 5FSUA 2QMLA 4HNXB 4PXCA 4QC6A 2BUEA 2VBQA 3TFYA 3SJFA 2VI7A 4TNUA 5E3BA 3K9TA 2XEGA 4UMLA 1EE3P 4QUSA 3TT2A 4WJBA 2BL1A 4ZY0A 4KOUA 1YVOA 4OMEA 2O53A 4UEZA 4IQYA 3H8FA 3KHZA 4ZBGA 5C88A 4OAEA 4CAWA 5JQ4A 4OIDA 5CPAA 3JVNA 1YLOA 4R87A 3NE7A 2I00A 2DF5A 1LRZA 1ZLIA 1RTQA 1NJRA 2VXKA 3IO1A 4M3SA 4B5PA
chains in the Genus database with same CATH topology
3KI9A 2PVWA 8CPAA 3D7HA 2ZEDA 1AMPA 2POKA 2HB6A 4G1PA 3PB9X 1HDUA 1ZG9A 4NGMA 4CPAA 1XMBA 4ONWA 1F57A 2V8VA 4TWEA 2NYQA 4B6ZA 4DYOA 4P10A 4F9VA 3GPGA 1ARLA 4R8FA 3CDXA 1IY7A 3V7ZA 3KQXA 5HIHA 1F2PA 4FAIA 4UIBA 5LRJA 2HC9A 4MHPA 2ZEGA 4RUHA 1QMUA 5D29A 4PXDA 3FVLA 4Z65A 2IQ6A 3SI2A 3PB4X 2WZNA 4GM5A 1PYTB 4R7MA 5AILA 1YW6A 2ANPA 1GYTA 4NGPA 1ZLHA 2PJ9A 4NJRA 1R3NA 2GU2A 2PJ4A 2JEWA 4W9YA 3GUXA 3B35A 4NGQA 4JZ0A 4P4DA 2IMOA 4MHNA 2BO9A 2F7VA 3VARA 1YSJA 2VL1A 3PB6X 4NGRA 3GPQA 1AYEA 2C1CA 2XEFA 3RBUA 4K0CA 4KSIA 2CF4A 5HOLA 1TF8A 2G9DA 3SIGA 2C6PA 2ACFA 2CTCA 3HLPA 4ZX9A 3L2NA 4J5RA 2IJZA 4P4BA 3B3CA 4A39A 1R43A 3CPXA 3V45A 4PXBA 2AFUA 3FX6A 2EEEA 1VHOA 4Q7AA 1VHEA 4OC2A 2AFOA 1JQGA 4NGNA 5JGFA 1TXRA 1Z5RA 3MRUA 2AFWA 2ZEEA 5K8NA 4X8IA 4A38A 5HXDA 4A37A 4OKOA 1TY8A 5CMSA 4H2KA 3NH5A 2GREA 2AFZA 3T8WA 3FECA 2ZENA 1BAVA 3FJUA 1BPNA 5CBMA 2LGRA 4KYBA 1IGBA 1Z8LA 2Q4ZA 3IJ3A 5DUSA 3SI0A 2CTBA 3RZAA 3EKEA 4TU0A 4EMEA 3D7FA 3DLJA 2XD7A 4JLLA 4PPZA 5K8MA 2WYRA 5D8NA 1CBXA 1ELLP 4O23A 1BPMA 5K8PA 4UIAA 2ZEFA 3EWOA 2VRIA 1H8LA 3FF3A 4GVVA 2ZOFA 3ETIA 1CP7A 4P44A 1FNOA 3V2BA 3D7GA 5LRKA 4JCAA 1F2OA 2AFSA 4OC4A 4PQAA 2ZEHA 1SPVA 3NH4A 3ISZA 3GLJA 2PRQA 2ZEPA 3PEIA 4MCQA 2RB7A 3PBEA 3S9LA 1CPSA 4MRIA 4OIWA 2JBKA 4LQGA 4ETKA 3GQEA 1M4LA 1Y0RA 3VATA 4ZY2A 1HEEA 1TKFA 3WC5A 4JGKA 1CP6A 2XEIA 1CG2A 3V38A 3K2KA 2FAVA 4ABKA 2DEAA 3BHXA 3SIHA 1HDQA 2V8HA 4AXVA 4R6TA 1KWMA 3CT9A 2L8RA 1ZR5A 3IFEA 4UF4A 5LRGA 3H8GA 2OOTA 1TF9A 1TXZA 4MMOA 1XRYA 1LANA 3HUVA 4IK2A 3EWRA 4ZY1A 3NFZA 4EWTA 2Q51A 3EWPA 2JBJA 3SIIA 5DS0A 2EWBA 3QNVA 2O4HA 2OR4A 2ABZA 2Q43A 5FSYA 3GPOA 2EK9A 3ISXA 3B3WA 1Z2LA 5JM6A 2AFXA 3IIFA 4NGSA 2BCOA 2C6GA 1LAMA 3SJXA 1DTDA 1CX8A 1YD9A 2X47A 2AFMA 2ZELA 4MXUA 1LCPA 3PFEA 2PJ1A 1Q7LA 1UWYA 3VH9A 1TKHA 4ESSA 3BI1A 4NFRA 2PJ3A 4IHMA 1XFOA 3KL9A 3EJGA 7CPAA 4P4JA 6CPAA 5J1QA 4MHZA 5I4MA 1QQ9A 1YMEA 5LYLA 3NH8A 4UEEA 4JYWA 4J4ZA 4UEFA 4WWVA 5LYIA 3FMCA 1VIXA 3H8EA 3D66A 3PB8X 3S9NA 4ABLA 3B3TA 4MCPA 4NJQA 3WT4A 1HJZA 5LYFA 3SIJA 2AFCA 2PIZA 5HVGA 2PJCA 3GB0A 4YWYA 5LYDA 3B7IA 3FH4A 2QYVA 3B2YA 3PB7X 3KR4A 3LWUA 2PJ2A 3KGQA 3LMSA 3KQZA 2GLFA 2PIYA 4ZI6A 4P6YA 3GQOA 3IIBA 4MCRA 4J5QA 5CB5A 4EFDA 5CB3A 5ELYA 3KR5A 1PCAA 2PJ6A 4P4EA 4D86A 2QVPA 5IB9A 1ZR3A 4IAVA 3I1UA 5FSZA 2DX6A 4MCSA 4JVVA 1Y0YA 3JRUA 3VFQA 1CPXA 3CPAA 2ZOGA 1LFWA 2F8HA 3N5FA 1Y7EA 4ETJA 2CIJA 3EW5A 1BLLE 3B3SA 3IIDA 4F8ZA 4X2TA 3IWWA 4DJLA 5K8OA 2C6CA 1ARMA 3IEHA 4FUUA 4P4FA 4X3RA 1ZG7A 4BD9A 4OC1A 3D67A 3MN8A 1LOKA 3KZWA 4YU9A 3DGVA 2PE3A 1FT7A 3S9MA 1OBRA 4F9UA 5HVHA 2NSMA 2PVVA 2J9AA 2EK8A 2FG1A 3EWQA 1ELMP 2ZEOA 2BFRA 3B3VA 4GVWA 3NA6A 3WABA 