4R6TA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
514
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords M17 leucyl aminopeptidase
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 168
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r6tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r6tA02
5LRKA 4RUHA 3EWPA 1R3NA 4PXDA 3FX6A 2AFMA 2V8DA 4JYWA 3GQOA 3KZWA 2DEAA 3V38A 4A94A 4OIDA 2NSMA 4ABKA 1CG2A 3HUVA 2FXKA 2C6CA 4R7MA 3I1UA 2EK8A 3FMCA 2IMOA 4KYBA 2BO9A 5DS0A 2RFHA 4EWTA 4UEFA 2JBJA 3FJUA 3GB0A 3B3VA 8CPAA 1M4LA 2PJ3A 3D7DA 2CTCA 2WZNA 4OIWA 3PBBA 4P4JA 2XEGA 4UIAA 1ELLP 2G9DA 4IK2A 3VH9A 5K8OA 4UEZA 4GM5A 2O53A 2V8VA 3DLJA 3MN8A 4YU9A 3EWQA 5LYLA 2JEWA 5J1QA 1LANA 3PB8X 3KI9A 5K8MA 4EFDA 3KHXA 4BD9A 5LYFA 4MCRA 5LYDA 1SPVA 3LMSA 3PBEA 2FAVA 2FG1A 2EWBA 4P4DA 4P4BA 3WC7A 4ZY1A 1F57A 4DUKA 1LFWA 2L8RA 4MMOA 1TKJA 1UWYA 5CPAA 3EWRA 3KGQA 1ZG8A 3GLJA 3TX8A 3ISXA 1TY8A 4GVWA 5JGFA 4ZY2A 3QNVA 1TF9A 1Y0RA 1DE4C 2DX6A 1LAMA 4EMEA 2ZEOA 3NH4A 4NGQA 2QYVA 3B3SA 2AFXA 5JH9A 3SIJA 2CF4A 4R6TA 2PJCA 3B2YA 2ZENA 1PYTB 3RBUA 3SIGA 1TXRA 3SJGA 2JBKA 2BOAA 2I3CA 4IQYA 3RAMA 3SIHA 1GYTA 2PJ2A 3GPGA 3FECA 3PB4X 4P44A 4JGKA 2AFWA 2GU2A 5D29A 3D7HA 4NGSA 1Y7EA 3B35A 3PFOA 2OOTA 3BI0A 2PJ8A 2WYRA 3HLPA 5HVFA 3TC8A 3K9TA 3EJFA 3IFEA 4UEEA 3IWWA 4H2KA 4NGRA 4LQGA 4F9UA 2PRQA 2PJ1A 1QQ9A 2ACFA 5HXDA 1ZLIA 3GPOA 5JM6A 1XFOA 3JRUA 4ZX8A 2PJBA 3K2KA 4NJQA 2RB7A 2V77A 4OKOA 4PXBA 5CB5A 4OC0A 3KR5A 1DTDA 2C1CA 2EEEA 3D7FA 3PB7X 2NYQA 2C6GA 4MHZA 4MCPA 2BFRA 5HIHA 1YMEA 5K8PA 4K0CA 3VARA 2LGRA 4A38A 1AMPA 4ZY0A 5CB3A 2PJ9A 3T8WA 1CPSA 4OMEA 1XJOA 3KL9A 2XEJA 1VHEA 2PIYA 4TWEA 1QMUA 2GREA 3IC1A 2F7VA 2V8GA 3V7ZA 2ZEEA 2J9AA 3PRTA 3KQZA 1KWMA 2CTBA 4P45A 4FAIA 1HEEA 4PXCA 5FSXA 1BPMA 3GPQA 3SIIA 1Q7LA 3VATA 4MCSA 4P4FA 2BCOA 4A39A 5HVGA 2HC9A 1HDUA 3IJ3A 1ARMA 3H8FA 4MHNA 2AFSA 2ZEPA 1ZR5A 2Q43A 5LRGA 3SI0A 3BI1A 2PJAA 3ISZA 4FUUA 3FEDA 5CBMA 4OC4A 2IQ6A 4ABLA 3CPAA 5E3BA 1CP7A 1TKHA 3N5FA 1LOKA 4K3NA 2POKA 3IIBA 2F8HA 2AFZA 1YW6A 1BLLE 2ABZA 3PEIA 1YLOA 2ZEDA 2PJ7A 1EE3P 3D67A 2VRIA 4A37A 3S9LA 3WC5A 2CIJA 2PJ5A 3L2NA 1YSJA 4J4ZA 3V2BA 4NFRA 4R8FA 3B3TA 4YWYA 2O4HA 4NGPA 4P10A 5AILA 1TKFA 1XRYA 3FEEA 4X8IA 2QJ8A 4O23A 5IB9A 1AYEA 2HB6A 1NJRA 4MHYA 3KQXA 2GLJA 1Z8LA 5ELYA 4JLLA 3GUXA 4J5QA 2PJ0A 1PCAA 4ONWA 5CMSA 4JZ0A 3SJFA 5I4MA 2PCUA 6CPAA 2V8HA 3CPXA 1ELMP 4CPAA 4TNUA 4ZYQA 3NH5A 3PB6X 4ZI6A 3LWUA 4OC2A 4MXUA 3ETIA 4D86A 3H8EA 1XMBA 4OC5A 3EWOA 3D7GA 4FWUA 4MRIA 4W9YA 4IHMA 2PE3A 1OBRA 3IEHA 1BAVA 2PVVA 4P4EA 4MCQA 3WABA 4F8ZA 3RZAA 4OC3A 2AFCA 2ANPA 3GQEA 4GUAA 1XBUA 2XEIA 3S9MA 4UMLA 3EJGA 3WC6A 4UIBA 3Q6ZA 3EKEA 2FVGA 2PIZA 5K8NA 2IJZA 1VGYA 5THWA 5HVHA 3KR4A 2VL1A 1ZR3A 4DJLA 3BHXA 4Q7AA 1BPNA 5LRJA 2ZEHA 4TU0A 2ZOFA 2ZEGA 1NSAA 2XEFA 1JQGA 4P4IA 4FBEA 2ZELA 3JZTA 2PVWA 2AFUA 3PB9X 4WWVA 1TF8A 3SJXA 2X47A 3FF3A 3SI2A 4Z65A 4ETJA 4NGMA 3S9NA 3B3WA 4G1PA 1H8LA 3B3CA 4J5SA 1IGBA 3VFQA 4NGNA 4F9VA 5D8NA 1VIXA 1Z5RA 2QVPA 1FNOA 2PJ6A 1LCPA 3D68A 1ZG7A 1LAPA 3BXMA 4DYOA 2ZEMA 3FH4A 4ESSA 4JVVA 4KSIA 4MHPA 3MRUA 3Q71A 1VHOA 3KHZA 4NJRA 4J5RA 5HOLA 2BFQA 2GLFA 1CPXA 5DUSA 1FT7A 4NGTA 5F09A 3WT4A 2ZEFA 5FSZA 1Z2LA 3SI1A 3EW5A 4X2TA 1ZG9A 1HJZA 4GVVA 7CPAA 2XD7A 3V45A 4ETKA 3KASA 1F2PA 1CX8A 3NH8A 4JCAA 2OR4A 1CBXA 3FVLA 1CP6A 3NFZA 5FSUA 3PFEA 1R43A 2PJ4A 3CDXA 1IY7A 1Y0YA 4ZX9A 2C6PA 2Q4ZA 4PQAA 3IO1A 4PXEA 4UF4A 4X3RA 3IIFA 3DGVA 5FSYA 2Q51A 2ZOGA 3D4UA 4IAVA 2EK9A 1YD9A 3D66A 3H8GA 1TXZA 4B6ZA 4WJBA 1ZLHA 4OC1A 4AXVA 1ARLA 4PPZA 1RTQA 2AFOA 3NA6A 3B7IA 1HDQA 4P6YA 3CT9A 3SJEA 1VHUA 3IIDA 1YW4A 5FSVA 1F2OA 4OP4A 4R76A 5LYIA
chains in the Genus database with same CATH superfamily
