4R6TA

Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
519
structure length
514
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
molecule tags Hydrolase/hydrolase inhibitor
source organism Plasmodium falciparum 3d7
publication title Two-Pronged Attack: Dual Inhibition of Plasmodium falciparum M1 and M17 Metalloaminopeptidases by a Novel Series of Hydroxamic Acid-Based Inhibitors.
pubmed doi rcsb
total genus 168
structure length 514
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4r6tA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4r6tA02
4GUAA 2PJ7A 1DTDA 3PB4X 4NGSA 2F8HA 1H8LA 1CBXA 3B3VA 2RFHA 3KR5A 2FAVA 2CF4A 5JGFA 1FT7A 4MHPA 4ZY2A 3VFQA 1CPXA 5LRKA 4OC0A 5K8PA 2O4HA 3EJGA 2PCUA 4ZX8A 3GPGA 1M4LA 3IIBA 2GU2A 1YMEA 3NFZA 3JZTA 2ANPA 3K9TA 2IJZA 4PQAA 1TY8A 2IMOA 1DE4C 1HDUA 1XJOA 5LRGA 1HDQA 3PBBA 2WZNA 3WABA 3WC6A 4BD9A 4J5RA 4ZY1A 3IJ3A 2ZEFA 3KHXA 3LWUA 5FSZA 8CPAA 4O23A 2PJAA 3Q6ZA 2AFWA 2EWBA 4ZI6A 1CX8A 1XRYA 2PE3A 2ZOGA 3QNVA 2JBJA 3KR4A 3GQEA 3GQOA 3EWRA 3Q71A 4MHNA 1LANA 2AFZA 2I3CA 4IAVA 4JZ0A 3GB0A 4NGNA 4UIBA 4R8FA 2CTCA 3SJXA 1TF8A 5CBMA 2AFXA 5LYDA 5CPAA 4R76A 1IY7A 5IB9A 4P10A 2PJ9A 5D8NA 2ZEMA 4UIAA 4DJLA 3SJGA 3WC5A 4X2TA 4UEFA 1ARLA 1ZLHA 2RB7A 4GM5A 2ZELA 1XBUA 2LGRA 2G9DA 1LAMA 1PCAA 1GYTA 1VHEA 1FNOA 4OIDA 4JGKA 1F2OA 2V77A 4P4BA 2BFRA 3DLJA 2PRQA 3EKEA 2ABZA 5FSYA 3L2NA 5LRJA 4P4IA 3H8FA 1Y7EA 5LYIA 1TXRA 3JRUA 3I1UA 2EEEA 1BLLE 4PXBA 5THWA 1QQ9A 4P4DA 3ISZA 2ZENA 2IQ6A 4UEEA 3K2KA 1UWYA 2JBKA 3KQXA 4ZX9A 2V8VA 1BPMA 2WYRA 5E3BA 1CG2A 3IWWA 4ZYQA 4YU9A 4JYWA 4F9UA 3IIDA 2PIYA 5HXDA 4TU0A 4OC2A 2AFSA 1ARMA 1Z8LA 4TWEA 5CMSA 2DEAA 4MCQA 3FEEA 2BFQA 1VGYA 4X3RA 3PB9X 3B3CA 2ZEPA 2PJ5A 3ETIA 3TX8A 4MRIA 2QJ8A 4UF4A 3V7ZA 3FEDA 2GREA 5FSUA 1NSAA 2PJ3A 2OOTA 4A37A 5JM6A 1ELMP 4MXUA 5CB3A 3NA6A 4OC5A 3GUXA 3BHXA 1TKHA 3SIIA 5FSVA 3EWQA 5DUSA 2ZEHA 3NH5A 3PRTA 1YSJA 3IFEA 4PXEA 2NSMA 1LCPA 4FWUA 4IHMA 4CPAA 3CPAA 4RUHA 3IO1A 2ZOFA 4J5QA 3EWPA 3VH9A 4UMLA 4NGRA 3V2BA 5JH9A 2Q51A 1JQGA 4IQYA 3GPOA 3HLPA 3RAMA 3PB8X 4FUUA 3H8EA 2F7VA 4FAIA 2VRIA 3VARA 5HVFA 1Z2LA 3SIJA 5HVGA 1QMUA 2XD7A 2PJ0A 4PXCA 4MCRA 1Q7LA 4F9VA 4ABLA 2XEFA 3V45A 4PPZA 1OBRA 1EE3P 2QVPA 5HOLA 4ABKA 1R43A 2Q4ZA 3IEHA 1ZG8A 2AFOA 3PFEA 1ZG7A 4JCAA 4OC3A 5DS0A 3S9LA 3D4UA 4WJBA 1NJRA 4X8IA 3EWOA 4DYOA 2PJ6A 3MN8A 2CIJA 1HEEA 5HIHA 3ISXA 4EMEA 4ETJA 4LQGA 4NGMA 4EWTA 4ZY0A 3KASA 3NH4A 2C6CA 3NH8A 2AFCA 4FBEA 3BI1A 4A38A 1VHOA 3D7DA 6CPAA 4P45A 4IK2A 4B6ZA 2BO9A 3TC8A 4EFDA 4MCPA 3D7GA 2EK9A 1TF9A 2PJBA 3GLJA 4NJRA 4R6TA 4A39A 4JLLA 2PJCA 2PJ4A 3SI0A 3S9MA 2FG1A 4NFRA 4AXVA 4MHYA 4P4FA 3EJFA 3SIGA 2FXKA 1YD9A 2AFUA 5FSXA 1YLOA 4OKOA 3KQZA 3SIHA 2ZEOA 1VHUA 3SI1A 3PEIA 1CP7A 1ZLIA 4P4EA 1XFOA 5F09A 2C6PA 4OMEA 1F2PA 1KWMA 3BI0A 3WT4A 4OIWA 3GPQA 3MRUA 3D66A 1BAVA 2VL1A 3DGVA 5LYLA 2BOAA 2ZEEA 4GVVA 2JEWA 2PJ1A 3N5FA 4NGPA 1ZG9A 1LAPA 2GLFA 4DUKA 1CP6A 3FVLA 3B35A 1Y0YA 3IC1A 2FVGA 4Z65A 4GVWA 4Q7AA 3IIFA 1RTQA 1SPVA 3CT9A 4W9YA 1YW4A 4NGQA 3S9NA 4P4JA 2V8GA 3FECA 3SJEA 