4FBEA 2QJ8A 2V8DA 1YW4A 4OP4A 5HVFA 1ZG8A 1VHUA 1LAPA 4DUKA 4OC3A 1XJOA 2PCUA 3KHXA 3IC1A 1VGYA 2V77A 2BFQA 3KASA 4P4IA 3D4UA 2PJBA 3FEEA 3PFOA 2ZEMA 3D7DA 4FWUA 2XEJA 4ZYQA 2RFHA 3Q6ZA 3BI0A 4J5SA 2GLJA 4P45A 5F09A 3BXMA 2FXKA 2V8GA 3PRTA 1NSAA 3Q71A 2PJ0A 4NGTA 3WC6A 2PJ7A 5FSVA 3PBBA 4OC5A 2PJ5A 3JZTA 3SI1A 3WC7A 2BOAA 1DE4C 4R76A 4OC0A 5FSXA 3TX8A 2I3CA 3EJFA 3TC8A 4ZX8A 4GUAA 3D68A 4MHYA 5JH9A 3SJEA 4K3NA 1XBUA 2FVGA 3FEDA 3RAMA 4A94A 2PJ8A 2PJAA 3SJGA 1TKJA 5THWA 4PXEA 5FSUA 4PXCA 3SJFA 4TNUA 5E3BA 3K9TA 2XEGA 4UMLA 1EE3P 4WJBA 4OMEA 4ZY0A 2O53A 4UEZA 4IQYA 3H8FA 3KHZA 4OIDA 5CPAA 1YLOA 3IO1A 1ZLIA 1RTQA 1NJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KI9 A;  2PVW A;  8CPA A;  3D7H A;  2ZED A;  1AMP A;  2POK A;  2HB6 A;  4G1P A;  3PB9 X;  1HDU A;  1ZG9 A;  4NGM A;  4CPA A;  1XMB A;  4ONW A;  1F57 A;  2V8V A;  4TWE A;  2NYQ A;  4B6Z A;  4DYO A;  4P10 A;  4F9V A;  3GPG A;  1ARL A;  4R8F A;  3CDX A;  1IY7 A;  3V7Z A;  3KQX A;  5HIH A;  1F2P A;  4FAI A;  4UIB A;  5LRJ A;  2HC9 A;  4MHP A;  2ZEG A;  4RUH A;  1QMU A;  5D29 A;  4PXD A;  3FVL A;  4Z65 A;  2IQ6 A;  3SI2 A;  3PB4 X;  2WZN A;  4GM5 A;  1PYT B;  4R7M A;  5AIL A;  1YW6 A;  2ANP A;  1GYT A;  4NGP A;  1ZLH A;  2PJ9 A;  4NJR A;  1R3N A;  2GU2 A;  2PJ4 A;  2JEW A;  4W9Y A;  3GUX A;  3B35 A;  4NGQ A;  4JZ0 A;  4P4D A;  2IMO A;  4MHN A;  2BO9 A;  2F7V A;  3VAR A;  1YSJ A;  2VL1 A;  3PB6 X;  4NGR A;  3GPQ A;  1AYE A;  2C1C A;  2XEF A;  3RBU A;  4K0C A;  4KSI A;  2CF4 A;  5HOL A;  1TF8 A;  2G9D A;  3SIG A;  2C6P A;  2ACF A;  2CTC A;  3HLP A;  4ZX9 A;  3L2N A;  4J5R A;  2IJZ A;  4P4B A;  3B3C A;  4A39 A;  1R43 A;  3CPX A;  3V45 A;  4PXB A;  2AFU A;  3FX6 A;  2EEE A;  1VHO A;  4Q7A A;  1VHE A;  4OC2 A;  2AFO A;  1JQG A;  4NGN A;  5JGF A;  1TXR A;  1Z5R A;  3MRU A;  2AFW A;  2ZEE A;  5K8N A;  4X8I A;  4A38 A;  5HXD A;  4A37 A;  4OKO A;  1TY8 A;  5CMS A;  4H2K A;  3NH5 A;  2GRE A;  2AFZ A;  3T8W A;  3FEC A;  2ZEN A;  1BAV A;  3FJU A;  1BPN A;  5CBM A;  2LGR A;  4KYB A;  1IGB A;  1Z8L A;  2Q4Z A;  3IJ3 A;  5DUS A;  3SI0 A;  2CTB A;  3RZA A;  3EKE A;  4TU0 A;  4EME A;  3D7F A;  3DLJ A;  2XD7 A;  4JLL A;  4PPZ A;  5K8M A;  2WYR A;  5D8N A;  1CBX A;  1ELL P;  4O23 A;  1BPM A;  5K8P A;  4UIA A;  2ZEF A;  3EWO A;  2VRI A;  1H8L A;  3FF3 A;  4GVV A;  2ZOF A;  3ETI A;  1CP7 A;  4P44 A;  1FNO A;  3V2B A;  3D7G A;  5LRK A;  4JCA A;  1F2O A;  2AFS A;  4OC4 A;  4PQA A;  2ZEH A;  1SPV A;  3NH4 A;  3ISZ A;  3GLJ A;  2PRQ A;  2ZEP A;  3PEI A;  4MCQ A;  2RB7 A;  3PBE A;  3S9L A;  1CPS A;  4MRI A;  4OIW A;  2JBK A;  4LQG A;  4ETK A;  3GQE A;  1M4L A;  1Y0R A;  3VAT A;  4ZY2 A;  1HEE A;  1TKF A;  3WC5 A;  4JGK A;  1CP6 A;  2XEI A;  1CG2 A;  3V38 A;  3K2K A;  2FAV A;  4ABK A;  2DEA A;  3BHX A;  3SIH A;  1HDQ A;  2V8H A;  4AXV A;  4R6T A;  1KWM A;  3CT9 A;  2L8R A;  1ZR5 A;  3IFE A;  4UF4 A;  5LRG A;  3H8G A;  2OOT A;  1TF9 A;  1TXZ A;  4MMO A;  1XRY A;  1LAN A;  3HUV A;  4IK2 A;  3EWR A;  4ZY1 A;  3NFZ A;  