3TO6A 2GIVA 2CNSA 5LRKA 4RUHA 4PK3A 2PC1A 5G21A 3EWPA 3P2HA 4CYNA 1XIXA 1R3NA 4PXDA 3FX6A 4E2AA 1MJAA 2AFMA 2V8DA 4FD5A 4JYWA 3GQOA 1I21A 1SQHA 5KTAA 3IWEA 3KZWA 2DEAA 3V38A 2J8NA 4LUAA 4OIDA 4A94A 5E96A 2NSMA 4MBUA 4ABKA 1CG2A 3HUVA 2FXKA 2C6CA 4L8AA 4OADA 2G0BA 4R7MA 4KLWA 4OLLA 3I1UA 4CYOA 2EK8A 3FMCA 2FS5A 2CNMA 4KYBA 2BO9A 2IMOA 5DS0A 5KTCA 2RFHA 1Q2DA 2B5GB 1IB1E 4EWTA 5IX3A 2QMLA 4UEFA 2JBJA 2Z10A 3FJUA 1R57A 3GB0A 3B3VA 4FD7A 3LODA 8CPAA 1M4LA 2PJ3A 3GY9A 4MFQA 1IOIA 1I12A 3D7DA 2CTCA 5HMNA 2WZNA 4OIWA 3PBBA 3TCVA 4P4JA 5IB0A 4CAFA 2VZYA 2JZFA 1IIDA 1IU8A 2XEGA 3VWDA 1I1DA 1Z4EA 2A4NA 3JVNA 5ISVA 4UIAA 1ELLP 2PRBA 2G9DA 3CXPA 2C27A 4IK2A 3VH9A 5K8OA 4UEZA 4KOYA 2KQVA 4GM5A 2O53A 1CJWA 2V8VA 3DLJA 3MN8A 2HQYA 2VEZA 4UWIA 4Y49C 4YU9A 3EWQA 4J3GA 5LYLA 2JEWA 2JZDA 5J1QA 2Z3OA 1LANA 1AUGA 3KI9A 3PB8X 4CYPA 2YNCC 3KHXA 4PK2A 3E0KA 2IL4A 2PDOA 4BD9A 4EFDA 4UFXA 4MCRA 5LYDA 1SPVA 4AB7A 5LYFA 5JPHA 2G3AA 4KORA 3LMSA 3PBEA 4KOVA 3K9UA 2FAVA 2FG1A 4LQ6A 1KUVA 2EWBA 4P4DA 4MFLA 4A95A 1P4NA 4B10A 3DNSA 4B11A 2JEVA 4P4BA 3WC7A 4ZY1A 2DPSA 1F57A 4DUKA 1LFWA 3RO0A 2L8RA 1Y9KA 2FXFA 1TKJA 1UWYA 2P6GA 4MMOA 4IF5A 5CPAA 3EWRA 1M4GA 4U9ZA 1CM0A 3KGQA 3GKRA 3QB8A 3CZXA 4NEXA 3TT2A 2JDDA 1ZG8A 5CNPA 2Z3LA 3GLJA 2F5IA 3I9SA 5F48A 3DR8A 3TX8A 3ISXA 4HNXB 1TY8A 4GVWA 5JGFA 4ZY2A 2BEIA 3QNVA 3ZZIA 1IOFA 3FB3A 4UBRA 1TF9A 1Y0RA 1DE4C 2DX6A 1LAMA 4EMEA 2ZEOA 3NH4A 4NGQA 2QYVA 4C7HA 4MJ8A 2ZW5A 3B3SA 2AFXA 5JH9A 3SIJA 2CF4A 5AG5A 5H86A 3W91A 4C2XA 4KUBA 5J8CA 4UFWA 5J8FA 4R6TA 5A27A 1S5KA 2PJCA 3B2YA 1A2ZA 2D4PA 1PYTB 2ZENA 3SIGA 1TXRA 2QECA 3IU2A 2JBKA 3RBUA 3SJGA 5BWAB 1MK4A 2BOAA 2I3CA 4IQYA 3RAMA 3SIHA 1GYTA 2J8MA 2PJ2A 3GPGA 2Z0ZA 4L89A 3GIUA 5AGEA 3FECA 2REEA 4X5KA 3PB4X 4P44A 2B3VA 3SHPA 4JGKA 2AFWA 2GU2A 4U9YA 1LRZA 2Q4YA 3D2PA 5AG4A 2CNTA 1Z8XA 3N7ZA 1B6BA 5D29A 3D7HA 4NGSA 3TFYA 1Y7EA 3B35A 2W2GA 4M6IA 5G20A 5DWNA 3PFOA 3H4QA 2P0WA 2OOTA 3BI0A 1WWZA 2PJ8A 1X10A 2WYRA 2OH1A 3HLPA 3K9TA 4UCNA 5HVFA 3TC8A 1J4JA 3EJFA 2PQ8A 4C7IA 1UFHA 3FNCA 3IFEA 3IWWA 4UEEA 4H2KA 3TOAA 4AVBA 4NGRA 4LQGA 2Q7BA 4F9UA 2PRQA 2KCWA 2PJ1A 1QQ9A 2YGWA 2ACFA 5HXDA 4B5OA 4F6AA 3DSBA 1ZLIA 4YRHA 3GPOA 5JM6A 1PUAA 3JRUA 4ZX8A 1XFOA 1XF8A 2PJBA 2RB7A 2V77A 2Z3KA 2CXAA 3K2KA 4NJQA 4OKOA 4PXBA 1Z9UA 5CB5A 2B5GA 4OC0A 3KR5A 1DTDA 4RI1A 4HKFA 1QSNA 2C1CA 4CRYB 2EEEA 4BINA 3D7FA 4CAVA 3PB7X 1S7NA 4KVOE 2NYQA 2C6GA 4MHZA 1QSTA 4MCPA 1YR0A 2BFRA 1YVKA 4U5YA 5HIHA 1YMEA 4KVXA 4UA3A 5K8PA 4K0CA 3VARA 3R9GA 2LGRA 4A38A 1FY7A 1AMPA 4ZY0A 3JUWA 5CB3A 1OZPA 1B87A 2PR1A 3W6XA 1QSMA 4CS0B 2PJ9A 1NSLA 3T8WA 1CPSA 1JWQA 1NE9A 4OMEA 2RNKA 4UCMA 1XJOA 3KL9A 2XEJA 1VHEA 2YNDA 2PIYA 3MGDA 3NE8A 3BJ8A 2Q44A 2VI7A 4JD6A 4TWEA 5AG6A 4GXHA 1QMUA 2GREA 3IC1A 2F7VA 2V8GA 3V7ZA 2ZEEA 2J9AA 3PRTA 3KQZA 1KWMA 2HV2A 2CTBA 3D2MA 4KOWA 1HEEA 4MI4A 4P45A 5FSXA 4PXCA 4DNCA 2Q4VA 4FAIA 5KTDA 1BPMA 3GPQA 3SIIA 3A9LA 4M6GA 1Q7LA 3VATA 4MCSA 3QAYA 3EXNA 1IYKA 4P4FA 1WK4A 2BCOA 2WPWA 4A39A 5HVGA 2HC9A 2VQYA 4FD4A 4R87A 1HDUA 2VBQA 3IJ3A 1ARMA 1U6MA 3R9FA 2BL1A 3H8FA 2HUZA 4MHNA 2AFSA 2ZEPA 1ZR5A 2Q43A 5LRGA 4CAXA 4CGNA 3SI0A 3RNZA 3BI1A 2PJAA 3B8GA 3ISZA 4FUUA 4KUAA 3FEDA 2B4DB 4AG9A 5CBMA 3TE4A 2I00A 1YLEA 3C26A 4OC4A 2IQ6A 4QBJA 3QAHA 2ZW4A 4ABLA 3CPAA 5E3BA 1CP7A 1TKHA 2DF5A 1LOKA 4K3NA 2POKA 3N5FA 3NE7A 4ZGYB 3IIBA 2F8HA 3I3GA 2AFZA 4AVAA 1YW6A 1BLLE 2ABZA 4XPDC 2FIAA 4LX9A 4OP4A 4AG7A 3PEIA 1YLOA 1M4DA 4BMHA 2ZEDA 2D4OA 1EE3P 2PJ7A 3D67A 1MJBA 2VRIA 1Y7RA 2ATRA 4A37A 2O28A 3S9LA 2EBJA 3WC5A 1M1DA 2CIJA 2K5TA 2PJ5A 2B3UA 2JZEA 3W6SA 3L2NA 1YSJA 4J4ZA 3T9YA 3V2BA 4C68A 4A32A 4KLVA 2OZUA 4NFRA 1VKCA 3B3TA 4R8FA 4MFPA 4YWYA 1YGHA 2G3TA 2O4HA 3EC4A 4NGPA 4P10A 4XNHB 4MFZA 2Q04A 5AILA 5H84A 1TKFA 2ZPAA 1XRYA 1YX0A 2R8VA 3TOBA 3FEEA 4X8IA 3CXQA 3F8KA 2QJ8A 4O23A 5IB9A 2R1IA 4MFJA 4MFKA 1AYEA 2HB6A 3IWGA 1NJRA 4MHYA 1P0HA 3KQXA 3PP9A 2GLJA 3R9EA 1Z8LA 4R3KA 5ELYA 4YFJA 4JLLA 3GUXA 4KVME 4J5QA 2OZHA 4F0XA 1VHSA 3CXSA 1L0CA 2PJ0A 4Q36A 3WR7A 1PCAA 4ONWA 4H6UA 4RN7A 5CMSA 4JZ0A 3SJFA 4AVCA 4JXRA 2PCUA 6CPAA 5I4MA 1Z8TA 2V8HA 3CPXA 1ELMP 4CPAA 2OU2A 4TNUA 4ZYQA 3NH5A 3PB6X 1PU9A 2EVNA 4ZI6A 5EMIA 4I49A 1NMTA 1YREA 4RS2A 3LWUA 2YNEA 4OC2A 4H89A 4B14A 4A31A 4XPLA 2EO8A 1KZFA 2REFA 4MXUA 2PR8A 3ETIA 5JQ4A 4D86A 2FSRA 3S6HA 3H8EA 3PZJA 1XMBA 4CYQA 4QUSA 3BLNA 4OC5A 3F5BA 1M44A 5G1ZA 2P6EA 3EWOA 2BUEA 3D7GA 3DDDA 4FWUA 4MRIA 4W9YA 3S6FA 4JJXA 4KOSA 4IHMA 3RYOA 4CRZB 2PE3A 4EVYA 1OBRA 3IEHA 2Q0YA 1ZO0A 1BAVA 1ON0A 1XOVA 1RO5A 2PVVA 3SXNA 3VWEA 3GYAA 4P4EA 2PSWA 3D8PA 3FRMA 5EBVA 4MCQA 5F46A 3KKWA 3WABA 4F8ZA 3RZAA 4OC3A 2AFCA 4E8OA 2ANPA 2WUUA 1QSOA 3GQEA 4GUAA 1XBUA 3BJ7A 2XEIA 3OWCA 4JLYA 3S9MA 2ODFA 4UMLA 2Z3MA 3EJGA 2VZZA 5I0CA 2EUIA 1N71A 2RC4A 3WC6A 4PSWA 4JXQA 4R3LA 4UIBA 4M6HA 3S6GA 3Q6ZA 3JTKA 1XMTA 3EKEA 2B4DA 2FVGA 2PIZA 5GCNA 1TIQA 2AE6A 5K8NA 2IJZA 2I79A 1VGYA 4KS9A 5THWA 4NF1A 1GHEA 1KUYA 2VXKA 5HVHA 3KR4A 