4R6TA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
total genus 168
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r6tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r6tA02
1YW6A 3NH5A 2DX6A 2BCOA 1OBRA 4O23A 2PJ7A 4AXVA 2ZEDA 3IFEA 2PJ9A 3DGVA 6CPAA 3B3TA 2V8GA 1CPSA 3HUVA 1VHEA 4G1PA 5F09A 2FXKA 3IEHA 1H8LA 1LOKA 4OC2A 1JQGA 3GUXA 3SI2A 2GREA 3D7GA 3KQXA 4PXDA 4PXBA 5FSUA 4OC0A 3PB7X 2V8HA 1LANA 4D86A 4NGQA 3BHXA 1XMBA 2AFXA 4EMEA 4ABLA 4UEFA 1VGYA 3K2KA 4IAVA 4IHMA 3VARA 2XEJA 4ZY2A 4OC1A 3WT4A 1TY8A 2L8RA 3D66A 1AMPA 2GLFA 4P4EA 5AILA 4P4BA 4OC5A 1HEEA 4RUHA 4F9VA 2IJZA 3ETIA 1DTDA 3WC7A 3EW5A 1CPXA 2NYQA 5ELYA 2QVPA 4B6ZA 4DUKA 1QMUA 2BFRA 1ARMA 2ANPA 3EWPA 3SIGA 4PQAA 4F9UA 2BO9A 4OKOA 4EFDA 1BPMA 3MRUA 1EE3P 1FT7A 1TKFA 5K8NA 1BLLE 1TF8A 4MHZA 2PIZA 1YW4A 4UF4A 3EKEA 3V38A 5HVGA 3BI0A 5HVHA 3Q6ZA 3JZTA 4MRIA 2GLJA 2PVVA 2RFHA 5DS0A 2X47A 2CTBA 3SIIA 2ZENA 2G9DA 3B35A 3WC5A 2ZEEA 1XFOA 4J5RA 3FF3A 2ZEFA 4FAIA 3TX8A 3S9NA 5CBMA 2IQ6A 4WJBA 1TXRA 2QYVA 3CDXA 2Q43A 3B2YA 3HLPA 2PJ5A 4FBEA 2ZEGA 1LFWA 2O53A 5LYLA 2AFSA 5LYFA 5D29A 2BOAA 1BPNA 2AFOA 4PXEA 2ZEMA 3VH9A 2PJAA 1PCAA 4NJQA 4OMEA 1YD9A 5CB5A 2PCUA 2ACFA 4FWUA 1ZG7A 3BI1A 3NH8A 3SJEA 1Z8LA 2VL1A 3Q71A 5I4MA 5DUSA 4CPAA 1ELLP 3NH4A 1ZG8A 4TWEA 3FH4A 5K8PA 1IY7A 1ZG9A 2PJCA 4UEEA 4K3NA 4GM5A 4YU9A 2Q51A 2XD7A 1ZLHA 4OC4A 1HDUA 4R7MA 3FECA 3TC8A 4OIWA 3PBBA 2AFCA 2FG1A 4YWYA 4DJLA 2QJ8A 4OC3A 2ZEOA 3NFZA 2PJBA 5THWA 7CPAA 8CPAA 1XJOA 2XEGA 1XRYA 4P45A 3KHZA 5FSZA 1TKJA 3IWWA 4ABKA 5HXDA 1Y7EA 3WABA 4ETKA 3IIBA 3EWQA 4JYWA 1CBXA 4X3RA 2CF4A 2FVGA 2PJ3A 4MHPA 5E3BA 4JCAA 3EWOA 3KR5A 1Z5RA 3QNVA 3IIDA 4A38A 4Q7AA 2C6CA 1QQ9A 3SI1A 4X2TA 4UMLA 4ESSA 2JBJA 3DLJA 5IB9A 2BFQA 4ZYQA 3KR4A 5LYDA 2VRIA 5D8NA 4J5SA 3FEEA 3GLJA 1IGBA 3T8WA 4P4JA 2ZEHA 3SJFA 5CB3A 4OIDA 2EK9A 1LCPA 4W9YA 2C6GA 3D67A 4NGMA 2FAVA 2AFWA 5FSVA 2CIJA 3B3CA 2Q4ZA 2PJ2A 2ZELA 4JLLA 3ISZA 4MMOA 3BXMA 4NGTA 4ZY1A 4NJRA 3D7FA 3NA6A 1HJZA 4R8FA 4KYBA 3EJGA 3FVLA 2NSMA 3B7IA 5JGFA 2GU2A 2ZOGA 3V2BA 4FUUA 1NJRA 3CPXA 2PVWA 3CT9A 3V7ZA 4NGPA 4A37A 2PIYA 2IMOA 1BAVA 3IO1A 1Z2LA 4ZY0A 4ZX8A 5LYIA 1VIXA 5LRGA 1CP7A 1VHUA 4A39A 2V8DA 3S9MA 3PEIA 2XEFA 5LRJA 4P44A 2AFUA 4JGKA 1Y0YA 3PB8X 1LAMA 2EK8A 2AFZA 2C6PA 5FSXA 5CPAA 1LAPA 4K0CA 4MCPA 2WZNA 4P4DA 1AYEA 3KASA 3H8FA 3EWRA 2DEAA 4LQGA 1R43A 1YLOA 4ONWA 1TF9A 2O4HA 2ABZA 3IJ3A 3PB6X 3PBEA 3PFOA 5JH9A 4ZX9A 3KZWA 3PB4X 4IQYA 2EWBA 1HDQA 3D68A 2OOTA 1YSJA 3VFQA 4A94A 4JVVA 1ARLA 5HOLA 3N5FA 4MHYA 3JRUA 4Z65A 4R6TA 3H8EA 3FJUA 4TNUA 3SJGA 4H2KA 3ISXA 1M4LA 1FNOA 2ZOFA 1GYTA 4MHNA 4NGNA 4OP4A 5HVFA 3GB0A 2PE3A 3FEDA 5K8OA 1NSAA 3IC1A 2POKA 1KWMA 1PYTB 1SPVA 3SI0A 5CMSA 2JBKA 4KSIA 2ZEPA 3PB9X 3RZAA 4P4IA 3FMCA 5LRKA 3GPOA 1R3NA 4X8IA 4NFRA 4UIBA 3GQOA 3KI9A 5FSYA 2OR4A 1F2OA 4EWTA 3GPQA 4BD9A 3D4UA 1UWYA 1F2PA 3PFEA 3K9TA 3PRTA 1DE4C 3KQZA 2PRQA 3VATA 2PJ4A 1ELMP 1YMEA 3GPGA 1CG2A 3B3SA 3EJFA 2JEWA 5K8MA 1RTQA 4GUAA 4J5QA 1VHOA 1Y0RA 3KHXA 1F57A 4PPZA 1TKHA 2F7VA 2HC9A 2XEIA 3KGQA 4MXUA 3D7DA 2PJ0A 4UIAA 2V8VA 3CPAA 1Q7LA 4DYOA 3IIFA 2V77A 4ETJA 5J1QA 4MCRA 1ZR5A 4GVVA 1ZLIA 4ZI6A 3FX6A 2HB6A 3B3VA 3RBUA 3I1UA 1CP6A 3L2NA 4GVWA 3RAMA 2EEEA 3LWUA 2CTCA 5HIHA 2LGRA 3GQEA 4UEZA 3S9LA 2PJ6A 2WYRA 3SJXA 1ZR3A 3B3WA 3LMSA 1TXZA 2PJ8A 3D7HA 4JZ0A 2AFMA 4MCQA 2C1CA 4NGSA 3SIHA 4IK2A 3SIJA 4NGRA 2RB7A 1CX8A 3H8GA 3MN8A 4J4ZA 4P10A 4P6YA 3WC6A 3KL9A 4PXCA 4TU0A 2PJ1A 3V45A 4MCSA 4R76A 2J9AA 5JM6A 1XBUA 4WWVA 4P4FA 4F8ZA 2F8HA 2I3CA
chains in the Genus database with same CATH superfamily
1YW6A 3NH5A 3R1KA 2PSWA 2DX6A 2BCOA 2Z3NA 3RYOA 1OBRA 4O23A 2PJ7A 3ZZIA 4AG9A 4R87A 4AXVA 2ZEDA 1FY7A 3IFEA 2PJ9A 2R8VA 3EXNA 2HUZA 3DGVA 3B3TA 4BBHA 6CPAA 4C2ZA 2V8GA 1CPSA 1A2ZA 4UCNA 3HUVA 4PSWA 4A2ZA 1VHEA 4G1PA 3SXNA 2K5TA 5F09A 4B5PB 2FXKA 3BLNA 3G3SA 3R9EA 5I0CA 3IEHA 1H8LA 4KVOE 1NSLA 4U9YA 1B87A 2PC1A 1LOKA 4XNHB 4OC2A 5EC4A 1JQGA 5AG6A 3GUXA 4U5YA 3SI2A 4YGOA 2GREA 5ISVA 3D7GA 3KQXA 2R7HA 1IYKA 1KZFA 4PXDA 3TTHA 4II9A 4PXBA 5FSUA 1RXTA 3PB7X 4OC0A 4CYPA 2V8HA 1LANA 4D86A 4NGQA 3BHXA 2EUIA 1B6BA 1XMBA 2AFXA 4EMEA 2FIWA 4ABLA 4CAWA 4UEFA 1VGYA 1GHEA 3FIXA 3K2KA 4IAVA 4IHMA 3VARA 2XEJA 2YGWA 4BMHA 4ZY2A 2FIAA 4HKFA 1M4GA 2Z3OA 2O28A 2Q04A 4OC1A 3WT4A 3K9UA 1TY8A 2L8RA 1S7KA 1QSOA 