4EWT A;  2Q51 A;  3EWP A;  2JBJ A;  3SII A;  5DS0 A;  2EWB A;  3QNV A;  2O4H A;  2OR4 A;  2ABZ A;  2Q43 A;  5FSY A;  3GPO A;  2EK9 A;  3ISX A;  3B3W A;  1Z2L A;  5JM6 A;  2AFX A;  3IIF A;  4NGS A;  2BCO A;  2C6G A;  1LAM A;  3SJX A;  1DTD A;  1CX8 A;  1YD9 A;  2X47 A;  2AFM A;  2ZEL A;  4MXU A;  1LCP A;  3PFE A;  2PJ1 A;  1Q7L A;  1UWY A;  3VH9 A;  1TKH A;  4ESS A;  3BI1 A;  4NFR A;  2PJ3 A;  4IHM A;  1XFO A;  3KL9 A;  3EJG A;  7CPA A;  4P4J A;  6CPA A;  5J1Q A;  4MHZ A;  5I4M A;  1QQ9 A;  1YME A;  5LYL A;  3NH8 A;  4UEE A;  4JYW A;  4J4Z A;  4UEF A;  4WWV A;  5LYI A;  3FMC A;  1VIX A;  3H8E A;  3D66 A;  3PB8 X;  3S9N A;  4ABL A;  3B3T A;  4MCP A;  4NJQ A;  3WT4 A;  1HJZ A;  5LYF A;  3SIJ A;  2AFC A;  2PIZ A;  5HVG A;  2PJC A;  3GB0 A;  4YWY A;  5LYD A;  3B7I A;  3FH4 A;  2QYV A;  3B2Y A;  3PB7 X;  3KR4 A;  3LWU A;  2PJ2 A;  3KGQ A;  3LMS A;  3KQZ A;  2GLF A;  2PIY A;  4ZI6 A;  4P6Y A;  3GQO A;  3IIB A;  4MCR A;  4J5Q A;  5CB5 A;  4EFD A;  5CB3 A;  5ELY A;  3KR5 A;  1PCA A;  2PJ6 A;  4P4E A;  4D86 A;  2QVP A;  5IB9 A;  1ZR3 A;  4IAV A;  3I1U A;  5FSZ A;  2DX6 A;  4MCS A;  4JVV A;  1Y0Y A;  3JRU A;  3VFQ A;  1CPX A;  3CPA A;  2ZOG A;  1LFW A;  2F8H A;  3N5F A;  1Y7E A;  4ETJ A;  2CIJ A;  3EW5 A;  1BLL E;  3B3S A;  3IID A;  4F8Z A;  4X2T A;  3IWW A;  4DJL A;  5K8O A;  2C6C A;  1ARM A;  3IEH A;  4FUU A;  4P4F A;  4X3R A;  1ZG7 A;  4BD9 A;  4OC1 A;  3D67 A;  3MN8 A;  1LOK A;  3KZW A;  4YU9 A;  3DGV A;  2PE3 A;  1FT7 A;  3S9M A;  1OBR A;  4F9U A;  5HVH A;  2NSM A;  2PVV A;  2J9A A;  2EK8 A;  2FG1 A;  3EWQ A;  1ELM P;  2ZEO A;  2BFR A;  3B3V A;  4GVW A;  3NA6 A;  3WAB A;  4FBE A;  2QJ8 A;  2V8D A;  1YW4 A;  4OP4 A;  5HVF A;  1ZG8 A;  1VHU A;  1LAP A;  4DUK A;  4OC3 A;  1XJO A;  2PCU A;  3KHX A;  3IC1 A;  1VGY A;  2V77 A;  2BFQ A;  3KAS A;  4P4I A;  3D4U A;  2PJB A;  3FEE A;  3PFO A;  2ZEM A;  3D7D A;  4FWU A;  2XEJ A;  4ZYQ A;  2RFH A;  3Q6Z A;  3BI0 A;  4J5S A;  2GLJ A;  4P45 A;  5F09 A;  3BXM A;  2FXK A;  2V8G A;  3PRT A;  1NSA A;  3Q71 A;  2PJ0 A;  4NGT A;  3WC6 A;  2PJ7 A;  5FSV A;  3PBB A;  4OC5 A;  2PJ5 A;  3JZT A;  3SI1 A;  3WC7 A;  2BOA A;  1DE4 C;  4R76 A;  4OC0 A;  5FSX A;  3TX8 A;  2I3C A;  3EJF A;  3TC8 A;  4ZX8 A;  4GUA A;  3D68 A;  4MHY A;  5JH9 A;  3SJE A;  4K3N A;  1XBU A;  2FVG A;  3FED A;  3RAM A;  4A94 A;  2PJ8 A;  2PJA A;  3SJG A;  1TKJ A;  5THW A;  4PXE A;  5FSU A;  4PXC A;  3SJF A;  4TNU A;  5E3B A;  3K9T A;  2XEG A;  4UML A;  1EE3 P;  4WJB A;  4OME A;  4ZY0 A;  2O53 A;  4UEZ A;  4IQY A;  3H8F A;  3KHZ A;  4OID A;  5CPA A;  1YLO A;  3IO1 A;  1ZLI A;  1RTQ A;  1NJR A; 
#chains in the Genus database with same CATH topology