1S60A 1Z4RA 2VL1A 1ZR3A 2FIWA 3BHXA 1BO4A 3LD2A 4OAEA 4Q7AA 1BPNA 4QVTA 4Y49B 3R96A 1XEBA 4CGMA 5IV0A 5LRJA 2H5MA 3LACA 4A30A 2ZEHA 4TU0A 3TO9A 1IYLA 2R7HA 2ZOFA 4UCPA 2ZEGA 4F0YA 1NSAA 2XEFA 4GS4A 1JQGA 2JLMA 4P4IA 2ZW7A 2Y0MA 2ZELA 3JZTA 4FBEA 2PVWA 3FYNA 1S7KA 2Z11A 2AFUA 3PB9X 4WWVA 1TF8A 1YK3A 5FVJA 3ZJ0A 3SJXA 5HH1A 1BOBA 2X47A 4CGLA 4PSXA 2WCTA 1IICA 4YGOA 3FF3A 3SI2A 2WPXA 2Z3PA 2QIRA 4KZTA 4Z65A 4CGOA 4II9A 4R9MA 2ARHA 4NCZA 4ETJA 4NGMA 5G22A 3S9NA 3B3WA 4XNHC 2Z3NA 2ZW6A 4G1PA 4KOXA 2ZXVA 1S7FA 5F47A 4B5PA 1H8LA 4E0AA 2X7BA 3B3CA 3EY5A 4H6ZA 3D3SA 4J5SA 2YNCA 1IGBA 3TTHA 3VFQA 3FXTA 4IUSA 4NGNA 4F9VA 5D8NA 1VIXA 1Z5RA 2QVPA 3UY5A 1FNOA 2PJ6A 4UWJA 2JDCA 1LCPA 4JWPA 1YQEA 1ZG7A 3D68A 4R57A 2AJ6A 1LAPA 3BXMA 1RXTA 3G8WA 4DYOA 5DWMA 2ZEMA 4MY3A 4CAEA 3FH4A 4KSAA 4ESSA 4FD6A 4HNYB 3R95A 4JVVA 4KSIA 2GFQA 3P2FA 4MHPA 4XPKA 3MRUA 3Q71A 1VHOA 3KHZA 2FT0A 2NMTA 4NJRA 4B5PB 4CGPA 4J5RA 3H5ZA 2GE3A 1S3ZA 4KSFA 2BSWA 5HOLA 2BFQA 2B4BA 2GLFA 1CPXA 4MHDA 3F0AA 5DUSA 1FT7A 4NGTA 5F09A 3WT4A 2ZEFA 2DXQA 5FSZA 1Z2LA 4B13A 3SI1A 2DPTA 4HNWB 3EW5A 4X2TA 1ZG9A 4Q38A 4M3SA 4C2ZA 1HJZA 3FBUA 1M4IA 4GVVA 5F49A 1QSRA 4NXYA 5EC4A 4NSQA 4ORFA 2XD7A 7CPAA 3V45A 3DR6A 4ETKA 1S7LA 4C2YA 3KASA 1F2PA 5K8MA 3TO7A 1Z8WA 1CX8A 3NH8A 3FIXA 4M85A 4JCAA 4XPDB 3T90A 4UFVA 2OR4A 4A2ZA 1CBXA 1V0CA 1Q2YA 1CP6A 1MJ9A 3FVLA 1YVOA 3PGPA 3NFZA 5FSUA 3PFEA 1R43A 3G3SA 5AG7A 2PJ4A 4ONUA 3V8IA 1IY7A 1Y0YA 4ZX9A 3CDXA 2C6PA 2P6FA 2Q4ZA 3IO1A 4PQAA 4PXEA 4UF4A 4X3RA 4DJLA 1Y9WA 3IIFA 2FE7A 2GANA 3DGVA 1X12A 4PV6A 4BBHA 4CAWA 4K30A 5FSYA 4KOTA 2Q51A 1K4JA 2ZOGA 3D4UA 3IGRA 4IAVA 2J8RA 2B58A 2CY2A 2EK9A 1YD9A 1KUXA 3D66A 3SXOA 3H8GA 1TXZA 4QB9A 2WSAA 3S6KA 5A28A 3IU1A 4B6ZA 4A33A 4WJBA 1ZLHA 4OC1A 3R1KA 1ARLA 4PPZA 2FCKA 2Q7SA 4AXVA 5C88A 4B12A 1RTQA 2OZGA 2AFOA 3NA6A 1XE4A 1Q2CA 3EFAA 3B7IA 1HDQA 4KOUA 4ZBGA 3EO4A 4MY0A 3CT9A 2FL4A 2OB0A 1VHUA 3IIDA 1YW4A 4P6YA 5FSVA 3SJEA 1F2OA 4QC6A 4HPSA 2R98A 5C82A 4R76A 5LYIA
chains in the Genus database with same CATH topology
5LRKA 4RUHA 3EWPA 1R3NA 4PXDA 3FX6A 2AFMA 2V8DA 4JYWA 3GQOA 3KZWA 2DEAA 3V38A 4A94A 4OIDA 2NSMA 4ABKA 1CG2A 3HUVA 2FXKA 2C6CA 4R7MA 3I1UA 2EK8A 3FMCA 2IMOA 4KYBA 2BO9A 5DS0A 2RFHA 4EWTA 4UEFA 2JBJA 3FJUA 3GB0A 3B3VA 8CPAA 1M4LA 2PJ3A 3D7DA 2CTCA 2WZNA 4OIWA 3PBBA 4P4JA 2XEGA 4UIAA 1ELLP 2G9DA 4IK2A 3VH9A 5K8OA 4UEZA 4GM5A 2O53A 2V8VA 3DLJA 3MN8A 4YU9A 3EWQA 5LYLA 2JEWA 5J1QA 1LANA 3PB8X 3KI9A 5K8MA 4EFDA 3KHXA 4BD9A 5LYFA 4MCRA 5LYDA 1SPVA 3LMSA 3PBEA 2FAVA 2FG1A 2EWBA 4P4DA 4P4BA 3WC7A 4ZY1A 1F57A 4DUKA 1LFWA 2L8RA 4MMOA 1TKJA 1UWYA 5CPAA 3EWRA 3KGQA 1ZG8A 3GLJA 3TX8A 3ISXA 1TY8A 4GVWA 5JGFA 4ZY2A 3QNVA 1TF9A 1Y0RA 1DE4C 2DX6A 1LAMA 4EMEA 2ZEOA 3NH4A 4NGQA 2QYVA 3B3SA 2AFXA 5JH9A 3SIJA 2CF4A 4R6TA 2PJCA 3B2YA 2ZENA 1PYTB 3RBUA 3SIGA 1TXRA 3SJGA 2JBKA 2BOAA 2I3CA 4IQYA 3RAMA 3SIHA 1GYTA 2PJ2A 3GPGA 3FECA 3PB4X 4P44A 4JGKA 2AFWA 2GU2A 5D29A 3D7HA 4NGSA 1Y7EA 3B35A 3PFOA 2OOTA 3BI0A 2PJ8A 2WYRA 3HLPA 5HVFA 3TC8A 3K9TA 3EJFA 3IFEA 4UEEA 3IWWA 4H2KA 4NGRA 4LQGA 4F9UA 2PRQA 2PJ1A 1QQ9A 2ACFA 5HXDA 1ZLIA 3GPOA 5JM6A 1XFOA 3JRUA 4ZX8A 2PJBA 3K2KA 4NJQA 2RB7A 2V77A 4OKOA 4PXBA 5CB5A 4OC0A 3KR5A 1DTDA 2C1CA 2EEEA 3D7FA 3PB7X 2NYQA 2C6GA 4MHZA 4MCPA 2BFRA 5HIHA 1YMEA 5K8PA 4K0CA 3VARA 2LGRA 4A38A 1AMPA 4ZY0A 5CB3A 2PJ9A 3T8WA 1CPSA 4OMEA 1XJOA 3KL9A 2XEJA 1VHEA 2PIYA 4TWEA 1QMUA 2GREA 3IC1A 2F7VA 2V8GA 3V7ZA 2ZEEA 2J9AA 3PRTA 3KQZA 1KWMA 2CTBA 4P45A 4FAIA 1HEEA 4PXCA 5FSXA 1BPMA 3GPQA 3SIIA 1Q7LA 3VATA 4MCSA 4P4FA 2BCOA 4A39A 5HVGA 2HC9A 1HDUA 3IJ3A 1ARMA 3H8FA 4MHNA 2AFSA 2ZEPA 1ZR5A 2Q43A 5LRGA 3SI0A 3BI1A 2PJAA 3ISZA 4FUUA 3FEDA 5CBMA 4OC4A 2IQ6A 4ABLA 3CPAA 5E3BA 1CP7A 1TKHA 3N5FA 1LOKA 4K3NA 2POKA 3IIBA 2F8HA 2AFZA 1YW6A 1BLLE 2ABZA 3PEIA 1YLOA 2ZEDA 2PJ7A 1EE3P 3D67A 2VRIA 4A37A 3S9LA 3WC5A 2CIJA 2PJ5A 3L2NA 1YSJA 4J4ZA 3V2BA 4NFRA 4R8FA 3B3TA 4YWYA 2O4HA 4NGPA 4P10A 5AILA 1TKFA 1XRYA 3FEEA 4X8IA 2QJ8A 4O23A 5IB9A 1AYEA 2HB6A 1NJRA 4MHYA 3KQXA 2GLJA 1Z8LA 5ELYA 4JLLA 3GUXA 4J5QA 2PJ0A 1PCAA 4ONWA 5CMSA 4JZ0A 3SJFA 5I4MA 2PCUA 6CPAA 2V8HA 3CPXA 1ELMP 4CPAA 4TNUA 4ZYQA 3NH5A 3PB6X 4ZI6A 3LWUA 4OC2A 4MXUA 3ETIA 4D86A 3H8EA 1XMBA 4OC5A 3EWOA 3D7GA 4FWUA 4MRIA 4W9YA 4IHMA 2PE3A 1OBRA 3IEHA 1BAVA 2PVVA 4P4EA 4MCQA 3WABA 4F8ZA 3RZAA 4OC3A 