3D66A 1Z9UA 1AMPA 3MGDA 1MJBA 2Q4YA 4L89A 5HMNA 2GLFA 4B5PA 4P4EA 1IIDA 5AILA 4CRZB 3CZXA 4P4BA 4OC5A 1HEEA 4RUHA 3LD2A 3FBUA 2YNCA 2IJZA 3SXOA 4F9VA 2ARHA 4OADA 1QSTA 3ETIA 1DTDA 3WC7A 3EW5A 4E0AA 3A9LA 2B4BA 4RI1A 1CPXA 2NYQA 5ELYA 1TIQA 2QVPA 2OB0A 4A33A 4B6ZA 5G1ZA 4DUKA 1QMUA 2BFRA 1ARMA 2ANPA 3EWPA 3SIGA 4YRHA 2B3UA 4PQAA 4F9UA 2BO9A 4OKOA 4EFDA 1BPMA 3JVNA 3MRUA 4RS2A 1EE3P 1FT7A 2FE7A 2Z3PA 3VWDA 1TKFA 3TO6A 5K8NA 4KOUA 1BLLE 1TF8A 5FVJA 4MHZA 2PIZA 1YW4A 1X12A 2GE3A 2REEA 5IV0A 3N7ZA 4UF4A 1M4DA 1OZPA 1YX0A 3EKEA 3V38A 5HVGA 3BI0A 2Q0YA 4JXRA 2Z3LA 5HVHA 3Q6ZA 4MJ8A 3JZTA 3D8PA 4ONUA 4Y49B 3W6SA 2BEIA 2VEZA 4MRIA 2GLJA 2PVVA 1S7FA 2RFHA 3LODA 2X47A 5DS0A 2CTBA 3SIIA 2ZENA 2F5IA 1IB1E 4PSXA 2G9DA 3B35A 3WC5A 1KUXA 1XE4A 2QIRA 2ZEEA 1XFOA 3T9YA 5KTAA 4J5RA 3FF3A 5JQ4A 1K4JA 1UFHA 2ZEFA 2JDCA 4DNCA 3EO4A 4CGPA 1MJAA 4B11A 4FAIA 1X10A 4FD7A 4LX9A 2P6FA 5CBMA 1YVKA 4UCMA 3TX8A 1P4NA 1S7NA 2IQ6A 1WK4A 4WJBA 4B10A 1TXRA 2QYVA 1M44A 2Q43A 2B4DB 3CDXA 3DNSA 1IOIA 3B2YA 3HLPA 2PJ5A 4FBEA 1V0CA 2ZEGA 1LFWA 1XEBA 2O53A 5LYLA 2AFSA 5GCNA 5LYFA 3IGRA 2JLMA 2JDDA 5D29A 4IUSA 2BOAA 4QVTA 3TOBA 1BPNA 2AFOA 4AB7A 4PXEA 1Z8WA 2ZEMA 3WR7A 2AE6A 3VH9A 2WPWA 1XF8A 1PCAA 2PJAA 4NJQA 4OMEA 3T90A 2HQYA 1YD9A 5AG4A 1BO4A 2P6EA 5CB5A 2PCUA 2ZXVA 2ACFA 3F8KA 1ZG7A 3BI1A 3NH8A 4FWUA 3SJEA 1Z8LA 4CGNA 3TO7A 2VL1A 2Y0MA 5J8CA 3TCVA 3Q71A 2FL4A 1JWQA 4MI4A 2WUUA 5I4MA 5DUSA 3QAYA 2Z10A 1N71A 1ELLP 4CPAA 3NH4A 4K30A 1ZG8A 2JEVA 3LACA 4TWEA 4AVBA 3FH4A 5K8PA 3DSBA 4H6ZA 4U9ZA 2CXAA 1IY7A 1ZG9A 2PJCA 2PR1A 4UEEA 4B13A 2JZEA 4K3NA 4GM5A 4YU9A 2B4DA 4B5OA 1S5KA 1I21A 2Q51A 2XD7A 1VHSA 2Z0ZA 3FXTA 1ZLHA 2D4PA 4M6IA 2D4OA 2X7BA 4OC4A 1HDUA 4R7MA 2NMTA 3FECA 4OIWA 4UCPA 3TC8A 2ZW5A 2AFCA 3PBBA 2FG1A 1Q2DA 4CRYB 2HV2A 4HNWB 4YWYA 3RNZA 4AVAA 4KOTA 2P6GA 4B14A 3W91A 4DJLA 2CY2A 1Z8TA 4HPSA 4A31A 3IWEA 2QJ8A 4JD6A 3OWCA 4OC3A 2ZEOA 1ZO0A 2I00A 3NFZA 4MBUA 4MFKA 3TO9A 2PJBA 5THWA 7CPAA 4A32A 8CPAA 4XNHC 4XPKA 2RNKA 4A95A 1XJOA 2XEGA 3R9GA 3C26A 4A37A 1XRYA 4P45A 2B5GB 3KHZA 5FSZA 3G8WA 1TKJA 4B12A 3IWWA 4ABKA 2FS5A 3H5ZA 4JLYA 4CAVA 5HXDA 1Y7EA 3WABA 4ETKA 3IIBA 3EWQA 4JYWA 1CBXA 4KOWA 4X3RA 2CF4A 2FVGA 2DF5A 2PRBA 2PJ3A 4MHPA 2GANA 2Q4VA 5E3BA 1MJ9A 4ZGYB 2Q7BA 4JCAA 4KVME 3EWOA 3KR5A 1CM0A 1Z5RA 2DPSA 4J3GA 3QNVA 3IIDA 1VKCA 4A38A 3R96A 4Q7AA 5F49A 1I12A 2C6CA 1QQ9A 4ZBGA 3SI1A 4F0YA 1Y9WA 4X2TA 4UMLA 4ESSA 2ZW7A 5J8FA 4CAXA 2VQYA 2JBJA 3DLJA 5IB9A 5A27A 2BFQA 3QB8A 4ZYQA 3KR4A 5LYDA 2VRIA 5D8NA 4J5SA 3FRMA 4RN7A 3FEEA 3GLJA 1IGBA 5EMIA 1M4IA 3T8WA 4P4JA 1CJWA 4E8OA 2ZEHA 3SJFA 2QECA 5CB3A 3DR6A 4OIDA 2EK9A 2PR8A 1LCPA 3PZJA 2C6GA 3D67A 4NGMA 2FAVA 4QB9A 4HNYB 1Q2YA 4W9YA 3DR8A 3IU2A 5KTCA 2AFWA 4PV6A 4M6GA 4GXHA 2PQ8A 4MY0A 2OU2A 4MFZA 4Q36A 2VBQA 2BUEA 5FSVA 1Y9KA 4L8AA 4UFXA 5G21A 2CIJA 3B3CA 2Q4ZA 1RO5A 4FD6A 2PJ2A 2ZELA 4CS0B 4CYNA 4JLLA 2REFA 3ISZA 3TT2A 4M85A 2EBJA 4KOXA 5F46A 1YVOA 4MMOA 3BXMA 5C82A 4NGTA 3F0AA 4ZY1A 3IWGA 5F47A 3P2HA 4R57A 4NJRA 3D7FA 4UWIA 1SQHA 5A28A 4MFLA 5AG5A 3NA6A 5G22A 3EFAA 1HJZA 4R8FA 2Q7SA 4KYBA 3S6KA 3EJGA 3FVLA 3SHPA 4CGMA 2VI7A 2NSMA 3B7IA 4LUAA 1XOVA 5JGFA 2GU2A 2ZOGA 3V2BA 4M3SA 4FUUA 4MHDA 1MK4A 1NJRA 3CPXA 4KSAA 1J4JA 4NEXA 2BSWA 2PVWA 3CT9A 3QAHA 4NGPA 3V7ZA 2JZDA 4MFJA 4FD4A 2PIYA 4R3KA 4C7HA 2IMOA 4CYQA 1BAVA 3IO1A 1Z2LA 4ZY0A 4ZX8A 2RC4A 4QC6A 5LYIA 1YREA 1IICA 4A30A 1LRZA 2OH1A 4CYOA 2YNCC 1VIXA 2ZW6A 5LRGA 2W2GA 1YQEA 1CP7A 2Z3KA 1VHUA 2EVNA 3VWEA 4A39A 2V8DA 4MFQA 3S9MA 3PEIA 2XEFA 5LRJA 4P44A 2AFUA 2I79A 5DWNA 4JGKA 4UFWA 1Y0YA 3PB8X 1LAMA 4NF1A 2EK8A 2FT0A 2AFZA 2C6PA 1YR0A 2VZYA 4UWJA 1YLEA 2OZGA 3DDDA 5FSXA 3JUWA 5CPAA 4GS4A 1LAPA 4K0CA 2WSAA 3ZJ0A 4P4FA 3KKWA 4KOSA 4MCPA 2WZNA 4P4DA 1AYEA 3KASA 3H8FA 3EWRA 2DEAA 2ZPAA 3B8GA 4LQGA 1R43A 4KOYA 1YLOA 2YNEA 1TF9A 4ONWA 2O4HA 3JTKA 2ABZA 3IJ3A 3PB6X 3PBEA 3PFOA 1BOBA 4ZX9A 3BJ7A 3KZWA 3PB4X 4IQYA 4NCZA 5DWMA 2EWBA 1HDQA 3D68A 2OOTA 1Y7RA 4KVXA 1YSJA 1I1DA 3VFQA 5AG7A 3IU1A 1NMTA 4A94A 1AUGA 4JVVA 1ARLA 2B3VA 3S6HA 2WCTA 5HOLA 2A4NA 3CXPA 2YNDA 3S9NA 1QSNA 3N5FA 3GY9A 4MHYA 3JRUA 4Z65A 4R6TA 3H8EA 3FJUA 4TNUA 3SJGA 4H2KA 3ISXA 4Q38A 1Q2CA 4Y49C 1M4LA 1FNOA 1PUAA 2ZOFA 1PU9A 2PDOA 4NSQA 2FCKA 1GYTA 4MHNA 4NGNA 4OP4A 4F0XA 5HVFA 1Z4EA 3GB0A 2PE3A 3FEDA 1P0HA 2WPXA 5K8OA 4LQ6A 