 3KI9 A;  4CRZ B;  2PVW A;  8CPA A;  2FS5 A;  3D7H A;  2Z11 A;  3RYO A;  2ZED A;  1RXT A;  1AMP A;  3I3G A;  2PR8 A;  2POK A;  1XEB A;  4RN7 A;  2B3U A;  2I79 A;  2HB6 A;  4G1P A;  3PB9 X;  1HDU A;  2H5M A;  1ZG9 A;  4NGM A;  1K4J A;  4CPA A;  1XMB A;  2QEC A;  4ONW A;  1F57 A;  2V8V A;  4TWE A;  2NYQ A;  1L0C A;  4B6Z A;  4IUS A;  1QST A;  4DYO A;  4R9M A;  4AVC A;  4P10 A;  4CYO A;  5EBV A;  4C2Y A;  4F9V A;  3GPG A;  1ARL A;  5I0C A;  4KVX A;  3TTH A;  2FCK A;  4PV6 A;  3WR7 A;  4R8F A;  3CDX A;  1IY7 A;  3V7Z A;  3KQX A;  5HIH A;  1F2P A;  4FAI A;  1IU8 A;  2G0B A;  4II9 A;  3IU2 A;  2Z3P A;  4UIB A;  5LRJ A;  2HC9 A;  3PZJ A;  4MHP A;  4UFW A;  2ZEG A;  4FD4 A;  4RUH A;  1QMU A;  5D29 A;  2C27 A;  4ZGY B;  1U6M A;  4PXD A;  3FVL A;  4Z65 A;  1S7F A;  3G3S A;  1P4N A;  2IQ6 A;  3PB4 X;  2WZN A;  4GM5 A;  3SI2 A;  3R95 A;  1OZP A;  1PYT B;  1JWQ A;  1M4D A;  4R7M A;  4FD6 A;  4UA3 A;  5AIL A;  3SXN A;  1YW6 A;  2ANP A;  2Z0Z A;  4ORF A;  3RO0 A;  4B10 A;  4MFL A;  3ZJ0 A;  3C26 A;  4HNY B;  2IL4 A;  1GYT A;  2B4D A;  2GIV A;  2HUZ A;  4NGP A;  4B12 A;  1ZLH A;  2PJ9 A;  4B5O A;  2Q4V A;  2X7B A;  2DPT A;  3BJ8 A;  4LQ6 A;  4NJR A;  1R3N A;  2GU2 A;  2PJ4 A;  4CGM A;  4CYN A;  4KLV A;  1RO5 A;  2JEW A;  4W9Y A;  1Y7R A;  3GUX A;  3B35 A;  4NGQ A;  4JZ0 A;  1Q2C A;  2Q7B A;  3SXO A;  4P4D A;  2IMO A;  3F8K A;  2WCT A;  4MI4 A;  4KOS A;  4NCZ A;  4MHN A;  2CXA A;  4BBH A;  2BO9 A;  2F7V A;  3DDD A;  1YSJ A;  3VAR A;  4XNH B;  2VL1 A;  3W91 A;  5J8C A;  1YR0 A;  3PB6 X;  4NGR A;  4CGN A;  4MHD A;  3GPQ A;  1AYE A;  2C1C A;  2XEF A;  4C7I A;  3RBU A;  4K0C A;  4KSI A;  2CF4 A;  2JDD A;  5HOL A;  2EBJ A;  2EUI A;  1SQH A;  2FT0 A;  2JEV A;  5F49 A;  4B14 A;  1TF8 A;  4CGL A;  2G9D A;  2Z3M A;  4M6I A;  3SIG A;  3H5Z A;  2PR1 A;  5H86 A;  3T9Y A;  2C6P A;  3B8G A;  2ACF A;  2CTC A;  3HLP A;  3R9G A;  2VQY A;  3D8P A;  3IWG A;  4CS0 B;  5F46 A;  1IYK A;  4ZX9 A;  4PSW A;  3L2N A;  4KZT A;  4J5R A;  2IJZ A;  3IU1 A;  4P4B A;  3B3C A;  4A39 A;  5IX3 A;  1R43 A;  3CPX A;  3I9S A;  3F5B A;  3V45 A;  4KSA A;  2RC4 A;  2ZW7 A;  4PXB A;  3QB8 A;  4KVO E;  1YVK A;  4JXQ A;  2OZH A;  2AFU A;  3FX6 A;  5F47 A;  3TE4 A;  2EEE A;  1VHO A;  4Q7A A;  4E8O A;  1M44 A;  1IOI A;  1VHE A;  4F0X A;  4OC2 A;  4CAX A;  2AFO A;  1JQG A;  4NGN A;  5JGF A;  2DXQ A;  1XE4 A;  4R3K A;  4MBU A;  1TXR A;  2OU2 A;  1Z5R A;  2FSR A;  2PC1 A;  2FIW A;  3MRU A;  2AFW A;  2GE3 A;  2ZEE A;  5K8N A;  4X8I A;  4A38 A;  3R1K A;  4A37 A;  5HXD A;  4QVT A;  4OKO A;  1TY8 A;  5CMS A;  4H2K A;  1ZO0 A;  3NH5 A;  4CAF A;  2GRE A;  2AFZ A;  4DNC A;  3T8W A;  3FEC A;  2ZEN A;  1BAV A;  1V0C A;  3FJU A;  4LUA A;  1VHS A;  3CZX A;  1BO4 A;  1BPN A;  5CBM A;  1IID A;  2R98 A;  3D2M A;  2LGR A;  4KYB A;  1IGB A;  1B87 A;  1Z8L A;  1S7N A;  3IJ3 A;  5DUS A;  2G3A A;  1I12 A;  2Q4Z A;  3MGD A;  3SI0 A;  2CTB A;  3RZA A;  3EKE A;  2ZW5 A;  4TU0 A;  4MJ8 A;  4EME A;  3G8W A;  3D7F A;  3DLJ A;  2P0W A;  3N7Z A;  5F48 A;  2XD7 A;  4JLL A;  1S7K A;  2Q4Y A;  4H6Z A;  4PPZ A;  5K8M A;  3P2H A;  2WYR A;  5D8N A;  2D4P A;  3EFA A;  4JWP A;  4UCM A;  1CBX A;  1ELL P;  2ATR A;  4HPS A;  3R9E A;  2A4N A;  3FYN A;  1BPM A;  2BSW A;  4M6H A;  4O23 A;  5K8P A;  1IB1 E;  2FXF A;  3D3S A;  2RNK A;  4UIA A;  3S6F A;  2JZE