4ESSA 2PJ2A 3FMCA 2O53A 2POKA 3KZWA 4F8ZA 2QYVA 2NYQA 3FF3A 2PVVA 3V38A 4UEZA 4P44A 4J5SA 4D86A 3VATA 2XEJA 3FX6A 3CPXA 3RZAA 4G1PA 2XEGA 2PIZA 3T8WA 4K3NA 3CDXA 3PBEA 4ONWA 3KGQA 4P6YA 2J9AA 5K8NA 4JVVA 1Y0RA 1BPNA 4R7MA 3PB6X 4A94A 3B3SA 4MMOA 3KI9A 1YW6A 4H2KA 5LYFA 4NJQA 7CPAA 1TKFA 2C1CA 1ZR5A 1Z5RA 5J1QA 5HVHA 4PXDA 2CTBA 4OC1A 2ZEDA 3B2YA 3KL9A 2HC9A 3WC7A 5D29A 3D68A 4MCSA 2V8DA 2Q43A 1HJZA 1IGBA 1XMBA 3LMSA 2ZEGA 4K0CA 5I4MA 1LOKA 5K8MA 3BXMA 4WWVA 3HUVA 5K8OA 3B3WA 3RBUA 4KYBA 3SI2A 2C6GA 2OR4A 1ZR3A 1CPSA 3B7IA 2GLJA 4OC4A 3D67A 2PJ8A 3SJFA 1TKJA 1TXZA 2HB6A 3B3TA 2ACFA 2V8HA 3FH4A 1LFWA 4TNUA 3PFOA 2PVWA 1PYTB 3EW5A 5CB5A 1F57A 3PB7X 2XEIA 1R3NA 4J4ZA 3H8GA 1ELLP 4ETKA 4OP4A 3KHZA 4NGTA 4YWYA 2DX6A 1AMPA 3D7HA 1VIXA 4MHZA 4KSIA 5AILA 5ELYA 2AFMA 2X47A 1AYEA 2EK8A 2L8RA 2BCOA 3D7FA 3FJUA
chains in the Genus database with same CATH superfamily
4GUAA 2PJ7A 1DTDA 3PB4X 4NGSA 1QSOA 2F8HA 1H8LA 4M6HA 1AUGA 2KCWA 1CBXA 3B3VA 2RFHA 3KR5A 4KOTA 2VXKA 2FAVA 2CF4A 5JGFA 1FT7A 2Q44A 4MFQA 4MHPA 4ZY2A 3VFQA 4BINA 2X7BA 5ISVA 4ONUA 2EBJA 2WPWA 4GS4A 1CPXA 4CS0B 4OC0A 1Y9KA 5K8PA 5LRKA 2O4HA 3EJGA 2IL4A 2PCUA 4F0YA 4ZX8A 3GPGA 1M4LA 3IIBA 2GU2A 4AG9A 5A28A 2JDCA 2RNKA 1YMEA 3E0KA 3UY5A 2Q7BA 2GE3A 2Z0ZA 3NFZA 3JZTA 4MI4A 2ANPA 4H6UA 2CY2A 2Z3NA 4KOSA 3K9TA 2IJZA 2CNSA 4PQAA 4II9A 1B6BA 3GY9A 2Z3MA 4CRZB 4QVTA 1TY8A 2IMOA 1DE4C 1HDUA 2WPXA 2JZDA 4XPDC 4C2YA 1QSMA 3GYAA 1XJOA 5LRGA 3R9GA 1HDQA 3PBBA 2WZNA 3IGRA 2PR1A 3WABA 3WC6A 5H84A 4BD9A 1U6MA 4R57A 4J5RA 4ZY1A 3IJ3A 2ZEFA 3KHXA 3LWUA 5FSZA 1Z4RA 4YFJA 8CPAA 4O23A 2B3UA 2FIWA 2PJAA 3D8PA 3Q6ZA 1R57A 3H4QA 4U5YA 4RN7A 2AFWA 2R7HA 5FVJA 4A95A 3LD2A 1Q2YA 2YGWA 2EWBA 4ZI6A 1CX8A 1P0HA 1XRYA 2PE3A 2Q7SA 2JLMA 2ZOGA 1RO5A 2B4DA 3FRMA 4UCMA 2FT0A 2JBJA 3KR4A 3GQEA 3GQOA 3EWRA 3Q71A 1GHEA 1I1DA 2BL1A 4EVYA 5KTAA 4MHNA 1LANA 1J4JA 2AFZA 3F0AA 2EUIA 4ORFA 2I3CA 2QIRA 4IAVA 4JZ0A 4KSAA 3GB0A 4NGNA 4UIBA 4R8FA 3BLNA 4CAXA 2CTCA 3SJXA 1TF8A 4M85A 5CBMA 2AFXA 4HNWB 2A4NA 4R76A 5CPAA 5LYDA 2AE6A 3G8WA 4CGNA 2JDDA 4LX9A 3DNSA 2G0BA 4NEXA 1IY7A 5J8FA 4CRYB 3TCVA 5IB9A 4JXRA 3JTKA 3D3SA 2J8RA 4P10A 5AG4A 2PJ9A 1S7LA 2CXAA 5D8NA 1QSTA 3CXSA 4JD6A 4PSWA 3TE4A 3CXQA 2ZEMA 4UIAA 5CNPA 5C82A 3R95A 4DJLA 3SJGA 3TTHA 3WC5A 1Q2DA 4X2TA 4UEFA 1ARLA 1ZLHA 2RB7A 4BBHA 4GM5A 2D4OA 2ZELA 1XBUA 2LGRA 2G9DA 2R8VA 1Z8XA 1LAMA 1VHEA 1PCAA 1GYTA 1IOIA 1FNOA 1XE4A 4OIDA 4JGKA 3W6XA 4AB7A 1F2OA 2V77A 2ZW7A 4P4BA 2BFRA 5BWAB 3DLJA 2PRQA 3EKEA 2ABZA 5FSYA 1FY7A 2FS5A 3L2NA 5LRJA 4P4IA 3H8FA 1Y7EA 1MJ9A 1TXRA 2B5GB 3PGPA 3JRUA 5G21A 3I1UA 5LYIA 3S6HA 2EEEA 1BLLE 4PXBA 5THWA 1S3ZA 4RI1A 1QQ9A 3TO6A 3R9FA 4P4DA 2BUEA 3ISZA 1YREA 2ZENA 5AG7A 2IQ6A 2O28A 2WSAA 4UEEA 3ZJ0A 2YNDA 3K2KA 1UWYA 1N71A 2JBKA 3T90A 5IV0A 2FCKA 4L89A 5G1ZA 3KQXA 4ZGYB 1S5KA 4F0XA 1VHSA 4TNUA 4ZX9A 1XEBA 2V8VA 1I12A 1BPMA 1X10A 2B4BA 4J3GA 2WYRA 5EMIA 2J8NA 4KS9A 5E3BA 1CG2A 3FYNA 3IWWA 5AG5A 4ZYQA 3BJ8A 4YU9A 1XIXA 4AVBA 4JYWA 5A27A 4R9MA 2I79A 3A9LA 4F9UA 2B5GA 3IIDA 2PIYA 3FB3A 4NF1A 5HXDA 