2AFCA 2ANPA 3GQEA 4GUAA 1XBUA 2XEIA 3S9MA 4UMLA 3EJGA 3WC6A 4UIBA 3Q6ZA 3EKEA 2FVGA 2PIZA 5K8NA 2IJZA 1VGYA 5THWA 5HVHA 3KR4A 2VL1A 1ZR3A 4DJLA 3BHXA 4Q7AA 1BPNA 5LRJA 2ZEHA 4TU0A 2ZOFA 2ZEGA 1NSAA 2XEFA 1JQGA 4P4IA 4FBEA 2ZELA 3JZTA 2PVWA 2AFUA 3PB9X 4WWVA 1TF8A 3SJXA 2X47A 3FF3A 3SI2A 4Z65A 4ETJA 4NGMA 3S9NA 3B3WA 4G1PA 1H8LA 3B3CA 4J5SA 1IGBA 3VFQA 4NGNA 4F9VA 5D8NA 1VIXA 1Z5RA 2QVPA 1FNOA 2PJ6A 1LCPA 3D68A 1ZG7A 1LAPA 3BXMA 4DYOA 2ZEMA 3FH4A 4ESSA 4JVVA 4KSIA 4MHPA 3MRUA 3Q71A 1VHOA 3KHZA 4NJRA 4J5RA 5HOLA 2BFQA 2GLFA 1CPXA 5DUSA 1FT7A 4NGTA 5F09A 3WT4A 2ZEFA 5FSZA 1Z2LA 3SI1A 3EW5A 4X2TA 1ZG9A 1HJZA 4GVVA 7CPAA 2XD7A 3V45A 4ETKA 3KASA 1F2PA 1CX8A 3NH8A 4JCAA 2OR4A 1CBXA 3FVLA 1CP6A 3NFZA 5FSUA 3PFEA 1R43A 2PJ4A 3CDXA 1IY7A 1Y0YA 4ZX9A 2C6PA 2Q4ZA 4PQAA 3IO1A 4PXEA 4UF4A 4X3RA 3IIFA 3DGVA 5FSYA 2Q51A 2ZOGA 3D4UA 4IAVA 2EK9A 1YD9A 3D66A 3H8GA 1TXZA 4B6ZA 4WJBA 1ZLHA 4OC1A 4AXVA 1ARLA 4PPZA 1RTQA 2AFOA 3NA6A 3B7IA 1HDQA 4P6YA 3CT9A 3SJEA 1VHUA 3IIDA 1YW4A 5FSVA 1F2OA 4OP4A 4R76A 5LYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LRK A;  4RUH A;  3EWP A;  1R3N A;  4PXD A;  3FX6 A;  2AFM A;  2V8D A;  4JYW A;  3GQO A;  3KZW A;  2DEA A;  3V38 A;  4A94 A;  4OID A;  2NSM A;  4ABK A;  1CG2 A;  3HUV A;  2FXK A;  2C6C A;  4R7M A;  3I1U A;  2EK8 A;  3FMC A;  2IMO A;  4KYB A;  2BO9 A;  5DS0 A;  2RFH A;  4EWT A;  4UEF A;  2JBJ A;  3FJU A;  3GB0 A;  3B3V A;  8CPA A;  1M4L A;  2PJ3 A;  3D7D A;  2CTC A;  2WZN A;  4OIW A;  3PBB A;  4P4J A;  2XEG A;  4UIA A;  1ELL P;  2G9D A;  4IK2 A;  3VH9 A;  5K8O A;  4UEZ A;  4GM5 A;  2O53 A;  2V8V A;  3DLJ A;  3MN8 A;  4YU9 A;  3EWQ A;  5LYL A;  2JEW A;  5J1Q A;  1LAN A;  3PB8 X;  3KI9 A;  5K8M A;  4EFD A;  3KHX A;  4BD9 A;  5LYF A;  4MCR A;  5LYD A;  1SPV A;  3LMS A;  3PBE A;  2FAV A;  2FG1 A;  2EWB A;  4P4D A;  4P4B A;  3WC7 A;  4ZY1 A;  1F57 A;  4DUK A;  1LFW A;  2L8R A;  4MMO A;  1TKJ A;  1UWY A;  5CPA A;  3EWR A;  3KGQ A;  1ZG8 A;  3GLJ A;  3TX8 A;  3ISX A;  1TY8 A;  4GVW A;  5JGF A;  4ZY2 A;  3QNV A;  1TF9 A;  1Y0R A;  1DE4 C;  2DX6 A;  1LAM A;  4EME A;  2ZEO A;  3NH4 A;  4NGQ A;  2QYV A;  3B3S A;  2AFX A;  5JH9 A;  3SIJ A;  2CF4 A;  4R6T A;  2PJC A;  3B2Y A;  2ZEN A;  1PYT B;  3RBU A;  3SIG A;  1TXR A;  3SJG A;  2JBK A;  2BOA A;  2I3C A;  4IQY A;  3RAM A;  3SIH A;  1GYT A;  2PJ2 A;  3GPG A;  3FEC A;  3PB4 X;  4P44 A;  4JGK A;  2AFW A;  2GU2 A;  5D29 A;  3D7H A;  4NGS A;  1Y7E A;  3B35 A;  3PFO A;  2OOT A;  3BI0 A;  2PJ8 A;  2WYR A;  3HLP A;  5HVF A;  3TC8 A;  3K9T A;  3EJF A;  3IFE A;  4UEE A;  3IWW A;  4H2K A;  4NGR A;  4LQG A;  4F9U A;  2PRQ A;  2PJ1 A;  1QQ9 A;  2ACF A;  5HXD A;  1ZLI A;  3GPO A;  5JM6 A;  1XFO A;  3JRU A;  4ZX8 A;  2PJB A;  3K2K A;  4NJQ A;  2RB7 A;  2V77 A;  4OKO A;  4PXB A;  5CB5 A;  4OC0 A;  3KR5 A;  1DTD A;  2C1C A;  2EEE A;  3D7F A;  3PB7 X;  2NYQ A;  2C6G A;  4MHZ A;  4MCP A;  2BFR A;  5HIH A;  1YME A;  5K8P A;  4K0C A;  3VAR A;  2LGR A;  4A38 A;  1AMP A;  4ZY0 A;  5CB3 A;  2PJ9 A;  3T8W A;  1CPS A;  4OME A;  1XJO A;  3KL9 A;  2XEJ A;  1VHE A;  2PIY A;  4TWE A;  1QMU A;  2GRE A;  3IC1 A;  2F7V A;  2V8G A;  3V7Z A;  2ZEE A;  2J9A A;  3PRT A;  3KQZ A;  1KWM A;  2CTB A;  4P45 A;  4FAI A;  1HEE A;  4PXC A;  5FSX A;  1BPM A;  3GPQ A;  3SII A;  1Q7L A;  3VAT A;  4MCS A;  4P4F A;  2BCO A;  4A39 A;  5HVG A;  2HC9 A;  1HDU A;  3IJ3 A;  1ARM A;  3H8F A;  4MHN A;  2AFS A;  2ZEP A;  1ZR5 A;  2Q43 A;  5LRG A;  3SI0 A;  3BI1 A;  2PJA A;  3ISZ A;  4FUU A;  3FED A;  5CBM A;  4OC4 A;  2IQ6 A;  4ABL A;  3CPA A;  5E3B A;  1CP7 A;  1TKH A;  3N5F A;  1LOK A;  4K3N A;  2POK A;  3IIB A;  2F8H A;  2AFZ A;  1YW6 A;  1BLL E;  2ABZ A;  3PEI A;  1YLO A;  2ZED A;  2PJ7 A;  1EE3 P;  3D67 A;  2VRI A;  4A37 A;  3S9L A;  3WC5 A;  2CIJ A;  2PJ5 A;  3L2N A;  1YSJ A;  4J4Z A;  3V2B A;  4NFR A;  4R8F A;  3B3T A;  4YWY A;  2O4H A;  4NGP A;  4P10 A;  5AIL A;  1TKF A;  1XRY A;  3FEE A;  4X8I A;  2QJ8 A;  4O23 A;  5IB9 A;  1AYE A;  2HB6 A;  1NJR A;  4MHY A;  3KQX A;  2GLJ A;  1Z8L A;  5ELY A;  4JLL A;  3GUX A;  4J5Q A;  2PJ0 A;  1PCA A;  4ONW A;  5CMS A;  4JZ0 A;  3SJF A;  5I4M A;  2PCU A;  6CPA A;  2V8H A;  3CPX A;  1ELM P;  4CPA A;  4TNU A;  4ZYQ A;  3NH5 A;  3PB6 X;  4ZI6 A;  3LWU A;  4OC2 A;  4MXU A;  3ETI A;  4D86 A;  3H8E A;  