A;  2Q0Y A;  2ZEF A;  1Z9U A;  3T90 A;  1YX0 A;  2JLM A;  4JJX A;  3K9U A;  3EWO A;  2VRI A;  3TO6 A;  5KTD A;  1H8L A;  1YLE A;  3FF3 A;  4A31 A;  2AE6 A;  4GVV A;  2ZOF A;  3ETI A;  4XPD C;  2FIA A;  1CP7 A;  4P44 A;  1FNO A;  2P6G A;  3R96 A;  3V2B A;  3CXP A;  3D7G A;  3TO7 A;  5LRK A;  2WUU A;  2B58 A;  4JCA A;  4NSQ A;  1F2O A;  4U5Y A;  1S3Z A;  2AFS A;  4OC4 A;  3S6K A;  4A32 A;  5KTC A;  4KOX A;  2AJ6 A;  4LX9 A;  5AG7 A;  3OWC A;  1YQE A;  4PQA A;  2G3T A;  2ZEH A;  1Y9W A;  1SPV A;  3NH4 A;  2PSW A;  1M1D A;  1Q2D A;  1X10 A;  5AG4 A;  3ISZ A;  3LAC A;  1X12 A;  2YND A;  3GLJ A;  2PRQ A;  4CAE A;  2ZEP A;  4QB9 A;  4AB7 A;  4X5K A;  3PEI A;  2YNC A;  4MCQ A;  1Z8T A;  2RB7 A;  1Z4R A;  4UFV A;  3PBE A;  1KUY A;  4KLW A;  3S9L A;  1CPS A;  4KUB A;  3ZZI A;  4MRI A;  5J8F A;  4OIW A;  2JBK A;  4LQG A;  3BJ7 A;  4MY3 A;  4ETK A;  3TCV A;  1NSL A;  3GQE A;  3R9F A;  1M4L A;  1YK3 A;  3VWD A;  1Y0R A;  3VAT A;  4ZY2 A;  3TOA A;  5AGE A;  2VZZ A;  3EXN A;  1HEE A;  2OZG A;  4KOW A;  4L89 A;  3PP9 A;  1WK4 A;  3DNS A;  1TKF A;  3V8I A;  1S7L A;  4JGK A;  2Z3O A;  2Y0M A;  3WC5 A;  2F5I A;  1CP6 A;  2XEI A;  1CG2 A;  3V38 A;  3K2K A;  1XIX A;  2FAV A;  4ABK A;  1MJ9 A;  2DEA A;  3SIH A;  1HDQ A;  2V8H A;  3BHX A;  3IGR A;  4AXV A;  2NMT A;  4NF1 A;  5EC4 A;  4R6T A;  2BEI A;  1KWM A;  3CT9 A;  2L8R A;  1ZR5 A;  3IFE A;  4UF4 A;  5LRG A;  2J8N A;  3H8G A;  4QBJ A;  5AG6 A;  1TF9 A;  1Y9K A;  1TXZ A;  4FD5 A;  4UCP A;  2OOT A;  1Z4E A;  4MY0 A;  1CM0 A;  4MMO A;  1XRY A;  2PQ8 A;  1LAN A;  3HUV A;  4YFJ A;  4IK2 A;  3EWR A;  4ZY1 A;  3NFZ A;  4OAD A;  4EWT A;  1TIQ A;  1CJW A;  2Q51 A;  3EWP A;  1KZF A;  2GAN A;  3JUW A;  1IIC A;  3SII A;  2JBJ A;  5GCN A;  2JDC A;  1IYL A;  2VZY A;  5DS0 A;  2EWB A;  3QNV A;  2O4H A;  4FD7 A;  2HQY A;  4B11 A;  2OR4 A;  5ISV A;  2ABZ A;  2Q43 A;  2Q7S A;  5FSY A;  3GPO A;  1FY7 A;  2EK9 A;  3DR6 A;  4MFP A;  3ISX A;  3B3W A;  1Z2L A;  5JM6 A;  2AFX A;  3IIF A;  4NGS A;  1VKC A;  4KUA A;  3UY5 A;  2BCO A;  2C6G A;  1LAM A;  4C7H A;  3SJX A;  1DTD A;  1CX8 A;  1YD9 A;  4HNW B;  2X47 A;  4IF5 A;  3CXS A;  4MFZ A;  2AFM A;  2ZEL A;  1UFH A;  4MXU A;  1LCP A;  5A27 A;  3PFE A;  5FVJ A;  2B3V A;  2PJ1 A;  1Q7L A;  1UWY A;  4GXH A;  3VH9 A;  4Y49 C;  1TKH A;  4ESS A;  3BI1 A;  4NFR A;  4UBR A;  4UWJ A;  2PDO A;  3A9L A;  4M6G A;  3FXT A;  2P6F A;  2FL4 A;  4AVA A;  2ZW6 A;  4CGO A;  2PJ3 A;  1NE9 A;  4IHM A;  1S60 A;  1XFO A;  4Q36 A;  3KL9 A;  3EJG A;  5DWM A;  7CPA A;  4P4J A;  6CPA A;  5AG5 A;  3TO9 A;  3LOD A;  5J1Q A;  4MHZ A;  4MFK A;  4A30 A;  2KQV A;  1QQ9 A;  1YME A;  5H84 A;  5I4M A;  2W2G A;  5LYL A;  4C2X A;  4A33 A;  2CNS A;  3NH8 A;  2Q04 A;  3P2F A;  4UEE A;  4JYW A;  4J4Z A;  3E0K A;  2J8M A;  4UEF A;  3PGP A;  4WWV A;  5LYI A;  5BWA B;  3FMC A;  1R57 A;  1VIX A;  2ODF A;  4R57 A;  3H8E A;  1XMT A;  3D66 A;  3PB8 X;  5HH1 A;  3EC4 A;  1YGH A;  3S9N A;  1Z8W A;  4ABL A;  4H6U A;  1XOV A;  3B3T A;  