4TU0A 4OC2A 2AFSA 1ARMA 1Z9UA 1YLEA 1Z8LA 2DXQA 2FXFA 3P2FA 5GCNA 3W91A 3DR8A 4TWEA 2ZW5A 4KVXA 5CMSA 3ZZIA 3S6FA 3QNVA 2DEAA 4K30A 4KSFA 4MCQA 3FEEA 2BFQA 1VGYA 3JUWA 3PB9X 4X3RA 3B3CA 2EO8A 2ZEPA 2Z3KA 5G22A 2PJ5A 1PUAA 2P6FA 5E96A 3ETIA 3TX8A 4MRIA 2QJ8A 4UF4A 3V7ZA 3EFAA 3FEDA 4MHDA 2GANA 2GREA 5FSUA 1NSAA 4YRHA 2PJ3A 2OOTA 4A37A 4PK2A 4C7HA 1ELMP 4MXUA 5CB3A 4AG7A 5JM6A 4CYOA 3NA6A 2YNCC 4OC5A 3GUXA 3BHXA 3F8KA 1TKHA 3SIIA 4QC6A 3SXOA 3VWEA 4CAEA 1M4DA 5FSVA 3EWQA 4FD5A 5DUSA 2ZEHA 3FXTA 3NH5A 1YSJA 3PRTA 3IFEA 4PXEA 3FNCA 2NSMA 5JQ4A 1LCPA 3SXNA 2P6EA 3QAHA 1CJWA 4FWUA 4IHMA 3CPAA 3DR6A 4CPAA 4RUHA 3IO1A 3FIXA 3QB8A 1KUXA 1X12A 1ZO0A 2ZOFA 4J5QA 5C88A 2P0WA 3EWPA 4CYNA 3D2PA 3VH9A 2JZEA 4UMLA 3W6SA 5IB0A 1YK3A 4MJ8A 4NGRA 3V2BA 4AVCA 2Q51A 5JH9A 4FD7A 1S7NA 4B5PA 1JQGA 4IQYA 2I00A 3GPOA 3DDDA 3HLPA 3RAMA 3PB8X 4MFPA 4C7IA 2EVNA 1XOVA 5F47A 1MK4A 1I21A 3SHPA 3IU1A 3EO4A 2F5IA 4QUSA 5G20A 4FUUA 3H8EA 4HKFA 4KUAA 3I3GA 4A32A 2F7VA 3LACA 2VRIA 4IUSA 4JLYA 1UFHA 3S6KA 3VARA 5HVFA 4FAIA 2WCTA 1Z2LA 2DF5A 3IU2A 4A31A 3SIJA 1KZFA 3EY5A 5HVGA 1M1DA 1QMUA 4Q38A 4R87A 4UFXA 2XD7A 2PJ0A 1XF8A 4M6GA 1IU8A 4PXCA 2P6GA 1Z8WA 1Q7LA 4MCRA 4F9VA 4ABLA 4CAWA 2XEFA 4BMHA 2ZPAA 3V45A 4PPZA 1OBRA 2OZUA 4I49A 4CGPA 1EE3P 2QVPA 5HOLA 4ABKA 1R43A 2Q4ZA 3IWEA 3IEHA 1S7KA 1WK4A 1ZG8A 1SQHA 2AFOA 1Q2CA 3N7ZA 3PFEA 4KVME 2FSRA 4NSQA 1ZG7A 3TOAA 4JCAA 4OC3A 5DS0A 3S9LA 3D4UA 4UCNA 4WJBA 1S60A 1NJRA 5HH1A 4X8IA 4UA3A 3EWOA 4DYOA 2PJ6A 3MN8A 2CIJA 2YNCA 1HEEA 2QMLA 2HV2A 5HIHA 4CAFA 3ISXA 4EMEA 4ETJA 4LQGA 2HQYA 2VBQA 2NMTA 4NGMA 4EWTA 4ZY0A 3KASA 4RS2A 3TO9A 3NH4A 2C6CA 2RC4A 3NH8A 2AFCA 4KOYA 4FBEA 2K5TA 3BI1A 4A38A 2PSWA 1VHOA 3D7DA 4OADA 1V0CA 4CYPA 6CPAA 4P45A 5KTDA 2ARHA 5HMNA 3PZJA 4A2ZA 1KUYA 4IK2A 4B6ZA 3CZXA 2BO9A 4UBRA 3TC8A 4EFDA 3GIUA 3R1KA 4MCPA 3RYOA 2ZW4A 3D7GA 2EK9A 4CGMA 1TF9A 2PJBA 5EC4A 3GLJA 4NJRA 4OAEA 4R6TA 2CNTA 4UWJA 4B5PB 1QSNA 4LQ6A 4JWPA 4A39A 2YNEA 4JLLA 2PJCA 2PJ4A 4QB9A 3SI0A 2B3VA 3R9EA 3S9MA 1A2ZA 2FG1A 4NFRA 4AXVA 3MGDA 5H86A 4MHYA 2ZXVA 4P4FA 3EJFA 2VEZA 4KLVA 3SIGA 4UCPA 2FXKA 3TO7A 1YR0A 1YD9A 3H5ZA 2Z11A 2AFUA 5FSXA 4QBJA 3P2HA 1YLOA 4OKOA 3KQZA 1XMTA 3SIHA 2ZEOA 1IYKA 1VHUA 1IICA 1CM0A 3SI1A 3PEIA 4Y49B 3TOBA 1CP7A 1ZLIA 4P4EA 1XFOA 4IF5A 4H89A 4XPDB 5F09A 2C6PA 4OMEA 1F2PA 2Z3PA 3GKRA 2G3TA 3PP9A 4FD4A 4ZBGA 4NCZA 4MY3A 3RNZA 4CYQA 1KWMA 3BI0A 4B13A 3WT4A 4OIWA 3GPQA 3JVNA 2Q04A 3MRUA 5AG6A 1LRZA 1Z8TA 2BEIA 2PC1A 3D66A 4LUAA 1BAVA 2VL1A 3DGVA 5LYLA 2BOAA 3C26A 2ZEEA 4GVVA 2JEWA 2PJ1A 1L0CA 3N5FA 4NGPA 4B10A 5F46A 3EXNA 1ZG9A 1LAPA 2GLFA 5JPHA 1IOFA 4DUKA 1CP6A 3FVLA 4OLLA 4FD6A 4UWIA 4KOUA 3B35A 2REEA 4B11A 1QSRA 1Y0YA 3IC1A 2Q0YA 4KZTA 2FVGA 4Z65A 4GVWA 4KUBA 3TFYA 1Z4EA 5DWMA 3KKWA 1M4GA 3IIFA 1MJAA 4Q7AA 3OWCA 4E2AA 1RTQA 1Y7RA 1YVKA 2FL4A 4MFKA 3R96A 2B58A 1SPVA 2Q4VA 3CT9A 4W9YA 1YW4A 1IIDA 5EBVA 2JZFA 3BJ7A 4NGQA 3S9NA 3G3SA 4P4JA 2V8GA 3FECA 4MFZA 4GXHA 3SJEA 4ESSA 2PJ2A 3EC4A 3FMCA 2O53A 2POKA 2PRBA 3KZWA 4E8OA 5J8CA 4F8ZA 2OH1A 2QYVA 2NYQA 4HNYB 