1NSAA 1XIXA 2Q44A 2POKA 3IC1A 1KWMA 1PYTB 1SPVA 3SI0A 2ZW4A 4KOVA 3NE7A 3W6XA 5CMSA 1Z8XA 3BJ8A 2JBKA 4KUBA 3V8IA 4KSIA 2ZEPA 3PB9X 3RZAA 4P4IA 1KUYA 2J8NA 3FMCA 2IL4A 5F48A 5LRKA 3GPOA 1R3NA 4PK2A 4X8IA 2AJ6A 4UFVA 4NFRA 4UIBA 3GQOA 4E2AA 5IB0A 2EO8A 3KI9A 1S3ZA 4XPLA 5FSYA 2OR4A 3FYNA 1F2OA 1L0CA 3GIUA 4X5KA 2CNTA 4EWTA 3GPQA 4BD9A 2GFQA 3D2MA 2H5MA 1UWYA 3D4UA 3EC4A 2G0BA 2B5GA 4ORFA 1F2PA 1ON0A 2JZFA 1S60A 4FD5A 3PFEA 4AVCA 4HNXB 4OAEA 3K9TA 3PRTA 5JPHA 3I9SA 1DE4C 3KQZA 4JJXA 2PRQA 3VATA 2PJ4A 3S6FA 4CAEA 1ELMP 3FB3A 4IF5A 4JWPA 1YMEA 3GPGA 1CG2A 4KSFA 4QUSA 3B3SA 2P0WA 3EJFA 2JEWA 3TOAA 4C2YA 5K8MA 1RTQA 3E0KA 4GUAA 2QMLA 4J5QA 1VHOA 1QSRA 1Y0RA 3KHXA 4UBRA 5JH9A 3PGPA 1F57A 5G20A 4H6UA 4CAFA 4PPZA 1TKHA 1M1DA 3D2PA 3CXQA 2J8MA 1IU8A 2F7VA 4KUAA 2HC9A 2XEIA 5AGEA 3KGQA 4MXUA 3R9FA 2FSRA 3D7DA 2PJ0A 4UIAA 4F8ZA 4QBJA 2ODFA 2C27A 1QSMA 2G3AA 2V8VA 3CPAA 5H86A 1Q7LA 4OLLA 2DXQA 4C68A 4DYOA 3IIFA 2V77A 3TE4A 5C88A 5IX3A 3H4QA 2R98A 3GKRA 4CGLA 3EY5A 4R3LA 5HH1A 4ETJA 5J1QA 1Z4RA 3NE8A 3P2FA 4MCRA 3I3GA 1ZR5A 4GVVA 3FNCA 1ZLIA 4KORA 4ZI6A 2HB6A 3FX6A 3B3VA 1WWZA 4F6AA 1S7LA 2GIVA 4KS9A 3RBUA 3I1UA 4C7IA 2BL1A 5H84A 4I49A 2Z11A 4PK3A 3CXSA 4C2XA 2KCWA 4XPDB 3R95A 4MY3A 5CNPA 3RO0A 5BWAB 3D3SA 1CP6A 5EBVA 2OZHA 3L2NA 2FXFA 4GVWA 4CGOA 2OZUA 3RAMA 1IOFA 1R57A 2EEEA 3LWUA 2CTCA 5HIHA 1U6MA 2J8RA 2LGRA 2CNSA 3GQEA 4UEZA 3S9LA 2PJ6A 2WYRA 3SJXA 1ZR3A 1IYLA 2DPTA 3B3WA 4KLVA 3LMSA 1TXZA 3UY5A 2CNMA 2PJ8A 3D7HA 4R9MA 4JZ0A 3PP9A 2AFMA 3F5BA 3GYAA 4KLWA 5KTDA 1KUVA 4H89A 4M6HA 4MCQA 2C1CA 4JXQA 4NGSA 3SIHA 2ATRA 4IK2A 3TFYA 3SIJA 4NGRA 2RB7A 1CX8A 3H8GA 2B58A 4YFJA 3MN8A 2R1IA 4J4ZA 1XMTA 4P10A 4P6YA 3WC6A 3KL9A 4PXCA 5E96A 4TU0A 4MFPA 2PJ1A 4NXYA 4KZTA 3V45A 4MCSA 4R76A 2J9AA 1YK3A 5JM6A 1XBUA 2KQVA 4UA3A 4WWVA 1NE9A 2VZZA 4AG7A 1YGHA 3S6GA 4EVYA 4BINA 2G3TA 2VXKA 4XPDC 2F8HA 2I3CA 2Z3MA
chains in the Genus database with same CATH topology
1YW6A 3NH5A 2DX6A 2BCOA 1OBRA 4O23A 2PJ7A 4AXVA 2ZEDA 3IFEA 2PJ9A 3DGVA 6CPAA 3B3TA 2V8GA 1CPSA 3HUVA 1VHEA 4G1PA 5F09A 2FXKA 3IEHA 1H8LA 1LOKA 4OC2A 1JQGA 3GUXA 3SI2A 2GREA 3D7GA 3KQXA 4PXDA 4PXBA 5FSUA 4OC0A 3PB7X 2V8HA 1LANA 4D86A 4NGQA 3BHXA 1XMBA 2AFXA 4EMEA 4ABLA 4UEFA 1VGYA 3K2KA 4IAVA 4IHMA 3VARA 2XEJA 4ZY2A 4OC1A 3WT4A 1TY8A 2L8RA 3D66A 1AMPA 2GLFA 4P4EA 5AILA 4P4BA 4OC5A 1HEEA 4RUHA 4F9VA 2IJZA 3ETIA 1DTDA 3WC7A 3EW5A 1CPXA 2NYQA 5ELYA 2QVPA 4B6ZA 4DUKA 1QMUA 2BFRA 1ARMA 2ANPA 3EWPA 3SIGA 4PQAA 4F9UA 2BO9A 4OKOA 4EFDA 1BPMA 3MRUA 1EE3P 1FT7A 1TKFA 5K8NA 1BLLE 1TF8A 4MHZA 2PIZA 1YW4A 4UF4A 3EKEA 3V38A 5HVGA 3BI0A 5HVHA 3Q6ZA 3JZTA 4MRIA 2GLJA 2PVVA 2RFHA 5DS0A 2X47A 2CTBA 3SIIA 2ZENA 2G9DA 3B35A 3WC5A 2ZEEA 1XFOA 4J5RA 3FF3A 2ZEFA 4FAIA 3TX8A 3S9NA 5CBMA 2IQ6A 4WJBA 1TXRA 2QYVA 3CDXA 2Q43A 3B2YA 3HLPA 2PJ5A 4FBEA 2ZEGA 1LFWA 2O53A 5LYLA 2AFSA 5LYFA 5D29A 2BOAA 1BPNA 2AFOA 4PXEA 2ZEMA 3VH9A 2PJAA 1PCAA 4NJQA 4OMEA 1YD9A 5CB5A 2PCUA 2ACFA 4FWUA 1ZG7A 3BI1A 3NH8A 3SJEA 1Z8LA 2VL1A 3Q71A 5I4MA 5DUSA 4CPAA 1ELLP 3NH4A 1ZG8A 4TWEA 3FH4A 5K8PA 1IY7A 1ZG9A 2PJCA 4UEEA 4K3NA 4GM5A 4YU9A 2Q51A 2XD7A 1ZLHA 4OC4A 1HDUA 4R7MA 3FECA 3TC8A 4OIWA 3PBBA 2AFCA 2FG1A 4YWYA 4DJLA 2QJ8A 4OC3A 2ZEOA 3NFZA 2PJBA 5THWA 7CPAA 8CPAA 1XJOA 2XEGA 1XRYA 4P45A 3KHZA 5FSZA 1TKJA 3IWWA 4ABKA 5HXDA 1Y7EA 3WABA 4ETKA 3IIBA 3EWQA 4JYWA 1CBXA 4X3RA 2CF4A 2FVGA 2PJ3A 4MHPA 5E3BA 4JCAA 3EWOA 3KR5A 1Z5RA 3QNVA 3IIDA 4A38A 4Q7AA 2C6CA 1QQ9A 3SI1A 4X2TA 4UMLA 4ESSA 2JBJA 3DLJA 5IB9A 2BFQA 4ZYQA 3KR4A 5LYDA 2VRIA 5D8NA 4J5SA 3FEEA 3GLJA 1IGBA 3T8WA 4P4JA 2ZEHA 3SJFA 5CB3A 4OIDA 2EK9A 1LCPA 4W9YA 2C6GA 3D67A 4NGMA 2FAVA 2AFWA 5FSVA 2CIJA 3B3CA 2Q4ZA 2PJ2A 2ZELA 4JLLA 3ISZA 4MMOA 3BXMA 4NGTA 4ZY1A 4NJRA 3D7FA 3NA6A 1HJZA 4R8FA 4KYBA 3EJGA 3FVLA 2NSMA 3B7IA 5JGFA 2GU2A 2ZOGA 3V2BA 4FUUA 1NJRA 3CPXA 2PVWA 3CT9A 3V7ZA 4NGPA 4A37A 2PIYA 2IMOA 1BAVA 3IO1A 1Z2LA 4ZY0A 4ZX8A 5LYIA 1VIXA 5LRGA 1CP7A 1VHUA 4A39A 2V8DA 3S9MA 3PEIA 2XEFA 5LRJA 4P44A 2AFUA 4JGKA 1Y0YA 3PB8X 1LAMA 2EK8A 2AFZA 2C6PA 5FSXA 5CPAA 1LAPA 4K0CA 4MCPA 2WZNA 4P4DA 1AYEA 3KASA 3H8FA 3EWRA 2DEAA 4LQGA 1R43A 1YLOA 4ONWA 1TF9A 2O4HA 2ABZA 3IJ3A 3PB6X 3PBEA 3PFOA 5JH9A 4ZX9A 3KZWA 3PB4X 4IQYA 2EWBA 1HDQA 3D68A 2OOTA 1YSJA 3VFQA 4A94A 4JVVA 1ARLA 5HOLA 3N5FA 4MHYA 3JRUA 4Z65A 4R6TA 3H8EA 