4MCP A;  4NJQ A;  3WT4 A;  1HJZ A;  5LYF A;  3SIJ A;  2AFC A;  4AVB A;  4CYP A;  2PIZ A;  5HVG A;  4CRY B;  2PJC A;  4BIN A;  3GB0 A;  2FE7 A;  4YWY A;  4K30 A;  1ON0 A;  1QSO A;  5LYD A;  3B7I A;  2ZXV A;  3FH4 A;  2QYV A;  4NEX A;  3B2Y A;  3PB7 X;  3KR4 A;  2K5T A;  2PJ2 A;  2YGW A;  3FNC A;  3KGQ A;  3LWU A;  3LMS A;  3KQZ A;  2GLF A;  3FBU A;  2PIY A;  3H4Q A;  1S5K A;  5A28 A;  4ZI6 A;  3GIU A;  2JZD A;  3GQO A;  4J3G A;  4KOT A;  4KS9 A;  4P6Y A;  3IIB A;  2GFQ A;  3TOB A;  4MCR A;  4J5Q A;  4HKF A;  2OB0 A;  5CB5 A;  5G22 A;  1YRE A;  4EFD A;  3IWE A;  2OH1 A;  5CB3 A;  5ELY A;  4JLY A;  3KR5 A;  1KUX A;  4PK3 A;  4E2A A;  2P6E A;  4YGO A;  1PCA A;  2PJ6 A;  4P4E A;  4XPK A;  4D86 A;  4F0Y A;  2QVP A;  5IB9 A;  1ZR3 A;  4IAV A;  3CXQ A;  4JXR A;  3I1U A;  5FSZ A;  2DX6 A;  4MCS A;  4JVV A;  1Y0Y A;  2D4O A;  3JRU A;  1Q2Y A;  2YNE A;  3NE8 A;  4MFQ A;  5CNP A;  3VFQ A;  5G21 A;  1CPX A;  1QSM A;  3CPA A;  2WPX A;  1P0H A;  1LFW A;  2F8H A;  2ZOG A;  3GYA A;  3N5F A;  5EMI A;  1Y7E A;  4I49 A;  4ETJ A;  2CIJ A;  3EW5 A;  5KTA A;  2Z3N A;  4CAV A;  1BLL E;  3S6G A;  3B3S A;  3IID A;  4XPD B;  4F8Z A;  4X2T A;  3IWW A;  4DJL A;  4JD6 A;  5K8O A;  4L8A A;  2C6C A;  1ARM A;  3IEH A;  4FUU A;  4GS4 A;  4P4F A;  4X3R A;  4AG7 A;  3D2P A;  1ZG7 A;  4XNH C;  3GKR A;  4BD9 A;  3F0A A;  4OC1 A;  3EY5 A;  3D67 A;  1MK4 A;  3MN8 A;  1LOK A;  1N71 A;  3KZW A;  4OLL A;  3DGV A;  4YU9 A;  3SHP A;  2PE3 A;  3FIX A;  1M4G A;  1FT7 A;  3S9M A;  1OBR A;  1PU9 A;  4F9U A;  5IV0 A;  5HVH A;  2NSM A;  3W6S A;  2PVV A;  2ZPA A;  2J9A A;  4R3L A;  2EK8 A;  2FG1 A;  3EWQ A;  1ELM P;  2ZEO A;  2BFR A;  3B3V A;  4GVW A;  2R8V A;  3NA6 A;  4H89 A;  1XF8 A;  5IB0 A;  1Z8X A;  4NXY A;  1I1D A;  4E0A A;  1AUG A;  1WWZ A;  2EVN A;  3WAB A;  4AG9 A;  2QJ8 A;  2V8D A;  1YW4 A;  4OP4 A;  5HVF A;  4FBE A;  4KOV A;  5G1Z A;  4U9Z A;  4F6A A;  4BMH A;  5C82 A;  1ZG8 A;  4KSF A;  5E96 A;  1VHU A;  1J4J A;  2J8R A;  2B5G B;  4A95 A;  1LAP A;  4ONU A;  4DUK A;  4C68 A;  4OC3 A;  1XJO A;  2PCU A;  3KHX A;  3IC1 A;  1VGY A;  2V77 A;  3S6H A;  4UFX A;  3VWE A;  2BFQ A;  3KAS A;  4P4I A;  3D4U A;  2PJB A;  2B4B A;  2Q44 A;  3GY9 A;  3FEE A;  3PFO A;  3QAY A;  3DR8 A;  1I21 A;  4PSX A;  3BLN A;  2ZEM A;  1B6B A;  3D7D A;  4FWU A;  4M85 A;  5DWN A;  5HMN A;  2JZF A;  2XEJ A;  2CNM A;  3DSB A;  4UCN A;  2OZU A;  4Q38 A;  4ZYQ A;  2RFH A;  1KUV A;  4B13 A;  3Q6Z A;  4B5P B;  3BI0 A;  4J5S A;  2GLJ A;  1QSR A;  4P45 A;  5F09 A;  3BXM A;  4YRH A;  2FXK A;  2V8G A;  2YNC C;  2ZW4 A;  3PRT A;  2Z10 A;  2QIR A;  1NSA A;  3FB3 A;  4CGP A;  3QAH A;  3RNZ A;  4RI1 A;  3Q71 A;  2PJ0 A;  4NGT A;  3LD2 A;  3WC6 A;  2DPS A;  2PJ7 A;  4A2Z A;  4U9Y A;  1PUA A;  4RS2 A;  5FSV A;  3PBB A;  2Z3L A;  3KKW A;  3JTK A;  2EO8 A;  1IOF A;  1BOB A;  1QSN A;  4KVM E;  4OC5 A;  2PJ5 A;  2WSA A;  3JZT A;  4XPL A;  3SI1 A;  3WC7 A;  2BOA A;  1DE4 C;  2CNT A;  4R76 A;  2O28 A;  4OC0 A;  4KOY A;  5FSX A;  3TX8 A;  