3FF3A 2DPSA 2PVVA 4C2ZA 3V38A 4UEZA 4E0AA 4P44A 4J5SA 4D86A 4CGOA 2ODFA 2OZGA 2CNMA 2VI7A 4UFWA 3VATA 2XEJA 2REFA 3FX6A 3CPXA 3RZAA 4G1PA 4PK3A 2XEGA 2PIZA 3T8WA 2D4PA 3F5BA 4K3NA 3CDXA 3PBEA 4MY0A 4ONWA 3KGQA 4P6YA 2W2GA 4M3SA 2J9AA 3B8GA 2PQ8A 4M6IA 5K8NA 4JVVA 2DPTA 1Y0RA 2Z10A 2ZW6A 4B5OA 1BPNA 4R7MA 3PB6X 4KORA 2KQVA 4A94A 3B3SA 3NE7A 1VKCA 4MMOA 1S7FA 4MFLA 2H5MA 3KI9A 1YW6A 4H2KA 1NMTA 5LYFA 2C27A 3IWGA 3NE8A 3K9UA 4NJQA 2FE7A 7CPAA 1TKFA 5IX3A 5DWNA 2C1CA 1ZR5A 1Y9WA 2Q4YA 2QECA 1Z5RA 5J1QA 4XNHB 4A33A 2OZHA 5HVHA 4PV6A 4PXDA 1BO4A 2CTBA 4U9ZA 5F49A 1KUVA 2VZYA 4OC1A 3T9YA 2ZEDA 2OB0A 3B2YA 3KL9A 3LODA 1NSLA 4CAVA 2HC9A 3WC7A 5D29A 3D68A 4HPSA 4U9YA 4MCSA 2V8DA 2Q43A 2Z3OA 1K4JA 1HJZA 3D2MA 1IGBA 3I9SA 1XMBA 1TIQA 2R98A 3LMSA 2ZEGA 3CXPA 4JJXA 4K0CA 5I4MA 1LOKA 5K8MA 1YVOA 4XPLA 2Z3LA 3BXMA 4WWVA 4X5KA 2PDOA 3HUVA 5K8OA 3B3WA 3RBUA 4XPKA 2R1IA 4KOWA 4KYBA 4NXYA 3SI2A 4R3LA 2GFQA 5AGEA 2C6GA 2OR4A 4HNXB 1ZR3A 1CPSA 4XNHC 2B4DB 4C68A 3B7IA 3WR7A 2GLJA 1M4IA 4OC4A 4B12A 4L8AA 3D67A 2PJ8A 1B87A 3VWDA 2Y0MA 3SJFA 2GIVA 1TKJA 4A30A 1TXZA 2HB6A 3B3TA 4H6ZA 4MBUA 2ACFA 2HUZA 4CGLA 1M44A 2V8HA 3FH4A 3DSBA 1LFWA 1PU9A 2BSWA 1YX0A 3PFOA 3QAYA 4R3KA 2PVWA 1PYTB 3EW5A 4KOVA 4Q36A 4DNCA 5I0CA 1YGHA 4F6AA 1MJBA 1IYLA 3V8IA 2AJ6A 2VZZA 5CB5A 1BOBA 1F57A 4KVOE 1IB1E 3PB7X 3RO0A 2JEVA 2XEIA 1R3NA 4JXQA 5KTCA 2ATRA 4J4ZA 3H8GA 3S6GA 1ELLP 4ETKA 4OP4A 3KHZA 2G3AA 4PSXA 4Y49C 5F48A 4B14A 1JWQA 4NGTA 4YWYA 2DX6A 2J8MA 4KLWA 1AMPA 3D7HA 1OZPA 1NE9A 2VQYA 4MFJA 3TT2A 1VIXA 4AVAA 2WUUA 4YGOA 4MHZA 2PR8A 2BCOA 1YQEA 2OU2A 4KSIA 5AILA 5ELYA 2AFMA 2X47A 1ON0A 1AYEA 1WWZA 4UFVA 4C2XA 3FBUA 2EK8A 1P4NA 4KOXA 2L8RA 1RXTA 3D7FA 2FIAA 3FJUA
chains in the Genus database with same CATH topology
4GUAA 2PJ7A 1DTDA 3PB4X 4NGSA 2F8HA 1H8LA 1CBXA 3B3VA 2RFHA 3KR5A 2FAVA 2CF4A 5JGFA 1FT7A 4MHPA 4ZY2A 3VFQA 1CPXA 5LRKA 4OC0A 5K8PA 2O4HA 3EJGA 2PCUA 4ZX8A 3GPGA 1M4LA 3IIBA 2GU2A 1YMEA 3NFZA 3JZTA 2ANPA 3K9TA 2IJZA 4PQAA 1TY8A 2IMOA 1DE4C 1HDUA 1XJOA 5LRGA 1HDQA 3PBBA 2WZNA 3WABA 3WC6A 4BD9A 4J5RA 4ZY1A 3IJ3A 2ZEFA 3KHXA 3LWUA 5FSZA 8CPAA 4O23A 2PJAA 3Q6ZA 2AFWA 2EWBA 4ZI6A 1CX8A 1XRYA 2PE3A 2ZOGA 3QNVA 2JBJA 3KR4A 3GQEA 3GQOA 3EWRA 3Q71A 4MHNA 1LANA 2AFZA 2I3CA 4IAVA 4JZ0A 3GB0A 4NGNA 4UIBA 4R8FA 2CTCA 3SJXA 1TF8A 5CBMA 2AFXA 5LYDA 5CPAA 4R76A 1IY7A 5IB9A 4P10A 2PJ9A 5D8NA 2ZEMA 4UIAA 4DJLA 3SJGA 3WC5A 4X2TA 4UEFA 1ARLA 1ZLHA 2RB7A 4GM5A 2ZELA 1XBUA 2LGRA 2G9DA 1LAMA 1PCAA 1GYTA 1VHEA 1FNOA 4OIDA 4JGKA 1F2OA 2V77A 4P4BA 2BFRA 3DLJA 2PRQA 3EKEA 2ABZA 5FSYA 3L2NA 5LRJA 4P4IA 3H8FA 1Y7EA 5LYIA 1TXRA 3JRUA 3I1UA 2EEEA 1BLLE 4PXBA 5THWA 1QQ9A 4P4DA 3ISZA 2ZENA 2IQ6A 4UEEA 3K2KA 1UWYA 2JBKA 3KQXA 4ZX9A 2V8VA 1BPMA 2WYRA 5E3BA 1CG2A 3IWWA 4ZYQA 4YU9A 4JYWA 4F9UA 3IIDA 2PIYA 5HXDA 4TU0A 4OC2A 2AFSA 1ARMA 1Z8LA 4TWEA 5CMSA 2DEAA 4MCQA 3FEEA 2BFQA 1VGYA 4X3RA 3PB9X 3B3CA 2ZEPA 2PJ5A 3ETIA 3TX8A 4MRIA 2QJ8A 4UF4A 3V7ZA 3FEDA 2GREA 5FSUA 1NSAA 2PJ3A 2OOTA 4A37A 5JM6A 1ELMP 4MXUA 5CB3A 3NA6A 4OC5A 3GUXA 3BHXA 1TKHA 