3FJUA 4TNUA 3SJGA 4H2KA 3ISXA 1M4LA 1FNOA 2ZOFA 1GYTA 4MHNA 4NGNA 4OP4A 5HVFA 3GB0A 2PE3A 3FEDA 5K8OA 1NSAA 3IC1A 2POKA 1KWMA 1PYTB 1SPVA 3SI0A 5CMSA 2JBKA 4KSIA 2ZEPA 3PB9X 3RZAA 4P4IA 3FMCA 5LRKA 3GPOA 1R3NA 4X8IA 4NFRA 4UIBA 3GQOA 3KI9A 5FSYA 2OR4A 1F2OA 4EWTA 3GPQA 4BD9A 3D4UA 1UWYA 1F2PA 3PFEA 3K9TA 3PRTA 1DE4C 3KQZA 2PRQA 3VATA 2PJ4A 1ELMP 1YMEA 3GPGA 1CG2A 3B3SA 3EJFA 2JEWA 5K8MA 1RTQA 4GUAA 4J5QA 1VHOA 1Y0RA 3KHXA 1F57A 4PPZA 1TKHA 2F7VA 2HC9A 2XEIA 3KGQA 4MXUA 3D7DA 2PJ0A 4UIAA 2V8VA 3CPAA 1Q7LA 4DYOA 3IIFA 2V77A 4ETJA 5J1QA 4MCRA 1ZR5A 4GVVA 1ZLIA 4ZI6A 3FX6A 2HB6A 3B3VA 3RBUA 3I1UA 1CP6A 3L2NA 4GVWA 3RAMA 2EEEA 3LWUA 2CTCA 5HIHA 2LGRA 3GQEA 4UEZA 3S9LA 2PJ6A 2WYRA 3SJXA 1ZR3A 3B3WA 3LMSA 1TXZA 2PJ8A 3D7HA 4JZ0A 2AFMA 4MCQA 2C1CA 4NGSA 3SIHA 4IK2A 3SIJA 4NGRA 2RB7A 1CX8A 3H8GA 3MN8A 4J4ZA 4P10A 4P6YA 3WC6A 3KL9A 4PXCA 4TU0A 2PJ1A 3V45A 4MCSA 4R76A 2J9AA 5JM6A 1XBUA 4WWVA 4P4FA 4F8ZA 2F8HA 2I3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW6 A;  3NH5 A;  2DX6 A;  2BCO A;  1OBR A;  4O23 A;  2PJ7 A;  4AXV A;  2ZED A;  3IFE A;  2PJ9 A;  3DGV A;  6CPA A;  3B3T A;  2V8G A;  1CPS A;  3HUV A;  1VHE A;  4G1P A;  5F09 A;  2FXK A;  3IEH A;  1H8L A;  1LOK A;  4OC2 A;  1JQG A;  3GUX A;  3SI2 A;  2GRE A;  3D7G A;  3KQX A;  4PXD A;  4PXB A;  5FSU A;  4OC0 A;  3PB7 X;  2V8H A;  1LAN A;  4D86 A;  4NGQ A;  3BHX A;  1XMB A;  2AFX A;  4EME A;  4ABL A;  4UEF A;  1VGY A;  3K2K A;  4IAV A;  4IHM A;  3VAR A;  2XEJ A;  4ZY2 A;  4OC1 A;  3WT4 A;  1TY8 A;  2L8R A;  3D66 A;  1AMP A;  2GLF A;  4P4E A;  5AIL A;  4P4B A;  4OC5 A;  1HEE A;  4RUH A;  4F9V A;  2IJZ A;  3ETI A;  1DTD A;  3WC7 A;  3EW5 A;  1CPX A;  2NYQ A;  5ELY A;  2QVP A;  4B6Z A;  4DUK A;  1QMU A;  2BFR A;  1ARM A;  2ANP A;  3EWP A;  3SIG A;  4PQA A;  4F9U A;  2BO9 A;  4OKO A;  4EFD A;  1BPM A;  3MRU A;  1EE3 P;  1FT7 A;  1TKF A;  5K8N A;  1BLL E;  1TF8 A;  4MHZ A;  2PIZ A;  1YW4 A;  4UF4 A;  3EKE A;  3V38 A;  5HVG A;  3BI0 A;  5HVH A;  3Q6Z A;  3JZT A;  4MRI A;  2GLJ A;  2PVV A;  2RFH A;  5DS0 A;  2X47 A;  2CTB A;  3SII A;  2ZEN A;  2G9D A;  3B35 A;  3WC5 A;  2ZEE A;  1XFO A;  4J5R A;  3FF3 A;  2ZEF A;  4FAI A;  3TX8 A;  3S9N A;  5CBM A;  2IQ6 A;  4WJB A;  1TXR A;  2QYV A;  3CDX A;  2Q43 A;  3B2Y A;  3HLP A;  2PJ5 A;  4FBE A;  2ZEG A;  1LFW A;  2O53 A;  5LYL A;  2AFS A;  5LYF A;  5D29 A;  2BOA A;  1BPN A;  2AFO A;  4PXE A;  2ZEM A;  3VH9 A;  2PJA A;  1PCA A;  4NJQ A;  4OME A;  1YD9 A;  5CB5 A;  2PCU A;  2ACF A;  4FWU A;  1ZG7 A;  3BI1 A;  3NH8 A;  3SJE A;  1Z8L A;  2VL1 A;  3Q71 A;  5I4M A;  5DUS A;  4CPA A;  1ELL P;  3NH4 A;  1ZG8 A;  4TWE A;  3FH4 A;  5K8P A;  1IY7 A;  1ZG9 A;  2PJC A;  4UEE A;  4K3N A;  4GM5 A;  4YU9 A;  2Q51 A;  2XD7 A;  1ZLH A;  4OC4 A;  1HDU A;  4R7M A;  3FEC A;  3TC8 A;  4OIW A;  3PBB A;  2AFC A;  2FG1 A;  4YWY A;  4DJL A;  2QJ8 A;  4OC3 A;  2ZEO A;  3NFZ A;  2PJB A;  5THW A;  7CPA A;  8CPA A;  1XJO A;  2XEG A;  1XRY A;  4P45 A;  3KHZ A;  5FSZ A;  1TKJ A;  3IWW A;  4ABK A;  5HXD A;  1Y7E A;  3WAB A;  4ETK A;  3IIB A;  3EWQ A;  4JYW A;  1CBX A;  4X3R A;  2CF4 A;  2FVG A;  2PJ3 A;  4MHP A;  5E3B A;  4JCA A;  3EWO A;  3KR5 A;  1Z5R A;  3QNV A;  3IID A;  4A38 A;  4Q7A A;  2C6C A;  1QQ9 A;  3SI1 A;  4X2T A;  4UML A;  4ESS A;  2JBJ A;  3DLJ A;  5IB9 A;  2BFQ A;  4ZYQ A;  3KR4 A;  5LYD A;  2VRI A;  5D8N A;  4J5S A;  3FEE A;  3GLJ A;  1IGB A;  3T8W A;  4P4J A;  2ZEH A;  3SJF A;  5CB3 A;  4OID A;  2EK9 A;  1LCP A;  4W9Y A;  2C6G A;  3D67 A;  4NGM A;  2FAV A;  2AFW A;  5FSV A;  2CIJ A;  3B3C A;  2Q4Z A;  2PJ2 A;  2ZEL A;  4JLL A;  3ISZ A;  4MMO A;  3BXM A;  4NGT A;  4ZY1 A;  4NJR A;  3D7F A;  3NA6 A;  1HJZ A;  4R8F A;  4KYB A;  3EJG A;  3FVL A;  2NSM A;  3B7I A;  5JGF A;  2GU2 A;  2ZOG A;  3V2B A;  4FUU A;  1NJR A;  3CPX A;  2PVW A;  3CT9 A;  3V7Z A;  4NGP A;  4A37 A;  2PIY A;  2IMO A;  1BAV A;  3IO1 A;  1Z2L A;  4ZY0 A;  4ZX8 A;  5LYI A;  1VIX A;  5LRG A;  1CP7 A;  1VHU A;  4A39 A;  2V8D A;  3S9M A;  3PEI A;  2XEF A;  5LRJ A;  4P44 A;  2AFU A;  4JGK A;  1Y0Y A;  3PB8 X;  1LAM A;  2EK8 A;  2AFZ A;  2C6P A;  5FSX A;  5CPA A;  1LAP A;  4K0C A;  4MCP A;  2WZN A;  4P4D A;  1AYE A;  3KAS A;  3H8F A;  3EWR A;  2DEA A;  4LQG A;  1R43 A;  1YLO A;  4ONW A;  1TF9 A;  2O4H A;  2ABZ A;  3IJ3 A;  3PB6 X;  3PBE A;  3PFO A;  5JH9 A;  4ZX9 A;  3KZW A;  3PB4 X;  4IQY A;  2EWB A;  1HDQ A;  3D68 A;  2OOT A;  1YSJ A;  3VFQ A;  4A94 A;  4JVV A;  1ARL A;  5HOL A;  3N5F A;  4MHY A;  3JRU A;  4Z65 A;  4R6T A;  3H8E A;  3FJU A;  4TNU A;  3SJG A;  4H2K A;  3ISX A;  1M4L A;  1FNO A;  2ZOF A;  1GYT A;  4MHN A;  4NGN A;  4OP4 A;  5HVF A;  3GB0 A;  2PE3 A;  3FED A;  5K8O A;  1NSA A;  3IC1 A;  2POK A;  1KWM A;  1PYT B;  1SPV A;  3SI0 A;  5CMS A;  2JBK A;  4KSI A;  2ZEP A;  3PB9 X;  3RZA A;  4P4I A;  3FMC A;  5LRK A;  3GPO A;  1R3N A;  4X8I A;  4NFR A;  4UIB A;  3GQO A;  3KI9 A;  5FSY A;  2OR4 A;  1F2O A;  4EWT A;  3GPQ A;  4BD9 A;  3D4U A;  1UWY A;  1F2P A;  3PFE A;  3K9T A;  3PRT A;  1DE4 C;  3KQZ A;  2PRQ A;  3VAT A;  2PJ4 A;  1ELM P;  1YME A;  3GPG A;  1CG2 A;  3B3S A;  3EJF A;  2JEW A;  5K8M A;  1RTQ A;  4GUA A;  4J5Q A;  1VHO A;  1Y0R A;  3KHX A;  1F57 A;  4PPZ A;  1TKH A;  2F7V A;  2HC9 A;  2XEI A;  3KGQ A;  4MXU A;  3D7D A;  2PJ0 A;  4UIA A;  2V8V A;  3CPA A;  1Q7L A;  4DYO A;  3IIF A;  2V77 A;  4ETJ A;  5J1Q A;  4MCR A;  1ZR5 A;  4GVV A;  1ZLI A;  4ZI6 A;  3FX6 A;  2HB6 A;  3B3V A;  3RBU A;  3I1U A;  1CP6 A;  3L2N A;  4GVW A;  3RAM A;  2EEE A;  3LWU A;  2CTC A;  5HIH A;  2LGR A;  3GQE A;  4UEZ A;  3S9L A;  2PJ6 A;  2WYR A;  3SJX A;  1ZR3 A;  3B3W A;  3LMS A;  1TXZ A;  2PJ8 A;  3D7H A;  4JZ0 A;  2AFM A;  4MCQ A;  2C1C A;  4NGS A;  3SIH A;  4IK2 A;  3SIJ A;  4NGR A;  2RB7 A;  1CX8 A;  3H8G A;  3MN8 A;  4J4Z A;  4P10 A;  4P6Y A;  3WC6 A;  3KL9 A;  4PXC A;  4TU0 A;  2PJ1 A;  3V45 A;  4MCS A;  4R76 A;  2J9A A;  5JM6 A;  1XBU A;  4WWV A;  4P4F A;  4F8Z A;  2F8H A;  2I3C A; 
#chains in the Genus database with same CATH topology
 1YW6 A;  3NH5 A;  3R1K A;  2PSW A;  2DX6 A;  2BCO A;  2Z3N A;  3RYO A;  1OBR A;  4O23 A;  2PJ7 A;  3ZZI A;  4AG9 A;  4R87 A;  4AXV A;  2ZED A;  1FY7 A;  3IFE A;  2PJ9 A;  2R8V A;  3EXN A;  2HUZ A;  3DGV A;  3B3T A;  4BBH A;  6CPA A;  4C2Z A;  2V8G A;  1CPS A;  1A2Z A;  4UCN A;  3HUV A;  4PSW A;  4A2Z A;  1VHE A;  4G1P A;  3SXN A;  2K5T A;  5F09 A;  4B5P B;  2FXK A;  3BLN A;  3G3S A;  3R9E A;  5I0C A;  3IEH A;  1H8L A;  4KVO E;  1NSL A;  4U9Y A;  1B87 A;  2PC1 A;  1LOK A;  4XNH B;  4OC2 A;  5EC4 A;  1JQG A;  5AG6 A;  3GUX A;  4U5Y A;  3SI2 A;  4YGO A;  2GRE A;  5ISV A;  3D7G A;  3KQX A;  2R7H A;  1IYK A;  1KZF A;  4PXD A;  3TTH A;  4II9 A;  4PXB A;  5FSU A;  1RXT A;  3PB7 X;  4OC0 A;  4CYP A;  2V8H A;  1LAN A;  4D86 A;  4NGQ A;  3BHX A;  2EUI A;  1B6B A;  1XMB A;  2AFX A;  4EME A;  2FIW A;  4ABL A;  4CAW A;  4UEF A;  1VGY A;  1GHE A;  3FIX A;  3K2K A;  4IAV A;  4IHM A;  3VAR A;  2XEJ A;  2YGW A;  4BMH A;  4ZY2 A;  2FIA A;  4HKF A;  1M4G A;  2Z3O A;  2O28 A;  2Q04 A;  4OC1 A;  3WT4 A;  3K9U A;  1TY8 A;  2L8R A;  1S7K A;  1QSO A;  3D66 A;  1Z9U A;  1AMP A;  3MGD A;  1MJB A;  2Q4Y A;  4L89 A;  5HMN A;  2GLF A;  4B5P A;  4P4E A;  1IID A;  5AIL A;  4CRZ B;  3CZX A;  4P4B A;  4OC5 A;  1HEE A;  4RUH A;  3LD2 A;  3FBU A;  2YNC A;  2IJZ A;  3SXO A;  4F9V A;  2ARH A;  4OAD A;  1QST A;  3ETI A;  1DTD A;  3WC7 A;  3EW5 A;  4E0A A;  3A9L A;  2B4B A;  4RI1 A;  1CPX A;  2NYQ A;  5ELY A;  1TIQ A;  2QVP A;  2OB0 A;  4A33 A;  4B6Z A;  5G1Z A;  4DUK A;  1QMU A;  2BFR A;  1ARM A;  2ANP A;  3EWP A;  3SIG A;  4YRH A;  2B3U A;  4PQA A;  4F9U A;  2BO9 A;  4OKO A;  4EFD A;  1BPM A;  3JVN A;  3MRU A;  4RS2 A;  1EE3 P;  1FT7 A;  2FE7 A;  2Z3P A;  3VWD A;  1TKF A;  3TO6 A;  5K8N A;  4KOU A;  1BLL E;  1TF8 A;  5FVJ A;  4MHZ A;  2PIZ A;  1YW4 A;  1X12 A;  2GE3 A;  2REE A;  5IV0 A;  3N7Z A;  4UF4 A;  1M4D A;  1OZP A;  1YX0 A;  3EKE A;  3V38 A;  5HVG A;  3BI0 A;  2Q0Y A;  4JXR A;  2Z3L A;  5HVH A;  3Q6Z A;  4MJ8 A;  3JZT A;  3D8P A;  4ONU A;  4Y49 B;  3W6S A;  2BEI A;  2VEZ A;  4MRI A;  2GLJ A;  2PVV A;  1S7F A;  2RFH A;  3LOD A;  2X47 A;  5DS0 A;  2CTB A;  3SII A;  2ZEN A;  2F5I A;  1IB1 E;  4PSX A;  2G9D A;  3B35 A;  3WC5 A;  1KUX A;  1XE4 A;  2QIR A;  2ZEE A;  1XFO A;  3T9Y A;  5KTA A;  4J5R A;  3FF3 A;  5JQ4 A;  1K4J A;  1UFH A;  2ZEF A;  2JDC A;  4DNC A;  3EO4 A;  4CGP A;  1MJA A;  4B11 A;  4FAI A;  1X10 A;  4FD7 A;  4LX9 A;  2P6F A;  5CBM A;  1YVK A;  4UCM A;  3TX8 A;  1P4N A;  1S7N A;  2IQ6 A;  1WK4 A;  4WJB A;  4B10 A;  1TXR A;  2QYV