2I3C A;  3EJF A;  2ARH A;  2CY2 A;  4MFJ A;  4EVY A;  3TC8 A;  4C2Z A;  2REF A;  1MJA A;  4ZX8 A;  1GHE A;  2WPW A;  3FRM A;  5G20 A;  2REE A;  4GUA A;  3EO4 A;  3D68 A;  3W6X A;  4KOR A;  4UWI A;  4MHY A;  5JH9 A;  2HV2 A;  4PK2 A;  4CYQ A;  2Z3K A;  2PRB A;  3SJE A;  4K3N A;  1XBU A;  2FVG A;  3FED A;  3RAM A;  1MJB A;  4A94 A;  2PJ8 A;  1M4I A;  5JPH A;  1NMT A;  2R1I A;  2PJA A;  4Y49 B;  3SJG A;  1TKJ A;  2VEZ A;  5THW A;  1A2Z A;  4PXE A;  2KCW A;  2B4D B;  2R7H A;  2B5G A;  5FSU A;  2QML A;  4HNX B;  4PXC A;  4QC6 A;  2BUE A;  2VBQ A;  3TFY A;  3SJF A;  2VI7 A;  4TNU A;  5E3B A;  3K9T A;  2XEG A;  4UML A;  1EE3 P;  4QUS A;  3TT2 A;  4WJB A;  2BL1 A;  4ZY0 A;  4KOU A;  1YVO A;  4OME A;  2O53 A;  4UEZ A;  4IQY A;  3H8F A;  3KHZ A;  4ZBG A;  5C88 A;  4OAE A;  4CAW A;  5JQ4 A;  4OID A;  5CPA A;  3JVN A;  1YLO A;  4R87 A;  3NE7 A;  2I00 A;  2DF5 A;  1LRZ A;  1ZLI A;  1RTQ A;  1NJR A;  2VXK A;  3IO1 A;  4M3S A;  4B5P A; 
#chains in the Genus database with same CATH homology
 3KI9 A;  2PVW A;  8CPA A;  3D7H A;  2ZED A;  1AMP A;  2POK A;  2HB6 A;  4G1P A;  3PB9 X;  1HDU A;  1ZG9 A;  4NGM A;  4CPA A;  1XMB A;  4ONW A;  1F57 A;  2V8V A;  4TWE A;  2NYQ A;  4B6Z A;  4DYO A;  4P10 A;  4F9V A;  3GPG A;  1ARL A;  4R8F A;  3CDX A;  1IY7 A;  3V7Z A;  3KQX A;  5HIH A;  1F2P A;  4FAI A;  4UIB A;  5LRJ A;  2HC9 A;  4MHP A;  2ZEG A;  4RUH A;  1QMU A;  5D29 A;  4PXD A;  3FVL A;  4Z65 A;  2IQ6 A;  3SI2 A;  3PB4 X;  2WZN A;  4GM5 A;  1PYT B;  4R7M A;  5AIL A;  1YW6 A;  2ANP A;  1GYT A;  4NGP A;  1ZLH A;  2PJ9 A;  4NJR A;  1R3N A;  2GU2 A;  2PJ4 A;  2JEW A;  4W9Y A;  3GUX A;  3B35 A;  4NGQ A;  4JZ0 A;  4P4D A;  2IMO A;  4MHN A;  2BO9 A;  2F7V A;  3VAR A;  1YSJ A;  2VL1 A;  3PB6 X;  4NGR A;  3GPQ A;  1AYE A;  2C1C A;  2XEF A;  3RBU A;  4K0C A;  4KSI A;  2CF4 A;  5HOL A;  1TF8 A;  2G9D A;  3SIG A;  2C6P A;  2ACF A;  2CTC A;  3HLP A;  4ZX9 A;  3L2N A;  4J5R A;  2IJZ A;  4P4B A;  3B3C A;  4A39 A;  1R43 A;  3CPX A;  3V45 A;  4PXB A;  2AFU A;  3FX6 A;  2EEE A;  1VHO A;  4Q7A A;  1VHE A;  4OC2 A;  2AFO A;  1JQG A;  4NGN A;  5JGF A;  1TXR A;  1Z5R A;  3MRU A;  2AFW A;  2ZEE A;  5K8N A;  4X8I A;  4A38 A;  5HXD A;  4A37 A;  4OKO A;  1TY8 A;  5CMS A;  4H2K A;  3NH5 A;  2GRE A;  2AFZ A;  3T8W A;  3FEC A;  2ZEN A;  1BAV A;  3FJU A;  1BPN A;  5CBM A;  2LGR A;  4KYB A;  1IGB A;  1Z8L A;  2Q4Z A;  3IJ3 A;  5DUS A;  3SI0 A;  2CTB A;  3RZA A;  3EKE A;  4TU0 A;  4EME A;  3D7F A;  3DLJ A;  2XD7 A;  4JLL A;  4PPZ A;  5K8M A;  2WYR A;  5D8N A;  1CBX A;  1ELL P;  4O23 A;  1BPM A;  5K8P A;  4UIA A;  2ZEF A;  3EWO A;  2VRI A;  1H8L A;  3FF3 A;  4GVV A;  2ZOF A;  3ETI A;  1CP7 A;  4P44 A;  1FNO A;  3V2B A;  3D7G A;  5LRK A;  4JCA A;  1F2O A;  2AFS A;  4OC4 A;  4PQA A;  2ZEH A;  1SPV A;  3NH4 A;  3ISZ A;  3GLJ A;  2PRQ A;  2ZEP A;  3PEI A;  4MCQ A;  2RB7 A;  3PBE A;  3S9L A;  1CPS A;  4MRI A;  4OIW A;  2JBK A;  4LQG A;  4ETK A;  3GQE A;  1M4L A;  1Y0R A;  3VAT A;  4ZY2 A;  1HEE A;  1TKF