3SIIA 5FSVA 3EWQA 5DUSA 2ZEHA 3NH5A 3PRTA 1YSJA 3IFEA 4PXEA 2NSMA 1LCPA 4FWUA 4IHMA 4CPAA 3CPAA 4RUHA 3IO1A 2ZOFA 4J5QA 3EWPA 3VH9A 4UMLA 4NGRA 3V2BA 5JH9A 2Q51A 1JQGA 4IQYA 3GPOA 3HLPA 3RAMA 3PB8X 4FUUA 3H8EA 2F7VA 4FAIA 2VRIA 3VARA 5HVFA 1Z2LA 3SIJA 5HVGA 1QMUA 2XD7A 2PJ0A 4PXCA 4MCRA 1Q7LA 4F9VA 4ABLA 2XEFA 3V45A 4PPZA 1OBRA 1EE3P 2QVPA 5HOLA 4ABKA 1R43A 2Q4ZA 3IEHA 1ZG8A 2AFOA 3PFEA 1ZG7A 4JCAA 4OC3A 5DS0A 3S9LA 3D4UA 4WJBA 1NJRA 4X8IA 3EWOA 4DYOA 2PJ6A 3MN8A 2CIJA 1HEEA 5HIHA 3ISXA 4EMEA 4ETJA 4LQGA 4NGMA 4EWTA 4ZY0A 3KASA 3NH4A 2C6CA 3NH8A 2AFCA 4FBEA 3BI1A 4A38A 1VHOA 3D7DA 6CPAA 4P45A 4IK2A 4B6ZA 2BO9A 3TC8A 4EFDA 4MCPA 3D7GA 2EK9A 1TF9A 2PJBA 3GLJA 4NJRA 4R6TA 4A39A 4JLLA 2PJCA 2PJ4A 3SI0A 3S9MA 2FG1A 4NFRA 4AXVA 4MHYA 4P4FA 3EJFA 3SIGA 2FXKA 1YD9A 2AFUA 5FSXA 1YLOA 4OKOA 3KQZA 3SIHA 2ZEOA 1VHUA 3SI1A 3PEIA 1CP7A 1ZLIA 4P4EA 1XFOA 5F09A 2C6PA 4OMEA 1F2PA 1KWMA 3BI0A 3WT4A 4OIWA 3GPQA 3MRUA 3D66A 1BAVA 2VL1A 3DGVA 5LYLA 2BOAA 2ZEEA 4GVVA 2JEWA 2PJ1A 3N5FA 4NGPA 1ZG9A 1LAPA 2GLFA 4DUKA 1CP6A 3FVLA 3B35A 1Y0YA 3IC1A 2FVGA 4Z65A 4GVWA 4Q7AA 3IIFA 1RTQA 1SPVA 3CT9A 4W9YA 1YW4A 4NGQA 3S9NA 4P4JA 2V8GA 3FECA 3SJEA 4ESSA 2PJ2A 3FMCA 2O53A 2POKA 3KZWA 4F8ZA 2QYVA 2NYQA 3FF3A 2PVVA 3V38A 4UEZA 4P44A 4J5SA 4D86A 3VATA 2XEJA 3FX6A 3CPXA 3RZAA 4G1PA 2XEGA 2PIZA 3T8WA 4K3NA 3CDXA 3PBEA 4ONWA 3KGQA 4P6YA 2J9AA 5K8NA 4JVVA 1Y0RA 1BPNA 4R7MA 3PB6X 4A94A 3B3SA 4MMOA 3KI9A 1YW6A 4H2KA 5LYFA 4NJQA 7CPAA 1TKFA 2C1CA 1ZR5A 1Z5RA 5J1QA 5HVHA 4PXDA 2CTBA 4OC1A 2ZEDA 3B2YA 3KL9A 2HC9A 3WC7A 5D29A 3D68A 4MCSA 2V8DA 2Q43A 1HJZA 1IGBA 1XMBA 3LMSA 2ZEGA 4K0CA 5I4MA 1LOKA 5K8MA 3BXMA 4WWVA 3HUVA 5K8OA 3B3WA 3RBUA 4KYBA 3SI2A 2C6GA 2OR4A 1ZR3A 1CPSA 3B7IA 2GLJA 4OC4A 3D67A 2PJ8A 3SJFA 1TKJA 1TXZA 2HB6A 3B3TA 2ACFA 2V8HA 3FH4A 1LFWA 4TNUA 3PFOA 2PVWA 1PYTB 3EW5A 5CB5A 1F57A 3PB7X 2XEIA 1R3NA 4J4ZA 3H8GA 1ELLP 4ETKA 4OP4A 3KHZA 4NGTA 4YWYA 2DX6A 1AMPA 3D7HA 1VIXA 4MHZA 4KSIA 5AILA 5ELYA 2AFMA 2X47A 1AYEA 2EK8A 2L8RA 2BCOA 3D7FA 3FJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUA A;  2PJ7 A;  1DTD A;  3PB4 X;  4NGS A;  2F8H A;  1H8L A;  1CBX A;  3B3V A;  2RFH A;  3KR5 A;  2FAV A;  2CF4 A;  5JGF A;  1FT7 A;  4MHP A;  4ZY2 A;  3VFQ A;  1CPX A;  5LRK A;  4OC0 A;  5K8P A;  2O4H A;  3EJG A;  2PCU A;  4ZX8 A;  3GPG A;  1M4L A;  3IIB A;  2GU2 A;  1YME A;  3NFZ A;  3JZT A;  2ANP A;  3K9T A;  2IJZ A;  4PQA A;  1TY8 A;  2IMO A;  1DE4 C;  1HDU A;  1XJO A;  5LRG A;  1HDQ A;  3PBB A;  2WZN A;  3WAB A;  3WC6 A;  4BD9 A;  4J5R A;  4ZY1 A;  3IJ3 A;  2ZEF A;  3KHX A;  3LWU A;  5FSZ A;  8CPA A;  4O23 A;  2PJA A;  3Q6Z A;  2AFW A;  2EWB A;  4ZI6 A;  1CX8 A;  1XRY A;  2PE3 A;  2ZOG A;  3QNV A;  2JBJ A;  3KR4 A;  3GQE A;  3GQO A;  3EWR A;  3Q71 A;  4MHN A;  1LAN A;  2AFZ A;  2I3C A;  4IAV A;  4JZ0 A;  3GB0 A;  4NGN A;  4UIB A;  4R8F A;  2CTC A;  3SJX A;  1TF8 A;  5CBM A;  2AFX A;  5LYD A;  5CPA A;  4R76 A;  1IY7 A;  5IB9 A;  4P10 A;  2PJ9 A;  5D8N A;  2ZEM A;  4UIA A;  4DJL A;  3SJG A;  3WC5 A;  4X2T A;  4UEF A;  1ARL A;  1ZLH A;  2RB7 A;  4GM5 A;  2ZEL A;  1XBU A;  2LGR A;  2G9D A;  1LAM A;  1PCA A;  1GYT A;  1VHE A;  1FNO A;  4OID A;  4JGK A;  1F2O A;  2V77 A;  4P4B A;  2BFR A;  3DLJ A;  2PRQ A;  3EKE A;  2ABZ A;  5FSY A;  3L2N A;  5LRJ A;  4P4I A;  3H8F A;  1Y7E A;  5LYI A;  1TXR A;  3JRU A;  3I1U A;  2EEE A;  1BLL E;  4PXB A;  5THW A;  1QQ9 A;  4P4D A;  3ISZ A;  2ZEN A;  2IQ6 A;  4UEE A;  3K2K A;  1UWY A;  2JBK A;  3KQX A;  4ZX9 A;  2V8V A;  1BPM A;  2WYR A;  5E3B A;  1CG2 A;  3IWW A;  4ZYQ A;  4YU9 A;  4JYW A;  4F9U A;  3IID A;  2PIY A;  5HXD A;  4TU0 A;  4OC2 A;  2AFS A;  1ARM A;  1Z8L A;  4TWE A;  5CMS A;  2DEA A;  4MCQ A;  3FEE A;  2BFQ A;  1VGY A;  4X3R A;  3PB9 X;  3B3C A;  2ZEP A;  2PJ5 A;  3ETI A;  3TX8 A;  4MRI A;  2QJ8 A;  4UF4 A;  3V7Z A;  3FED A;  2GRE A;  5FSU A;  1NSA A;  2PJ3 A;  2OOT A;  4A37 A;  5JM6 A;  1ELM P;  4MXU A;  5CB3 A;  3NA6 A;  4OC5 A;  3GUX A;  3BHX A;  1TKH A;  3SII A;  5FSV A;  3EWQ A;  5DUS A;  2ZEH A;  3NH5 A;  3PRT A;  1YSJ A;  3IFE A;  4PXE A;  2NSM A;  1LCP A;  4FWU A;  4IHM A;  4CPA A;  3CPA A;  4RUH A;  3IO1 A;  2ZOF A;  4J5Q A;  3EWP A;  3VH9 A;  4UML A;  4NGR A;  3V2B A;  5JH9 A;  2Q51 A;  1JQG A;  4IQY A;  3GPO A;  3HLP A;  3RAM A;  3PB8 X;  4FUU A;  3H8E A;  2F7V A;  4FAI A;  2VRI A;  3VAR A;  5HVF A;  1Z2L A;  3SIJ A;  5HVG A;  1QMU A;  2XD7 A;  2PJ0 A;  4PXC A;  4MCR A;  1Q7L A;  4F9V A;  4ABL A;  2XEF A;  3V45 A;  4PPZ A;  1OBR A;  1EE3 P;  2QVP A;  5HOL A;  4ABK A;  1R43 A;  2Q4Z A;  3IEH A;  1ZG8 A;  2AFO A;  3PFE A;  1ZG7 A;  4JCA A;  4OC3 A;  5DS0 A;  3S9L A;  3D4U A;  4WJB A;  1NJR A;  4X8I A;  3EWO A;  4DYO A;  2PJ6 A;  3MN8 A;  2CIJ A;  1HEE A;  5HIH A;  3ISX A;  4EME A;  4ETJ A;  4LQG A;  4NGM A;  4EWT A;  4ZY0 A;  3KAS A;  3NH4 A;  2C6C A;  3NH8 A;  2AFC A;  4FBE A;  3BI1 A;  4A38 A;  1VHO A;  3D7D A;  6CPA A;  4P45 A;  4IK2 A;  4B6Z A;  2BO9 A;  3TC8 A;  4EFD A;  4MCP A;  3D7G A;  2EK9 A;  1TF9 A;  2PJB A;  3GLJ A;  4NJR A;  4R6T A;  4A39 A;  4JLL A;  2PJC A;  2PJ4 A;  3SI0 A;  3S9M A;  2FG1 A;  4NFR A;  4AXV A;  4MHY A;  4P4F A;  3EJF A;  3SIG A;  2FXK A;  1YD9 A;  2AFU A;  5FSX A;  1YLO A;  4OKO A;  3KQZ A;  3SIH A;  2ZEO A;  1VHU A;  3SI1 A;  3PEI A;  1CP7 A;  1ZLI A;  4P4E A;  1XFO A;  5F09 A;  2C6P A;  4OME A;  1F2P A;  1KWM A;  3BI0 A;  3WT4 A;  4OIW A;  3GPQ A;  3MRU A;  3D66 A;  1BAV A;  2VL1 A;  3DGV A;  5LYL A;  2BOA A;  2ZEE A;  4GVV A;  2JEW A;  2PJ1 A;  3N5F A;  4NGP A;  1ZG9 A;  1LAP A;  2GLF A;  4DUK A;  1CP6 A;  3FVL A;  3B35 A;  1Y0Y A;  3IC1 A;  2FVG A;  4Z65 A;  4GVW A;  4Q7A A;  3IIF A;  1RTQ A;  1SPV A;  3CT9 A;  4W9Y A;  1YW4 A;  4NGQ A;  3S9N A;  4P4J A;  2V8G A;  3FEC A;  3SJE A;  4ESS A;  2PJ2 A;  3FMC A;  2O53 A;  2POK A;  3KZW A;  4F8Z A;  2QYV A;  2NYQ A;  3FF3 A;  2PVV A;  3V38 A;  4UEZ A;  4P44 A;  4J5S A;  4D86 A;  3VAT A;  2XEJ A;  3FX6 A;  3CPX A;  3RZA A;  4G1P A;  2XEG A;  2PIZ A;  3T8W A;  4K3N A;  3CDX A;  3PBE A;  4ONW A;  3KGQ A;  4P6Y A;  2J9A A;  5K8N A;  4JVV A;  1Y0R A;  1BPN