A;  1M44 A;  2Q43 A;  2B4D B;  3CDX A;  3DNS A;  1IOI A;  3B2Y A;  3HLP A;  2PJ5 A;  4FBE A;  1V0C A;  2ZEG A;  1LFW A;  1XEB A;  2O53 A;  5LYL A;  2AFS A;  5GCN A;  5LYF A;  3IGR A;  2JLM A;  2JDD A;  5D29 A;  4IUS A;  2BOA A;  4QVT A;  3TOB A;  1BPN A;  2AFO A;  4AB7 A;  4PXE A;  1Z8W A;  2ZEM A;  3WR7 A;  2AE6 A;  3VH9 A;  2WPW A;  1XF8 A;  1PCA A;  2PJA A;  4NJQ A;  4OME A;  3T90 A;  2HQY A;  1YD9 A;  5AG4 A;  1BO4 A;  2P6E A;  5CB5 A;  2PCU A;  2ZXV A;  2ACF A;  3F8K A;  1ZG7 A;  3BI1 A;  3NH8 A;  4FWU A;  3SJE A;  1Z8L A;  4CGN A;  3TO7 A;  2VL1 A;  2Y0M A;  5J8C A;  3TCV A;  3Q71 A;  2FL4 A;  1JWQ A;  4MI4 A;  2WUU A;  5I4M A;  5DUS A;  3QAY A;  2Z10 A;  1N71 A;  1ELL P;  4CPA A;  3NH4 A;  4K30 A;  1ZG8 A;  2JEV A;  3LAC A;  4TWE A;  4AVB A;  3FH4 A;  5K8P A;  3DSB A;  4H6Z A;  4U9Z A;  2CXA A;  1IY7 A;  1ZG9 A;  2PJC A;  2PR1 A;  4UEE A;  4B13 A;  2JZE A;  4K3N A;  4GM5 A;  4YU9 A;  2B4D A;  4B5O A;  1S5K A;  1I21 A;  2Q51 A;  2XD7 A;  1VHS A;  2Z0Z A;  3FXT A;  1ZLH A;  2D4P A;  4M6I A;  2D4O A;  2X7B A;  4OC4 A;  1HDU A;  4R7M A;  2NMT A;  3FEC A;  4OIW A;  4UCP A;  3TC8 A;  2ZW5 A;  2AFC A;  3PBB A;  2FG1 A;  1Q2D A;  4CRY B;  2HV2 A;  4HNW B;  4YWY A;  3RNZ A;  4AVA A;  4KOT A;  2P6G A;  4B14 A;  3W91 A;  4DJL A;  2CY2 A;  1Z8T A;  4HPS A;  4A31 A;  3IWE A;  2QJ8 A;  4JD6 A;  3OWC A;  4OC3 A;  2ZEO A;  1ZO0 A;  2I00 A;  3NFZ A;  4MBU A;  4MFK A;  3TO9 A;  2PJB A;  5THW A;  7CPA A;  4A32 A;  8CPA A;  4XNH C;  4XPK A;  2RNK A;  4A95 A;  1XJO A;  2XEG A;  3R9G A;  3C26 A;  4A37 A;  1XRY A;  4P45 A;  2B5G B;  3KHZ A;  5FSZ A;  3G8W A;  1TKJ A;  4B12 A;  3IWW A;  4ABK A;  2FS5 A;  3H5Z A;  4JLY A;  4CAV A;  5HXD A;  1Y7E A;  3WAB A;  4ETK A;  3IIB A;  3EWQ A;  4JYW A;  1CBX A;  4KOW A;  4X3R A;  2CF4 A;  2FVG A;  2DF5 A;  2PRB A;  2PJ3 A;  4MHP A;  2GAN A;  2Q4V A;  5E3B A;  1MJ9 A;  4ZGY B;  2Q7B A;  4JCA A;  4KVM E;  3EWO A;  3KR5 A;  1CM0 A;  1Z5R A;  2DPS A;  4J3G A;  3QNV A;  3IID A;  1VKC A;  4A38 A;  3R96 A;  4Q7A A;  5F49 A;  1I12 A;  2C6C A;  1QQ9 A;  4ZBG A;  3SI1 A;  4F0Y A;  1Y9W A;  4X2T A;  4UML A;  4ESS A;  2ZW7 A;  5J8F A;  4CAX A;  2VQY A;  2JBJ A;  3DLJ A;  5IB9 A;  5A27 A;  2BFQ A;  3QB8 A;  4ZYQ A;  3KR4 A;  5LYD A;  2VRI A;  5D8N A;  4J5S A;  3FRM A;  4RN7 A;  3FEE A;  3GLJ A;  1IGB A;  5EMI A;  1M4I A;  3T8W A;  4P4J A;  1CJW A;  4E8O A;  2ZEH A;  3SJF A;  2QEC A;  5CB3 A;  3DR6 A;  4OID A;  2EK9 A;  2PR8 A;  1LCP A;  3PZJ A;  2C6G A;  3D67 A;  4NGM A;  2FAV A;  4QB9 A;  4HNY B;  1Q2Y A;  4W9Y A;  3DR8 A;  3IU2 A;  5KTC A;  2AFW A;  4PV6 A;  4M6G A;  4GXH A;  2PQ8 A;  4MY0 A;  2OU2 A;  4MFZ A;  4Q36 A;  2VBQ A;  2BUE A;  5FSV A;  1Y9K A;  4L8A A;  4UFX A;  5G21 A;  2CIJ A;  3B3C A;  2Q4Z A;  1RO5 A;  4FD6 A;  2PJ2 A;  2ZEL A;  4CS0 B;  4CYN A;  4JLL A;  2REF A;  3ISZ A;  3TT2 A;  4M85 A;  2EBJ A;  4KOX A;  5F46 A;  1YVO A;  4MMO A;  3BXM A;  5C82 A;  4NGT A;  3F0A A;  4ZY1 A;  3IWG A;  5F47 A;  3P2H A;  4R57 A;  4NJR A;  3D7F A;  4UWI A;  1SQH A;  5A28 A;  4MFL A;  5AG5 A;  3NA6 A;  5G22 A;  3EFA A;  1HJZ A;  4R8F A;  2Q7S A;  4KYB A;  3S6K A;  3EJG A;  3FVL A;  3SHP A;  4CGM A;  2VI7 A;  2NSM A;  3B7I A;  4LUA A;  1XOV A;  5JGF A;  2GU2 A;  2ZOG A;  3V2B A;  4M3S A;  4FUU A;  4MHD A;  1MK4 A;  1NJR A;  3CPX A;  4KSA A;  1J4J A;  4NEX A;  2BSW A;  2PVW A;  3CT9 A;  3QAH A;  4NGP A;  3V7Z A;  2JZD A;  4MFJ A;  4FD4 A;  2PIY A;  4R3K A;  4C7H A;  2IMO A;  4CYQ A;  1BAV A;  3IO1 A;  1Z2L A;  4ZY0 A;  4ZX8 A;  2RC4 A;  4QC6 A;  5LYI A;  1YRE A;  1IIC A;  4A30 A;  1LRZ A;  2OH1 A;  4CYO A;  2YNC C;  1VIX A;  2ZW6 A;  5LRG A;  2W2G A;  1YQE A;  1CP7 A;  2Z3K A;  1VHU A;  2EVN A;  3VWE A;  4A39 A;  2V8D A;  4MFQ A;  3S9M A;  3PEI A;  2XEF A;  5LRJ A;  4P44 A;  2AFU A;  2I79 A;  5DWN A;  4JGK A;  4UFW A;  1Y0Y A;  3PB8 X;  1LAM A;  4NF1 A;  2EK8 A;  2FT0 A;  2AFZ A;  2C6P A;  1YR0 A;  2VZY A;  4UWJ A;  1YLE A;  2OZG A;  3DDD A;  5FSX A;  3JUW A;  5CPA A;  4GS4 A;  1LAP A;  4K0C A;  2WSA A;  3ZJ0 A;  4P4F A;  3KKW A;  4KOS A;  4MCP A;  2WZN A;  4P4D A;  1AYE A;  3KAS A;  3H8F A;  3EWR A;  2DEA A;  2ZPA A;  3B8G A;  4LQG A;  1R43 A;  4KOY A;  1YLO A;  2YNE A;  1TF9 A;  4ONW A;  2O4H A;  3JTK A;  2ABZ A;  3IJ3 A;  3PB6 