A;  3WC5 A;  4JGK A;  1CP6 A;  2XEI A;  1CG2 A;  3V38 A;  3K2K A;  2FAV A;  4ABK A;  2DEA A;  3BHX A;  3SIH A;  1HDQ A;  2V8H A;  4AXV A;  4R6T A;  1KWM A;  3CT9 A;  2L8R A;  1ZR5 A;  3IFE A;  4UF4 A;  5LRG A;  3H8G A;  2OOT A;  1TF9 A;  1TXZ A;  4MMO A;  1XRY A;  1LAN A;  3HUV A;  4IK2 A;  3EWR A;  4ZY1 A;  3NFZ A;  4EWT A;  2Q51 A;  3EWP A;  2JBJ A;  3SII A;  5DS0 A;  2EWB A;  3QNV A;  2O4H A;  2OR4 A;  2ABZ A;  2Q43 A;  5FSY A;  3GPO A;  2EK9 A;  3ISX A;  3B3W A;  1Z2L A;  5JM6 A;  2AFX A;  3IIF A;  4NGS A;  2BCO A;  2C6G A;  1LAM A;  3SJX A;  1DTD A;  1CX8 A;  1YD9 A;  2X47 A;  2AFM A;  2ZEL A;  4MXU A;  1LCP A;  3PFE A;  2PJ1 A;  1Q7L A;  1UWY A;  3VH9 A;  1TKH A;  4ESS A;  3BI1 A;  4NFR A;  2PJ3 A;  4IHM A;  1XFO A;  3KL9 A;  3EJG A;  7CPA A;  4P4J A;  6CPA A;  5J1Q A;  4MHZ A;  5I4M A;  1QQ9 A;  1YME A;  5LYL A;  3NH8 A;  4UEE A;  4JYW A;  4J4Z A;  4UEF A;  4WWV A;  5LYI A;  3FMC A;  1VIX A;  3H8E A;  3D66 A;  3PB8 X;  3S9N A;  4ABL A;  3B3T A;  4MCP A;  4NJQ A;  3WT4 A;  1HJZ A;  5LYF A;  3SIJ A;  2AFC A;  2PIZ A;  5HVG A;  2PJC A;  3GB0 A;  4YWY A;  5LYD A;  3B7I A;  3FH4 A;  2QYV A;  3B2Y A;  3PB7 X;  3KR4 A;  3LWU A;  2PJ2 A;  3KGQ A;  3LMS A;  3KQZ A;  2GLF A;  2PIY A;  4ZI6 A;  4P6Y A;  3GQO A;  3IIB A;  4MCR A;  4J5Q A;  5CB5 A;  4EFD A;  5CB3 A;  5ELY A;  3KR5 A;  1PCA A;  2PJ6 A;  4P4E A;  4D86 A;  2QVP A;  5IB9 A;  1ZR3 A;  4IAV A;  3I1U A;  5FSZ A;  2DX6 A;  4MCS A;  4JVV A;  1Y0Y A;  3JRU A;  3VFQ A;  1CPX A;  3CPA A;  2ZOG A;  1LFW A;  2F8H A;  3N5F A;  1Y7E A;  4ETJ A;  2CIJ A;  3EW5 A;  1BLL E;  3B3S A;  3IID A;  4F8Z A;  4X2T A;  3IWW A;  4DJL A;  5K8O A;  2C6C A;  1ARM A;  3IEH A;  4FUU A;  4P4F A;  4X3R A;  1ZG7 A;  4BD9 A;  4OC1 A;  3D67 A;  3MN8 A;  1LOK A;  3KZW A;  4YU9 A;  3DGV A;  2PE3 A;  1FT7 A;  3S9M A;  1OBR A;  4F9U A;  5HVH A;  2NSM A;  2PVV A;  2J9A A;  2EK8 A;  2FG1 A;  3EWQ A;  1ELM P;  2ZEO A;  2BFR A;  3B3V A;  4GVW A;  3NA6 A;  3WAB A;  4FBE A;  2QJ8 A;  2V8D A;  1YW4 A;  4OP4 A;  5HVF A;  1ZG8 A;  1VHU A;  1LAP A;  4DUK A;  4OC3 A;  1XJO A;  2PCU A;  3KHX A;  3IC1 A;  1VGY A;  2V77 A;  2BFQ A;  3KAS A;  4P4I A;  3D4U A;  2PJB A;  3FEE A;  3PFO A;  2ZEM A;  3D7D A;  4FWU A;  2XEJ A;  4ZYQ A;  2RFH A;  3Q6Z A;  3BI0 A;  4J5S A;  2GLJ A;  4P45 A;  5F09 A;  3BXM A;  2FXK A;  2V8G A;  3PRT A;  1NSA A;  3Q71 A;  2PJ0 A;  4NGT A;  3WC6 A;  2PJ7 A;  5FSV A;  3PBB A;  4OC5 A;  2PJ5 A;  3JZT A;  3SI1 A;  3WC7 A;  2BOA A;  1DE4 C;  4R76 A;  4OC0 A;  5FSX A;  3TX8 A;  2I3C A;  3EJF A;  3TC8 A;  4ZX8 A;  4GUA A;  3D68 A;  4MHY A;  5JH9 A;  3SJE A;  4K3N A;  1XBU A;  2FVG A;  3FED A;  3RAM A;  4A94 A;  2PJ8 A;  2PJA A;  3SJG A;  1TKJ A;  5THW A;  4PXE A;  5FSU A;  4PXC A;  3SJF A;  4TNU A;  5E3B A;  3K9T A;  2XEG A;  4UML A;  1EE3 P;  4WJB A;  4OME A;  4ZY0 A;  2O53 A;  4UEZ A;  4IQY A;  3H8F A;  3KHZ A;  4OID A;  5CPA A;  1YLO A;  3IO1 A;  1ZLI A;  1RTQ A;  1NJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...