A;  4R7M A;  3PB6 X;  4A94 A;  3B3S A;  4MMO A;  3KI9 A;  1YW6 A;  4H2K A;  5LYF A;  4NJQ A;  7CPA A;  1TKF A;  2C1C A;  1ZR5 A;  1Z5R A;  5J1Q A;  5HVH A;  4PXD A;  2CTB A;  4OC1 A;  2ZED A;  3B2Y A;  3KL9 A;  2HC9 A;  3WC7 A;  5D29 A;  3D68 A;  4MCS A;  2V8D A;  2Q43 A;  1HJZ A;  1IGB A;  1XMB A;  3LMS A;  2ZEG A;  4K0C A;  5I4M A;  1LOK A;  5K8M A;  3BXM A;  4WWV A;  3HUV A;  5K8O A;  3B3W A;  3RBU A;  4KYB A;  3SI2 A;  2C6G A;  2OR4 A;  1ZR3 A;  1CPS A;  3B7I A;  2GLJ A;  4OC4 A;  3D67 A;  2PJ8 A;  3SJF A;  1TKJ A;  1TXZ A;  2HB6 A;  3B3T A;  2ACF A;  2V8H A;  3FH4 A;  1LFW A;  4TNU A;  3PFO A;  2PVW A;  1PYT B;  3EW5 A;  5CB5 A;  1F57 A;  3PB7 X;  2XEI A;  1R3N A;  4J4Z A;  3H8G A;  1ELL P;  4ETK A;  4OP4 A;  3KHZ A;  4NGT A;  4YWY A;  2DX6 A;  1AMP A;  3D7H A;  1VIX A;  4MHZ A;  4KSI A;  5AIL A;  5ELY A;  2AFM A;  2X47 A;  1AYE A;  2EK8 A;  2L8R A;  2BCO A;  3D7F A;  3FJU A; 
#chains in the Genus database with same CATH topology
 4GUA A;  2PJ7 A;  1DTD A;  3PB4 X;  4NGS A;  1QSO A;  2F8H A;  1H8L A;  4M6H A;  1AUG A;  2KCW A;  1CBX A;  3B3V A;  2RFH A;  3KR5 A;  4KOT A;  2VXK A;  2FAV A;  2CF4 A;  5JGF A;  1FT7 A;  2Q44 A;  4MFQ A;  4MHP A;  4ZY2 A;  3VFQ A;  4BIN A;  2X7B A;  5ISV A;  4ONU A;  2EBJ A;  2WPW A;  4GS4 A;  1CPX A;  4CS0 B;  4OC0 A;  1Y9K A;  5K8P A;  5LRK A;  2O4H A;  3EJG A;  2IL4 A;  2PCU A;  4F0Y A;  4ZX8 A;  3GPG A;  1M4L A;  3IIB A;  2GU2 A;  4AG9 A;  5A28 A;  2JDC A;  2RNK A;  1YME A;  3E0K A;  3UY5 A;  2Q7B A;  2GE3 A;  2Z0Z A;  3NFZ A;  3JZT A;  4MI4 A;  2ANP A;  4H6U A;  2CY2 A;  2Z3N A;  4KOS A;  3K9T A;  2IJZ A;  2CNS A;  4PQA A;  4II9 A;  1B6B A;  3GY9 A;  2Z3M A;  4CRZ B;  4QVT A;  1TY8 A;  2IMO A;  1DE4 C;  1HDU A;  2WPX A;  2JZD A;  4XPD C;  4C2Y A;  1QSM A;  3GYA A;  1XJO A;  5LRG A;  3R9G A;  1HDQ A;  3PBB A;  2WZN A;  3IGR A;  2PR1 A;  3WAB A;  3WC6 A;  5H84 A;  4BD9 A;  1U6M A;  4R57 A;  4J5R A;  4ZY1 A;  3IJ3 A;  2ZEF A;  3KHX A;  3LWU A;  5FSZ A;  1Z4R A;  4YFJ A;  8CPA A;  4O23 A;  2B3U A;  2FIW A;  2PJA A;  3D8P A;  3Q6Z A;  1R57 A;  3H4Q A;  4U5Y A;  4RN7 A;  2AFW A;  2R7H A;  5FVJ A;  4A95 A;  3LD2 A;  1Q2Y A;  2YGW A;  2EWB A;  4ZI6 A;  1CX8 A;  1P0H A;  1XRY A;  2PE3 A;  2Q7S A;  2JLM A;  2ZOG A;  1RO5 A;  2B4D A;  3FRM A;  4UCM A;  2FT0 A;  2JBJ A;  3KR4 A;  3GQE A;  3GQO A;  3EWR A;  3Q71 A;  1GHE A;  1I1D A;  2BL1 A;  4EVY A;  5KTA A;  4MHN A;  1LAN A;  1J4J A;  2AFZ A;  3F0A A;  2EUI A;  4ORF A;  2I3C A;  2QIR A;  4IAV A;  4JZ0 A;  4KSA A;  3GB0 A;  4NGN A;  4UIB A;  4R8F A;  3BLN A;  4CAX A;  2CTC A;  3SJX A;  1TF8 A;  4M85 A;  5CBM A;  2AFX A;  4HNW B;  2A4N A;  4R76 A;  5CPA A;  5LYD A;  2AE6 A;  3G8W A;  4CGN A;  2JDD A;  4LX9 A;  3DNS A;  2G0B A;  4NEX A;  1IY7 A;  5J8F A;  4CRY B;  3TCV A;  5IB9 A;  4JXR A;  3JTK A;  3D3S A;  2J8R A;  4P10 A;  5AG4 A;  2PJ9 A;  1S7L A;  2CXA A;  5D8N A;  1QST A;  3CXS A;  4JD6 A;  4PSW A;  3TE4 A;  3CXQ A;  2ZEM A;  4UIA A;  5CNP A;  5C82 A;  3R95 A;  4DJL A;  3SJG A;  3TTH A;  