1XMB A;  4OC5 A;  3EWO A;  3D7G A;  4FWU A;  4MRI A;  4W9Y A;  4IHM A;  2PE3 A;  1OBR A;  3IEH A;  1BAV A;  2PVV A;  4P4E A;  4MCQ A;  3WAB A;  4F8Z A;  3RZA A;  4OC3 A;  2AFC A;  2ANP A;  3GQE A;  4GUA A;  1XBU A;  2XEI A;  3S9M A;  4UML A;  3EJG A;  3WC6 A;  4UIB A;  3Q6Z A;  3EKE A;  2FVG A;  2PIZ A;  5K8N A;  2IJZ A;  1VGY A;  5THW A;  5HVH A;  3KR4 A;  2VL1 A;  1ZR3 A;  4DJL A;  3BHX A;  4Q7A A;  1BPN A;  5LRJ A;  2ZEH A;  4TU0 A;  2ZOF A;  2ZEG A;  1NSA A;  2XEF A;  1JQG A;  4P4I A;  4FBE A;  2ZEL A;  3JZT A;  2PVW A;  2AFU A;  3PB9 X;  4WWV A;  1TF8 A;  3SJX A;  2X47 A;  3FF3 A;  3SI2 A;  4Z65 A;  4ETJ A;  4NGM A;  3S9N A;  3B3W A;  4G1P A;  1H8L A;  3B3C A;  4J5S A;  1IGB A;  3VFQ A;  4NGN A;  4F9V A;  5D8N A;  1VIX A;  1Z5R A;  2QVP A;  1FNO A;  2PJ6 A;  1LCP A;  3D68 A;  1ZG7 A;  1LAP A;  3BXM A;  4DYO A;  2ZEM A;  3FH4 A;  4ESS A;  4JVV A;  4KSI A;  4MHP A;  3MRU A;  3Q71 A;  1VHO A;  3KHZ A;  4NJR A;  4J5R A;  5HOL A;  2BFQ A;  2GLF A;  1CPX A;  5DUS A;  1FT7 A;  4NGT A;  5F09 A;  3WT4 A;  2ZEF A;  5FSZ A;  1Z2L A;  3SI1 A;  3EW5 A;  4X2T A;  1ZG9 A;  1HJZ A;  4GVV A;  7CPA A;  2XD7 A;  3V45 A;  4ETK A;  3KAS A;  1F2P A;  1CX8 A;  3NH8 A;  4JCA A;  2OR4 A;  1CBX A;  3FVL A;  1CP6 A;  3NFZ A;  5FSU A;  3PFE A;  1R43 A;  2PJ4 A;  3CDX A;  1IY7 A;  1Y0Y A;  4ZX9 A;  2C6P A;  2Q4Z A;  4PQA A;  3IO1 A;  4PXE A;  4UF4 A;  4X3R A;  3IIF A;  3DGV A;  5FSY A;  2Q51 A;  2ZOG A;  3D4U A;  4IAV A;  2EK9 A;  1YD9 A;  3D66 A;  3H8G A;  1TXZ A;  4B6Z A;  4WJB A;  1ZLH A;  4OC1 A;  4AXV A;  1ARL A;  4PPZ A;  1RTQ A;  2AFO A;  3NA6 A;  3B7I A;  1HDQ A;  4P6Y A;  3CT9 A;  3SJE A;  1VHU A;  3IID A;  1YW4 A;  5FSV A;  1F2O A;  4OP4 A;  4R76 A;  5LYI A; 
#chains in the Genus database with same CATH topology
 3TO6 A;  2GIV A;  2CNS A;  5LRK A;  4RUH A;  4PK3 A;  2PC1 A;  5G21 A;  3EWP A;  3P2H A;  4CYN A;  1XIX A;  1R3N A;  4PXD A;  3FX6 A;  4E2A A;  1MJA A;  2AFM A;  2V8D A;  4FD5 A;  4JYW A;  3GQO A;  1I21 A;  1SQH A;  5KTA A;  3IWE A;  3KZW A;  2DEA A;  3V38 A;  2J8N A;  4LUA A;  4OID A;  4A94 A;  5E96 A;  2NSM A;  4MBU A;  4ABK A;  1CG2 A;  3HUV A;  2FXK A;  2C6C A;  4L8A A;  4OAD A;  2G0B A;  4R7M A;  4KLW A;  4OLL A;  3I1U A;  4CYO A;  2EK8 A;  3FMC A;  2FS5 A;  2CNM A;  4KYB A;  2BO9 A;  2IMO A;  5DS0 A;  5KTC A;  2RFH A;  1Q2D A;  2B5G B;  1IB1 E;  4EWT A;  5IX3 A;  2QML A;  4UEF A;  2JBJ A;  2Z10 A;  3FJU A;  1R57 A;  3GB0 A;  3B3V A;  4FD7 A;  3LOD A;  8CPA A;  1M4L A;  2PJ3 A;  3GY9 A;  4MFQ A;  1IOI A;  1I12 A;  3D7D A;  2CTC A;  5HMN A;  2WZN A;  4OIW A;  3PBB A;  3TCV A;  4P4J A;  5IB0 A;  4CAF A;  2VZY A;  2JZF A;  1IID A;  1IU8 A;  2XEG A;  3VWD A;  1I1D A;  1Z4E A;  2A4N A;  3JVN A;  5ISV A;  4UIA A;  1ELL P;  2PRB A;  2G9D A;  3CXP A;  2C27 A;  4IK2 A;  3VH9 A;  5K8O A;  4UEZ A;  4KOY A;  2KQV A;  4GM5 A;  2O53 A;  1CJW A;  2V8V A;  3DLJ A;  3MN8 A;  2HQY A;  2VEZ A;  4UWI A;  4Y49 C;  4YU9 A;  3EWQ A;  4J3G A;  5LYL A;  2JEW A;  2JZD A;  5J1Q A;  2Z3O A;  1LAN A;  1AUG A;  3KI9 A;  3PB8 X;  4CYP A;  2YNC C;  3KHX A;  4PK2 A;  3E0K A;  2IL4 A;  2PDO A;  4BD9 A;  4EFD A;  4UFX A;  4MCR A;  5LYD A;  1SPV A;  4AB7 A;  5LYF A;  5JPH A;  2G3A A;  4KOR A;  3LMS A;  3PBE A;  4KOV A;  3K9U A;  2FAV A;  2FG1 A;  4LQ6 A;  1KUV A;  2EWB A;  4P4D A;  4MFL A;  4A95 A;  1P4N A;  4B10 A;  3DNS A;  4B11 A;  2JEV A;  4P4B A;  3WC7 A;  4ZY1 A;  2DPS A;  1F57 A;  4DUK A;  1LFW A;  3RO0 A;  2L8R A;  1Y9K A;  2FXF A;  1TKJ A;  1UWY A;  2P6G A;  4MMO A;  4IF5 A;  5CPA A;  3EWR A;  1M4G A;  4U9Z A;  1CM0 A;  3KGQ A;  3GKR A;  3QB8 A;  3CZX A;  4NEX A;  3TT2 A;  2JDD A;  1ZG8 A;  5CNP A;  2Z3L A;  3GLJ A;  2F5I A;  3I9S A;  5F48 A;  3DR8 A;  3TX8 A;  3ISX A;  4HNX B;  1TY8 A;  4GVW A;  5JGF A;  4ZY2 A;  2BEI A;  3QNV A;  3ZZI A;  1IOF A;  3FB3 A;  4UBR A;  1TF9 A;  1Y0R A;  1DE4 C;  2DX6 A;  1LAM A;  4EME A;  2ZEO A;  3NH4 A;  4NGQ A;  2QYV A;  4C7H A;  4MJ8 A;  2ZW5 A;  3B3S A;  2AFX A;  5JH9 A;  3SIJ A;  2CF4 A;  5AG5 A;  5H86 A;  3W91 A;  4C2X A;  4KUB A;  5J8C A;  4UFW A;  5J8F A;  4R6T A;  5A27 A;  1S5K A;  2PJC A;  3B2Y A;  1A2Z A;  2D4P A;  1PYT B;  2ZEN A;  3SIG A;  1TXR A;  2QEC A;  3IU2 A;  2JBK A;  3RBU A;  3SJG A;  5BWA B;  1MK4 A;  2BOA A;  2I3C A;  4IQY A;  