X;  3PBE A;  3PFO A;  1BOB A;  4ZX9 A;  3BJ7 A;  3KZW A;  3PB4 X;  4IQY A;  4NCZ A;  5DWM A;  2EWB A;  1HDQ A;  3D68 A;  2OOT A;  1Y7R A;  4KVX A;  1YSJ A;  1I1D A;  3VFQ A;  5AG7 A;  3IU1 A;  1NMT A;  4A94 A;  1AUG A;  4JVV A;  1ARL A;  2B3V A;  3S6H A;  2WCT A;  5HOL A;  2A4N A;  3CXP A;  2YND A;  3S9N A;  1QSN A;  3N5F A;  3GY9 A;  4MHY A;  3JRU A;  4Z65 A;  4R6T A;  3H8E A;  3FJU A;  4TNU A;  3SJG A;  4H2K A;  3ISX A;  4Q38 A;  1Q2C A;  4Y49 C;  1M4L A;  1FNO A;  1PUA A;  2ZOF A;  1PU9 A;  2PDO A;  4NSQ A;  2FCK A;  1GYT A;  4MHN A;  4NGN A;  4OP4 A;  4F0X A;  5HVF A;  1Z4E A;  3GB0 A;  2PE3 A;  3FED A;  1P0H A;  2WPX A;  5K8O A;  4LQ6 A;  1NSA A;  1XIX A;  2Q44 A;  2POK A;  3IC1 A;  1KWM A;  1PYT B;  1SPV A;  3SI0 A;  2ZW4 A;  4KOV A;  3NE7 A;  3W6X A;  5CMS A;  1Z8X A;  3BJ8 A;  2JBK A;  4KUB A;  3V8I A;  4KSI A;  2ZEP A;  3PB9 X;  3RZA A;  4P4I A;  1KUY A;  2J8N A;  3FMC A;  2IL4 A;  5F48 A;  5LRK A;  3GPO A;  1R3N A;  4PK2 A;  4X8I A;  2AJ6 A;  4UFV A;  4NFR A;  4UIB A;  3GQO A;  4E2A A;  5IB0 A;  2EO8 A;  3KI9 A;  1S3Z A;  4XPL A;  5FSY A;  2OR4 A;  3FYN A;  1F2O A;  1L0C A;  3GIU A;  4X5K A;  2CNT A;  4EWT A;  3GPQ A;  4BD9 A;  2GFQ A;  3D2M A;  2H5M A;  1UWY A;  3D4U A;  3EC4 A;  2G0B A;  2B5G A;  4ORF A;  1F2P A;  1ON0 A;  2JZF A;  1S60 A;  4FD5 A;  3PFE A;  4AVC A;  4HNX B;  4OAE A;  3K9T A;  3PRT A;  5JPH A;  3I9S A;  1DE4 C;  3KQZ A;  4JJX A;  2PRQ A;  3VAT A;  2PJ4 A;  3S6F A;  4CAE A;  1ELM P;  3FB3 A;  4IF5 A;  4JWP A;  1YME A;  3GPG A;  1CG2 A;  4KSF A;  4QUS A;  3B3S A;  2P0W A;  3EJF A;  2JEW A;  3TOA A;  4C2Y A;  5K8M A;  1RTQ A;  3E0K A;  4GUA A;  2QML A;  4J5Q A;  1VHO A;  1QSR A;  1Y0R A;  3KHX A;  4UBR A;  5JH9 A;  3PGP A;  1F57 A;  5G20 A;  4H6U A;  4CAF A;  4PPZ A;  1TKH A;  1M1D A;  3D2P A;  3CXQ A;  2J8M A;  1IU8 A;  2F7V A;  4KUA A;  2HC9 A;  2XEI A;  5AGE A;  3KGQ A;  4MXU A;  3R9F A;  2FSR A;  3D7D A;  2PJ0 A;  4UIA A;  4F8Z A;  4QBJ A;  2ODF A;  2C27 A;  1QSM A;  2G3A A;  2V8V A;  3CPA A;  5H86 A;  1Q7L A;  4OLL A;  2DXQ A;  4C68 A;  4DYO A;  3IIF A;  2V77 A;  3TE4 A;  5C88 A;  5IX3 A;  3H4Q A;  2R98 A;  3GKR A;  4CGL A;  3EY5 A;  4R3L A;  5HH1 A;  4ETJ A;  5J1Q A;  1Z4R A;  3NE8 A;  3P2F A;  4MCR A;  3I3G A;  1ZR5 A;  4GVV A;  3FNC A;  1ZLI A;  4KOR A;  4ZI6 A;  2HB6 A;  3FX6 A;  3B3V A;  1WWZ A;  4F6A A;  1S7L A;  2GIV A;  4KS9 A;  3RBU A;  3I1U A;  4C7I A;  2BL1 A;  5H84 A;  4I49 A;  2Z11 A;  4PK3 A;  3CXS A;  4C2X A;  2KCW A;  4XPD B;  3R95 A;  4MY3 A;  5CNP A;  3RO0 A;  5BWA B;  3D3S A;  1CP6 A;  5EBV A;  2OZH A;  3L2N A;  2FXF A;  4GVW A;  4CGO A;  2OZU A;  3RAM A;  1IOF A;  1R57 A;  2EEE A;  3LWU A;  2CTC A;  5HIH A;  1U6M A;  2J8R A;  2LGR A;  2CNS A;  3GQE A;  4UEZ A;  3S9L A;  2PJ6 A;  2WYR A;  3SJX A;  1ZR3 A;  1IYL A;  2DPT A;  3B3W A;  4KLV A;  3LMS A;  1TXZ A;  3UY5 A;  2CNM A;  2PJ8 A;  3D7H A;  4R9M A;  4JZ0 A;  3PP9 A;  2AFM A;  3F5B A;  3GYA A;  4KLW A;  5KTD A;  1KUV A;  4H89 A;  4M6H A;  4MCQ A;  2C1C A;  4JXQ A;  4NGS A;  3SIH A;  2ATR A;  4IK2 A;  3TFY A;  3SIJ A;  4NGR A;  2RB7 A;  1CX8 A;  3H8G A;  2B58 A;  4YFJ A;  3MN8 A;  2R1I A;  4J4Z A;  1XMT A;  4P10 A;  4P6Y A;  3WC6 A;  3KL9 A;  4PXC A;  5E96 A;  4TU0 A;  4MFP A;  2PJ1 A;  4NXY A;  4KZT A;  3V45 A;  4MCS A;  4R76 A;  2J9A A;  1YK3 A;  5JM6 A;  1XBU A;  2KQV A;  4UA3 A;  4WWV A;  1NE9 A;  2VZZ A;  4AG7 A;  1YGH A;  3S6G A;  4EVY A;  4BIN A;  2G3T A;  2VXK A;  4XPD C;  2F8H A;  2I3C A;  2Z3M A; 
#chains in the Genus database with same CATH homology
 1YW6 A;  3NH5 A;  2DX6 A;  2BCO A;  1OBR A;  4O23 A;  2PJ7 A;  4AXV A;  2ZED A;  3IFE A;  2PJ9 A;  3DGV A;  6CPA A;  3B3T A;  2V8G A;  1CPS A;  3HUV A;  1VHE A;  4G1P A;  5F09 A;  2FXK A;  3IEH A;  1H8L A;  1LOK A;  4OC2 A;  1JQG A;  3GUX A;  3SI2 A;  2GRE A;  3D7G A;  3KQX A;  4PXD A;  4PXB A;  5FSU A;  4OC0 A;  3PB7 X;  2V8H A;  1LAN A;  4D86 A;  4NGQ A;  3BHX A;  1XMB A;  2AFX A;  4EME A;  4ABL A;  4UEF A;  1VGY A;  3K2K A;  4IAV A;  4IHM A;  3VAR A;  2XEJ A;  4ZY2 A;  4OC1 A;  3WT4 A;  1TY8 A;  2L8R A;  3D66 A;  1AMP A;  2GLF A;  4P4E A;  5AIL A;  4P4B A;  4OC5 A;  1HEE A;  4RUH A;  4F9V A;  2IJZ A;  3ETI A;  1DTD A;  3WC7 A;  3EW5 A;  1CPX A;  2NYQ A;  5ELY A;  2QVP A;  4B6Z