3RAM A;  3SIH A;  1GYT A;  2J8M A;  2PJ2 A;  3GPG A;  2Z0Z A;  4L89 A;  3GIU A;  5AGE A;  3FEC A;  2REE A;  4X5K A;  3PB4 X;  4P44 A;  2B3V A;  3SHP A;  4JGK A;  2AFW A;  2GU2 A;  4U9Y A;  1LRZ A;  2Q4Y A;  3D2P A;  5AG4 A;  2CNT A;  1Z8X A;  3N7Z A;  1B6B A;  5D29 A;  3D7H A;  4NGS A;  3TFY A;  1Y7E A;  3B35 A;  2W2G A;  4M6I A;  5G20 A;  5DWN A;  3PFO A;  3H4Q A;  2P0W A;  2OOT A;  3BI0 A;  1WWZ A;  2PJ8 A;  1X10 A;  2WYR A;  2OH1 A;  3HLP A;  3K9T A;  4UCN A;  5HVF A;  3TC8 A;  1J4J A;  3EJF A;  2PQ8 A;  4C7I A;  1UFH A;  3FNC A;  3IFE A;  3IWW A;  4UEE A;  4H2K A;  3TOA A;  4AVB A;  4NGR A;  4LQG A;  2Q7B A;  4F9U A;  2PRQ A;  2KCW A;  2PJ1 A;  1QQ9 A;  2YGW A;  2ACF A;  5HXD A;  4B5O A;  4F6A A;  3DSB A;  1ZLI A;  4YRH A;  3GPO A;  5JM6 A;  1PUA A;  3JRU A;  4ZX8 A;  1XFO A;  1XF8 A;  2PJB A;  2RB7 A;  2V77 A;  2Z3K A;  2CXA A;  3K2K A;  4NJQ A;  4OKO A;  4PXB A;  1Z9U A;  5CB5 A;  2B5G A;  4OC0 A;  3KR5 A;  1DTD A;  4RI1 A;  4HKF A;  1QSN A;  2C1C A;  4CRY B;  2EEE A;  4BIN A;  3D7F A;  4CAV A;  3PB7 X;  1S7N A;  4KVO E;  2NYQ A;  2C6G A;  4MHZ A;  1QST A;  4MCP A;  1YR0 A;  2BFR A;  1YVK A;  4U5Y A;  5HIH A;  1YME A;  4KVX A;  4UA3 A;  5K8P A;  4K0C A;  3VAR A;  3R9G A;  2LGR A;  4A38 A;  1FY7 A;  1AMP A;  4ZY0 A;  3JUW A;  5CB3 A;  1OZP A;  1B87 A;  2PR1 A;  3W6X A;  1QSM A;  4CS0 B;  2PJ9 A;  1NSL A;  3T8W A;  1CPS A;  1JWQ A;  1NE9 A;  4OME A;  2RNK A;  4UCM A;  1XJO A;  3KL9 A;  2XEJ A;  1VHE A;  2YND A;  2PIY A;  3MGD A;  3NE8 A;  3BJ8 A;  2Q44 A;  2VI7 A;  4JD6 A;  4TWE A;  5AG6 A;  4GXH A;  1QMU A;  2GRE A;  3IC1 A;  2F7V A;  2V8G A;  3V7Z A;  2ZEE A;  2J9A A;  3PRT A;  3KQZ A;  1KWM A;  2HV2 A;  2CTB A;  3D2M A;  4KOW A;  1HEE A;  4MI4 A;  4P45 A;  5FSX A;  4PXC A;  4DNC A;  2Q4V A;  4FAI A;  5KTD A;  1BPM A;  3GPQ A;  3SII A;  3A9L A;  4M6G A;  1Q7L A;  3VAT A;  4MCS A;  3QAY A;  3EXN A;  1IYK A;  4P4F A;  1WK4 A;  2BCO A;  2WPW A;  4A39 A;  5HVG A;  2HC9 A;  2VQY A;  4FD4 A;  4R87 A;  1HDU A;  2VBQ A;  3IJ3 A;  1ARM A;  1U6M A;  3R9F A;  2BL1 A;  3H8F A;  2HUZ A;  4MHN A;  2AFS A;  2ZEP A;  1ZR5 A;  2Q43 A;  5LRG A;  4CAX A;  4CGN A;  3SI0 A;  3RNZ A;  3BI1 A;  2PJA A;  3B8G A;  3ISZ A;  4FUU A;  4KUA A;  3FED A;  2B4D B;  4AG9 A;  5CBM A;  3TE4 A;  2I00 A;  1YLE A;  3C26 A;  4OC4 A;  2IQ6 A;  4QBJ A;  3QAH A;  2ZW4 A;  4ABL A;  3CPA A;  5E3B A;  1CP7 A;  1TKH A;  2DF5 A;  1LOK A;  4K3N A;  2POK A;  3N5F A;  3NE7 A;  4ZGY B;  3IIB A;  2F8H A;  3I3G A;  2AFZ A;  4AVA A;  1YW6 A;  1BLL E;  2ABZ A;  4XPD C;  2FIA A;  4LX9 A;  4OP4 A;  4AG7 A;  3PEI A;  1YLO A;  1M4D A;  4BMH A;  2ZED A;  2D4O A;  1EE3 P;  2PJ7 A;  3D67 A;  1MJB A;  2VRI A;  1Y7R A;  2ATR A;  4A37 A;  2O28 A;  3S9L A;  2EBJ A;  3WC5 A;  1M1D A;  2CIJ A;  2K5T A;  2PJ5 A;  2B3U A;  2JZE A;  3W6S A;  3L2N A;  1YSJ A;  4J4Z A;  3T9Y A;  3V2B A;  4C68 A;  4A32 A;  4KLV A;  2OZU A;  4NFR A;  1VKC A;  3B3T A;  4R8F A;  4MFP A;  4YWY A;  1YGH A;  2G3T A;  2O4H A;  3EC4 A;  4NGP A;  4P10 A;  4XNH B;  4MFZ A;  2Q04 A;  5AIL A;  5H84 A;  1TKF A;  2ZPA A;  1XRY A;  1YX0 A;  2R8V A;  3TOB A;  3FEE A;  4X8I A;  3CXQ A;  3F8K A;  2QJ8 A;  4O23 A;  5IB9 A;  2R1I A;  4MFJ A;  4MFK A;  1AYE A;  2HB6 A;  3IWG A;  1NJR A;  4MHY A;  1P0H A;  3KQX A;  3PP9 A;  2GLJ A;  3R9E A;  1Z8L A;  4R3K A;  5ELY A;  4YFJ A;  4JLL A;  3GUX A;  4KVM E;  4J5Q A;  2OZH A;  4F0X A;  1VHS A;  3CXS A;  1L0C A;  2PJ0 A;  4Q36 A;  3WR7 A;  1PCA A;  4ONW A;  4H6U A;  4RN7 A;  5CMS A;  4JZ0 A;  3SJF A;  4AVC A;  4JXR A;  2PCU A;  6CPA A;  5I4M A;  1Z8T A;  2V8H A;  3CPX A;  1ELM P;  4CPA A;  2OU2 A;  4TNU A;  4ZYQ A;  3NH5 A;  3PB6 X;  1PU9 A;  2EVN A;  4ZI6 A;  5EMI A;  4I49 A;  1NMT A;  1YRE A;  4RS2 A;  3LWU A;  2YNE A;  4OC2 A;  4H89 A;  4B14 A;  4A31 A;  4XPL A;  2EO8 A;  1KZF A;  2REF A;  4MXU A;  2PR8 A;  3ETI A;  5JQ4 A;  4D86 A;  2FSR A;  3S6H A;  3H8E A;  3PZJ A;  1XMB A;  4CYQ A;  4QUS A;  3BLN A;  4OC5 A;  3F5B A;  1M44 A;  5G1Z A;  2P6E A;  3EWO A;  2BUE A;  3D7G A;  3DDD A;  4FWU A;  4MRI A;  4W9Y A;  3S6F A;  4JJX A;  4KOS A;  4IHM A;  3RYO A;  4CRZ B;  2PE3 A;  4EVY A;  1OBR A;  3IEH A;  2Q0Y A;  1ZO0 A;  1BAV A;  1ON0 A;  1XOV A;  1RO5 A;  2PVV A;  3SXN A;  3VWE A;  3GYA A;  4P4E A;  2PSW A;  3D8P A;  