A;  4DUK A;  1QMU A;  2BFR A;  1ARM A;  2ANP A;  3EWP A;  3SIG A;  4PQA A;  4F9U A;  2BO9 A;  4OKO A;  4EFD A;  1BPM A;  3MRU A;  1EE3 P;  1FT7 A;  1TKF A;  5K8N A;  1BLL E;  1TF8 A;  4MHZ A;  2PIZ A;  1YW4 A;  4UF4 A;  3EKE A;  3V38 A;  5HVG A;  3BI0 A;  5HVH A;  3Q6Z A;  3JZT A;  4MRI A;  2GLJ A;  2PVV A;  2RFH A;  5DS0 A;  2X47 A;  2CTB A;  3SII A;  2ZEN A;  2G9D A;  3B35 A;  3WC5 A;  2ZEE A;  1XFO A;  4J5R A;  3FF3 A;  2ZEF A;  4FAI A;  3TX8 A;  3S9N A;  5CBM A;  2IQ6 A;  4WJB A;  1TXR A;  2QYV A;  3CDX A;  2Q43 A;  3B2Y A;  3HLP A;  2PJ5 A;  4FBE A;  2ZEG A;  1LFW A;  2O53 A;  5LYL A;  2AFS A;  5LYF A;  5D29 A;  2BOA A;  1BPN A;  2AFO A;  4PXE A;  2ZEM A;  3VH9 A;  2PJA A;  1PCA A;  4NJQ A;  4OME A;  1YD9 A;  5CB5 A;  2PCU A;  2ACF A;  4FWU A;  1ZG7 A;  3BI1 A;  3NH8 A;  3SJE A;  1Z8L A;  2VL1 A;  3Q71 A;  5I4M A;  5DUS A;  4CPA A;  1ELL P;  3NH4 A;  1ZG8 A;  4TWE A;  3FH4 A;  5K8P A;  1IY7 A;  1ZG9 A;  2PJC A;  4UEE A;  4K3N A;  4GM5 A;  4YU9 A;  2Q51 A;  2XD7 A;  1ZLH A;  4OC4 A;  1HDU A;  4R7M A;  3FEC A;  3TC8 A;  4OIW A;  3PBB A;  2AFC A;  2FG1 A;  4YWY A;  4DJL A;  2QJ8 A;  4OC3 A;  2ZEO A;  3NFZ A;  2PJB A;  5THW A;  7CPA A;  8CPA A;  1XJO A;  2XEG A;  1XRY A;  4P45 A;  3KHZ A;  5FSZ A;  1TKJ A;  3IWW A;  4ABK A;  5HXD A;  1Y7E A;  3WAB A;  4ETK A;  3IIB A;  3EWQ A;  4JYW A;  1CBX A;  4X3R A;  2CF4 A;  2FVG A;  2PJ3 A;  4MHP A;  5E3B A;  4JCA A;  3EWO A;  3KR5 A;  1Z5R A;  3QNV A;  3IID A;  4A38 A;  4Q7A A;  2C6C A;  1QQ9 A;  3SI1 A;  4X2T A;  4UML A;  4ESS A;  2JBJ A;  3DLJ A;  5IB9 A;  2BFQ A;  4ZYQ A;  3KR4 A;  5LYD A;  2VRI A;  5D8N A;  4J5S A;  3FEE A;  3GLJ A;  1IGB A;  3T8W A;  4P4J A;  2ZEH A;  3SJF A;  5CB3 A;  4OID A;  2EK9 A;  1LCP A;  4W9Y A;  2C6G A;  3D67 A;  4NGM A;  2FAV A;  2AFW A;  5FSV A;  2CIJ A;  3B3C A;  2Q4Z A;  2PJ2 A;  2ZEL A;  4JLL A;  3ISZ A;  4MMO A;  3BXM A;  4NGT A;  4ZY1 A;  4NJR A;  3D7F A;  3NA6 A;  1HJZ A;  4R8F A;  4KYB A;  3EJG A;  3FVL A;  2NSM A;  3B7I A;  5JGF A;  2GU2 A;  2ZOG A;  3V2B A;  4FUU A;  1NJR A;  3CPX A;  2PVW A;  3CT9 A;  3V7Z A;  4NGP A;  4A37 A;  2PIY A;  2IMO A;  1BAV A;  3IO1 A;  1Z2L A;  4ZY0 A;  4ZX8 A;  5LYI A;  1VIX A;  5LRG A;  1CP7 A;  1VHU A;  4A39 A;  2V8D A;  3S9M A;  3PEI A;  2XEF A;  5LRJ A;  4P44 A;  2AFU A;  4JGK A;  1Y0Y A;  3PB8 X;  1LAM A;  2EK8 A;  2AFZ A;  2C6P A;  5FSX A;  5CPA A;  1LAP A;  4K0C A;  4MCP A;  2WZN A;  4P4D A;  1AYE A;  3KAS A;  3H8F A;  3EWR A;  2DEA A;  4LQG A;  1R43 A;  1YLO A;  4ONW A;  1TF9 A;  2O4H A;  2ABZ A;  3IJ3 A;  3PB6 X;  3PBE A;  3PFO A;  5JH9 A;  4ZX9 A;  3KZW A;  3PB4 X;  4IQY A;  2EWB A;  1HDQ A;  3D68 A;  2OOT A;  1YSJ A;  3VFQ A;  4A94 A;  4JVV A;  1ARL A;  5HOL A;  3N5F A;  4MHY A;  3JRU A;  4Z65 A;  4R6T A;  3H8E A;  3FJU A;  4TNU A;  3SJG A;  4H2K A;  3ISX A;  1M4L A;  1FNO A;  2ZOF A;  1GYT A;  4MHN A;  4NGN A;  4OP4 A;  5HVF A;  3GB0 A;  2PE3 A;  3FED A;  5K8O A;  1NSA A;  3IC1 A;  2POK A;  1KWM A;  1PYT B;  1SPV A;  3SI0 A;  5CMS A;  2JBK A;  4KSI A;  2ZEP A;  3PB9 X;  3RZA A;  4P4I A;  3FMC A;  5LRK A;  3GPO A;  1R3N A;  4X8I A;  4NFR A;  4UIB A;  3GQO A;  3KI9 A;  5FSY A;  2OR4 A;  1F2O A;  4EWT A;  3GPQ A;  4BD9 A;  3D4U A;  1UWY A;  1F2P A;  3PFE A;  3K9T A;  3PRT A;  1DE4 C;  3KQZ A;  2PRQ A;  3VAT A;  2PJ4 A;  1ELM P;  1YME A;  3GPG A;  1CG2 A;  3B3S A;  3EJF A;  2JEW A;  5K8M A;  1RTQ A;  4GUA A;  4J5Q A;  1VHO A;  1Y0R A;  3KHX A;  1F57 A;  4PPZ A;  1TKH A;  2F7V A;  2HC9 A;  2XEI A;  3KGQ A;  4MXU A;  3D7D A;  2PJ0 A;  4UIA A;  2V8V A;  3CPA A;  1Q7L A;  4DYO A;  3IIF A;  2V77 A;  4ETJ A;  5J1Q A;  4MCR A;  1ZR5 A;  4GVV A;  1ZLI A;  4ZI6 A;  3FX6 A;  2HB6 A;  3B3V A;  3RBU A;  3I1U A;  1CP6 A;  3L2N A;  4GVW A;  3RAM A;  2EEE A;  3LWU A;  2CTC A;  5HIH A;  2LGR A;  3GQE A;  4UEZ A;  3S9L A;  2PJ6 A;  2WYR A;  3SJX A;  1ZR3 A;  3B3W A;  3LMS A;  1TXZ A;  2PJ8 A;  3D7H A;  4JZ0 A;  2AFM A;  4MCQ A;  2C1C A;  4NGS A;  3SIH A;  4IK2 A;  3SIJ A;  4NGR A;  2RB7 A;  1CX8 A;  3H8G A;  3MN8 A;  4J4Z A;  4P10 A;  4P6Y A;  3WC6 A;  3KL9 A;  4PXC A;  4TU0 A;  2PJ1 A;  3V45 A;  4MCS A;  4R76 A;  2J9A A;  5JM6 A;  1XBU A;  4WWV A;  4P4F A;  4F8Z A;  2F8H A;  2I3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...