3FRM A;  5EBV A;  4MCQ A;  5F46 A;  3KKW A;  3WAB A;  4F8Z A;  3RZA A;  4OC3 A;  2AFC A;  4E8O A;  2ANP A;  2WUU A;  1QSO A;  3GQE A;  4GUA A;  1XBU A;  3BJ7 A;  2XEI A;  3OWC A;  4JLY A;  3S9M A;  2ODF A;  4UML A;  2Z3M A;  3EJG A;  2VZZ A;  5I0C A;  2EUI A;  1N71 A;  2RC4 A;  3WC6 A;  4PSW A;  4JXQ A;  4R3L A;  4UIB A;  4M6H A;  3S6G A;  3Q6Z A;  3JTK A;  1XMT A;  3EKE A;  2B4D A;  2FVG A;  2PIZ A;  5GCN A;  1TIQ A;  2AE6 A;  5K8N A;  2IJZ A;  2I79 A;  1VGY A;  4KS9 A;  5THW A;  4NF1 A;  1GHE A;  1KUY A;  2VXK A;  5HVH A;  3KR4 A;  1S60 A;  1Z4R A;  2VL1 A;  1ZR3 A;  2FIW A;  3BHX A;  1BO4 A;  3LD2 A;  4OAE A;  4Q7A A;  1BPN A;  4QVT A;  4Y49 B;  3R96 A;  1XEB A;  4CGM A;  5IV0 A;  5LRJ A;  2H5M A;  3LAC A;  4A30 A;  2ZEH A;  4TU0 A;  3TO9 A;  1IYL A;  2R7H A;  2ZOF A;  4UCP A;  2ZEG A;  4F0Y A;  1NSA A;  2XEF A;  4GS4 A;  1JQG A;  2JLM A;  4P4I A;  2ZW7 A;  2Y0M A;  2ZEL A;  3JZT A;  4FBE A;  2PVW A;  3FYN A;  1S7K A;  2Z11 A;  2AFU A;  3PB9 X;  4WWV A;  1TF8 A;  1YK3 A;  5FVJ A;  3ZJ0 A;  3SJX A;  5HH1 A;  1BOB A;  2X47 A;  4CGL A;  4PSX A;  2WCT A;  1IIC A;  4YGO A;  3FF3 A;  3SI2 A;  2WPX A;  2Z3P A;  2QIR A;  4KZT A;  4Z65 A;  4CGO A;  4II9 A;  4R9M A;  2ARH A;  4NCZ A;  4ETJ A;  4NGM A;  5G22 A;  3S9N A;  3B3W A;  4XNH C;  2Z3N A;  2ZW6 A;  4G1P A;  4KOX A;  2ZXV A;  1S7F A;  5F47 A;  4B5P A;  1H8L A;  4E0A A;  2X7B A;  3B3C A;  3EY5 A;  4H6Z A;  3D3S A;  4J5S A;  2YNC A;  1IGB A;  3TTH A;  3VFQ A;  3FXT A;  4IUS A;  4NGN A;  4F9V A;  5D8N A;  1VIX A;  1Z5R A;  2QVP A;  3UY5 A;  1FNO A;  2PJ6 A;  4UWJ A;  2JDC A;  1LCP A;  4JWP A;  1YQE A;  1ZG7 A;  3D68 A;  4R57 A;  2AJ6 A;  1LAP A;  3BXM A;  1RXT A;  3G8W A;  4DYO A;  5DWM A;  2ZEM A;  4MY3 A;  4CAE A;  3FH4 A;  4KSA A;  4ESS A;  4FD6 A;  4HNY B;  3R95 A;  4JVV A;  4KSI A;  2GFQ A;  3P2F A;  4MHP A;  4XPK A;  3MRU A;  3Q71 A;  1VHO A;  3KHZ A;  2FT0 A;  2NMT A;  4NJR A;  4B5P B;  4CGP A;  4J5R A;  3H5Z A;  2GE3 A;  1S3Z A;  4KSF A;  2BSW A;  5HOL A;  2BFQ A;  2B4B A;  2GLF A;  1CPX A;  4MHD A;  3F0A A;  5DUS A;  1FT7 A;  4NGT A;  5F09 A;  3WT4 A;  2ZEF A;  2DXQ A;  5FSZ A;  1Z2L A;  4B13 A;  3SI1 A;  2DPT A;  4HNW B;  3EW5 A;  4X2T A;  1ZG9 A;  4Q38 A;  4M3S A;  4C2Z A;  1HJZ A;  3FBU A;  1M4I A;  4GVV A;  5F49 A;  1QSR A;  4NXY A;  5EC4 A;  4NSQ A;  4ORF A;  2XD7 A;  7CPA A;  3V45 A;  3DR6 A;  4ETK A;  1S7L A;  4C2Y A;  3KAS A;  1F2P A;  5K8M A;  3TO7 A;  1Z8W A;  1CX8 A;  3NH8 A;  3FIX A;  4M85 A;  4JCA A;  4XPD B;  3T90 A;  4UFV A;  2OR4 A;  4A2Z A;  1CBX A;  1V0C A;  1Q2Y A;  1CP6 A;  1MJ9 A;  3FVL A;  1YVO A;  3PGP A;  3NFZ A;  5FSU A;  3PFE A;  1R43 A;  3G3S A;  5AG7 A;  2PJ4 A;  4ONU A;  3V8I A;  1IY7 A;  1Y0Y A;  4ZX9 A;  3CDX A;  2C6P A;  2P6F A;  2Q4Z A;  3IO1 A;  4PQA A;  4PXE A;  4UF4 A;  4X3R A;  4DJL A;  1Y9W A;  3IIF A;  2FE7 A;  2GAN A;  3DGV A;  1X12 A;  4PV6 A;  4BBH A;  4CAW A;  4K30 A;  5FSY A;  4KOT A;  2Q51 A;  1K4J A;  2ZOG A;  3D4U A;  3IGR A;  4IAV A;  2J8R A;  2B58 A;  2CY2 A;  2EK9 A;  1YD9 A;  1KUX A;  3D66 A;  3SXO A;  3H8G A;  1TXZ A;  4QB9 A;  2WSA A;  3S6K A;  5A28 A;  3IU1 A;  4B6Z A;  4A33 A;  4WJB A;  1ZLH A;  4OC1 A;  3R1K A;  1ARL A;  4PPZ A;  2FCK A;  2Q7S A;  4AXV A;  5C88 A;  4B12 A;  1RTQ A;  2OZG A;  2AFO A;  3NA6 A;  1XE4 A;  1Q2C A;  3EFA A;  3B7I A;  1HDQ A;  4KOU A;  4ZBG A;  3EO4 A;  4MY0 A;  3CT9 A;  2FL4 A;  2OB0 A;  1VHU A;  3IID A;  1YW4 A;  4P6Y A;  5FSV A;  3SJE A;  1F2O A;  4QC6 A;  4HPS A;  2R98 A;  5C82 A;  4R76 A;  5LYI A; 
#chains in the Genus database with same CATH homology
 5LRK A;  4RUH A;  3EWP A;  1R3N A;  4PXD A;  3FX6 A;  2AFM A;  2V8D A;  4JYW A;  3GQO A;  3KZW A;  2DEA A;  3V38 A;  4A94 A;  4OID A;  2NSM A;  4ABK A;  1CG2 A;  3HUV A;  2FXK A;  2C6C A;  4R7M A;  3I1U A;  2EK8 A;  3FMC A;  2IMO A;  4KYB A;  2BO9 A;  5DS0 A;  2RFH A;  4EWT A;  4UEF A;  2JBJ A;  3FJU A;  3GB0 A;  3B3V A;  8CPA A;  1M4L A;  2PJ3 A;  3D7D A;  2CTC A;  2WZN A;  4OIW A;  3PBB A;  4P4J A;  2XEG A;  4UIA A;  1ELL P;  2G9D A;  4IK2 A;  3VH9 A;  5K8O A;  4UEZ A;  4GM5 A;  2O53 A;  2V8V A;  3DLJ A;  3MN8 A;  4YU9 A;  3EWQ A;  5LYL A;  2JEW A;  5J1Q A;  1LAN A;  3PB8 X;  3KI9 A;  5K8M A;  4EFD A;  3KHX A;  4BD9 A;  5LYF A;  4MCR A;  5LYD A;  1SPV A;  3LMS A;  3PBE A;  2FAV A;  2FG1 A;  2EWB A;  4P4D A;  4P4B A;  3WC7 A;  4ZY1 A;  1F57 A;  4DUK A;  1LFW A;  2L8R A;  4MMO A;  1TKJ A;  1UWY A;  5CPA A;  3EWR A;  3KGQ A;  1ZG8 A;  3GLJ A;  3TX8 A;  3ISX A;  1TY8 A;  4GVW A;  5JGF A;  4ZY2 A;  3QNV A;  1TF9 A;  1Y0R A;  1DE4 C;  2DX6 A;  1LAM A;  4EME A;  2ZEO A;  3NH4 A;  4NGQ A;  2QYV A;  3B3S A;  2AFX A;  5JH9 A;  3SIJ A;  2CF4 A;  4R6T A;  2PJC A;  3B2Y A;  2ZEN A;  1PYT B;  3RBU A;  3SIG A;  1TXR A;  3SJG A;  2JBK A;  2BOA A;  2I3C A;  4IQY A;  3RAM A;  3SIH A;  1GYT A;  2PJ2 A;  3GPG A;  3FEC A;  3PB4 X;  4P44 A;  4JGK A;  2AFW A;  2GU2 A;  5D29 A;  3D7H A;  4NGS A;  1Y7E A;  3B35 A;  3PFO A;  2OOT A;  3BI0 A;  2PJ8 A;  2WYR A;  3HLP A;  5HVF A;  3TC8 A;  3K9T A;  3EJF A;  3IFE A;  4UEE A;  3IWW A;  4H2K A;  4NGR A;  4LQG A;  4F9U A;  2PRQ A;  2PJ1 A;  1QQ9 A;  2ACF A;  5HXD A;  1ZLI A;  3GPO A;  5JM6 A;  1XFO A;  3JRU A;  4ZX8 A;  2PJB A;  3K2K A;  4NJQ A;  2RB7 A;  2V77 A;  4OKO A;  4PXB A;  5CB5 A;  4OC0 A;  3KR5 A;  1DTD A;  2C1C A;  2EEE A;  3D7F A;  3PB7 X;  2NYQ A;  2C6G A;  4MHZ A;  4MCP A;  2BFR A;  5HIH A;  1YME A;  5K8P A;  4K0C A;  3VAR A;  2LGR A;  4A38 A;  1AMP A;  4ZY0 A;  5CB3 A;  2PJ9 A;  3T8W A;  1CPS A;  4OME A;  1XJO A;  3KL9 A;  2XEJ A;  1VHE A;  2PIY A;  4TWE A;  1QMU A;  2GRE A;  3IC1 A;  2F7V A;  2V8G A;  3V7Z A;  2ZEE A;  2J9A A;  3PRT A;  3KQZ A;  1KWM A;  2CTB A;  4P45 A;  4FAI A;  1HEE A;  4PXC A;  5FSX A;  1BPM A;  3GPQ A;  3SII A;  1Q7L A;  3VAT A;  4MCS A;  4P4F A;  2BCO A;  4A39 A;  5HVG A;  2HC9 A;  1HDU A;  3IJ3 A;  1ARM A;  3H8F A;  4MHN A;  2AFS A;  2ZEP A;  1ZR5 A;  2Q43 A;  5LRG A;  3SI0 A;  3BI1 A;  2PJA A;  3ISZ A;  4FUU A;  3FED A;  5CBM A;  4OC4 A;  2IQ6 A;  4ABL A;  3CPA A;  5E3B A;  1CP7 A;  1TKH A;  3N5F A;  1LOK A;  4K3N A;  2POK A;  3IIB A;  2F8H A;  2AFZ A;  1YW6 A;  1BLL E;  2ABZ A;  3PEI A;  1YLO A;  2ZED A;  2PJ7 A;  1EE3 P;  3D67 A;  2VRI A;  4A37 A;  3S9L A;  3WC5 A;  2CIJ A;  2PJ5 A;  3L2N A;  1YSJ A;  4J4Z A;  3V2B A;  4NFR A;  4R8F A;  3B3T A;  4YWY A;  2O4H A;  4NGP A;  4P10 A;  5AIL A;  1TKF A;  1XRY A;  3FEE A;  4X8I A;  2QJ8 A;  4O23 A;  5IB9 A;  1AYE A;  2HB6 A;  1NJR A;  4MHY A;  3KQX A;  2GLJ A;  1Z8L A;  5ELY A;  4JLL A;  3GUX A;  4J5Q A;  2PJ0 A;  1PCA A;  4ONW A;  5CMS A;  4JZ0 A;  3SJF A;  5I4M A;  2PCU A;  6CPA A;  2V8H A;  3CPX A;  1ELM P;  4CPA A;  4TNU A;  4ZYQ A;  3NH5 A;  3PB6 X;  4ZI6 A;  3LWU A;  4OC2 A;  4MXU A;  3ETI A;  4D86 A;  3H8E A;  1XMB A;  4OC5 A;  3EWO A;  3D7G A;  4FWU A;  4MRI A;  4W9Y A;  4IHM A;  2PE3 A;  1OBR A;  3IEH A;  1BAV A;  2PVV A;  4P4E A;  4MCQ A;  3WAB A;  4F8Z A;  3RZA A;  4OC3 A;  2AFC A;  2ANP A;  3GQE A;  4GUA A;  1XBU A;  2XEI A;  3S9M A;  4UML A;  3EJG A;  3WC6 A;  4UIB A;  3Q6Z A;  3EKE A;  2FVG A;  2PIZ A;  5K8N A;  2IJZ A;  1VGY A;  5THW A;  5HVH A;  3KR4 A;  2VL1 A;  1ZR3 A;  4DJL A;  3BHX A;  4Q7A A;  1BPN A;  5LRJ A;  2ZEH A;  4TU0 A;  2ZOF A;  2ZEG A;  1NSA A;  2XEF A;  1JQG A;  4P4I A;  4FBE A;  2ZEL A;  3JZT A;  2PVW A;  2AFU A;  3PB9 X;  4WWV A;  1TF8 A;  3SJX A;  2X47 A;  3FF3 A;  3SI2 A;  4Z65 A;  4ETJ A;  4NGM A;  3S9N A;  3B3W A;  4G1P A;  1H8L A;  3B3C A;  4J5S A;  1IGB A;  3VFQ A;  4NGN A;  4F9V A;  5D8N A;  1VIX A;  1Z5R A;  2QVP A;  1FNO A;  2PJ6 A;  1LCP A;  3D68 A;  1ZG7 A;  1LAP A;  3BXM A;  4DYO A;  2ZEM A;  3FH4 A;  4ESS A;  4JVV A;  4KSI A;  4MHP A;  3MRU A;  3Q71 A;  1VHO A;  3KHZ A;  4NJR A;  4J5R A;  5HOL A;  2BFQ A;  2GLF A;  1CPX A;  5DUS A;  1FT7 A;  4NGT A;  5F09 A;  3WT4 A;  2ZEF A;  5FSZ A;  1Z2L A;  3SI1 A;  3EW5 A;  4X2T A;  1ZG9 A;  1HJZ A;  4GVV A;  7CPA A;  2XD7 A;  3V45 A;  4ETK A;  3KAS A;  1F2P A;  1CX8 A;  3NH8 A;  4JCA A;  2OR4 A;  1CBX A;  3FVL A;  1CP6 A;  3NFZ A;  5FSU A;  3PFE A;  1R43 A;  2PJ4 A;  3CDX A;  1IY7 A;  1Y0Y A;  4ZX9 A;  2C6P A;  2Q4Z A;  4PQA A;  3IO1 A;  4PXE A;  4UF4 A;  4X3R A;  3IIF A;  3DGV A;  5FSY A;  2Q51 A;  2ZOG A;  3D4U A;  4IAV A;  2EK9 A;  1YD9 A;  3D66 A;  3H8G A;  1TXZ A;  4B6Z A;  4WJB A;  1ZLH A;  4OC1 A;  4AXV A;  1ARL A;  4PPZ A;  1RTQ A;  2AFO A;  3NA6 A;  3B7I A;  1HDQ A;  4P6Y A;  3CT9 A;  3SJE A;  1VHU A;  3IID A;  1YW4 A;  5FSV A;  1F2O A;  4OP4 A;  4R76 A;  5LYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...