3WC5 A;  1Q2D A;  4X2T A;  4UEF A;  1ARL A;  1ZLH A;  2RB7 A;  4BBH A;  4GM5 A;  2D4O A;  2ZEL A;  1XBU A;  2LGR A;  2G9D A;  2R8V A;  1Z8X A;  1LAM A;  1VHE A;  1PCA A;  1GYT A;  1IOI A;  1FNO A;  1XE4 A;  4OID A;  4JGK A;  3W6X A;  4AB7 A;  1F2O A;  2V77 A;  2ZW7 A;  4P4B A;  2BFR A;  5BWA B;  3DLJ A;  2PRQ A;  3EKE A;  2ABZ A;  5FSY A;  1FY7 A;  2FS5 A;  3L2N A;  5LRJ A;  4P4I A;  3H8F A;  1Y7E A;  1MJ9 A;  1TXR A;  2B5G B;  3PGP A;  3JRU A;  5G21 A;  3I1U A;  5LYI A;  3S6H A;  2EEE A;  1BLL E;  4PXB A;  5THW A;  1S3Z A;  4RI1 A;  1QQ9 A;  3TO6 A;  3R9F A;  4P4D A;  2BUE A;  3ISZ A;  1YRE A;  2ZEN A;  5AG7 A;  2IQ6 A;  2O28 A;  2WSA A;  4UEE A;  3ZJ0 A;  2YND A;  3K2K A;  1UWY A;  1N71 A;  2JBK A;  3T90 A;  5IV0 A;  2FCK A;  4L89 A;  5G1Z A;  3KQX A;  4ZGY B;  1S5K A;  4F0X A;  1VHS A;  4TNU A;  4ZX9 A;  1XEB A;  2V8V A;  1I12 A;  1BPM A;  1X10 A;  2B4B A;  4J3G A;  2WYR A;  5EMI A;  2J8N A;  4KS9 A;  5E3B A;  1CG2 A;  3FYN A;  3IWW A;  5AG5 A;  4ZYQ A;  3BJ8 A;  4YU9 A;  1XIX A;  4AVB A;  4JYW A;  5A27 A;  4R9M A;  2I79 A;  3A9L A;  4F9U A;  2B5G A;  3IID A;  2PIY A;  3FB3 A;  4NF1 A;  5HXD A;  4TU0 A;  4OC2 A;  2AFS A;  1ARM A;  1Z9U A;  1YLE A;  1Z8L A;  2DXQ A;  2FXF A;  3P2F A;  5GCN A;  3W91 A;  3DR8 A;  4TWE A;  2ZW5 A;  4KVX A;  5CMS A;  3ZZI A;  3S6F A;  3QNV A;  2DEA A;  4K30 A;  4KSF A;  4MCQ A;  3FEE A;  2BFQ A;  1VGY A;  3JUW A;  3PB9 X;  4X3R A;  3B3C A;  2EO8 A;  2ZEP A;  2Z3K A;  5G22 A;  2PJ5 A;  1PUA A;  2P6F A;  5E96 A;  3ETI A;  3TX8 A;  4MRI A;  2QJ8 A;  4UF4 A;  3V7Z A;  3EFA A;  3FED A;  4MHD A;  2GAN A;  2GRE A;  5FSU A;  1NSA A;  4YRH A;  2PJ3 A;  2OOT A;  4A37 A;  4PK2 A;  4C7H A;  1ELM P;  4MXU A;  5CB3 A;  4AG7 A;  5JM6 A;  4CYO A;  3NA6 A;  2YNC C;  4OC5 A;  3GUX A;  3BHX A;  3F8K A;  1TKH A;  3SII A;  4QC6 A;  3SXO A;  3VWE A;  4CAE A;  1M4D A;  5FSV A;  3EWQ A;  4FD5 A;  5DUS A;  2ZEH A;  3FXT A;  3NH5 A;  1YSJ A;  3PRT A;  3IFE A;  4PXE A;  3FNC A;  2NSM A;  5JQ4 A;  1LCP A;  3SXN A;  2P6E A;  3QAH A;  1CJW A;  4FWU A;  4IHM A;  3CPA A;  3DR6 A;  4CPA A;  4RUH A;  3IO1 A;  3FIX A;  3QB8 A;  1KUX A;  1X12 A;  1ZO0 A;  2ZOF A;  4J5Q A;  5C88 A;  2P0W A;  3EWP A;  4CYN A;  3D2P A;  3VH9 A;  2JZE A;  4UML A;  3W6S A;  5IB0 A;  1YK3 A;  4MJ8 A;  4NGR A;  3V2B A;  4AVC A;  2Q51 A;  5JH9 A;  4FD7 A;  1S7N A;  4B5P A;  1JQG A;  4IQY A;  2I00 A;  3GPO A;  3DDD A;  3HLP A;  3RAM A;  3PB8 X;  4MFP A;  4C7I A;  2EVN A;  1XOV A;  5F47 A;  1MK4 A;  1I21 A;  3SHP A;  3IU1 A;  3EO4 A;  2F5I A;  4QUS A;  5G20 A;  4FUU A;  3H8E A;  4HKF A;  4KUA A;  3I3G A;  4A32 A;  2F7V A;  3LAC A;  2VRI A;  4IUS A;  4JLY A;  1UFH A;  3S6K A;  3VAR A;  5HVF A;  4FAI A;  2WCT A;  1Z2L A;  2DF5 A;  3IU2 A;  4A31 A;  3SIJ A;  1KZF A;  3EY5 A;  5HVG A;  1M1D A;  1QMU A;  4Q38 A;  4R87 A;  4UFX A;  2XD7 A;  2PJ0 A;  1XF8 A;  4M6G A;  1IU8 A;  4PXC A;  2P6G A;  1Z8W A;  1Q7L A;  4MCR A;  4F9V A;  4ABL A;  4CAW A;  2XEF A;  4BMH A;  2ZPA A;  3V45 A;  4PPZ A;  1OBR A;  2OZU A;  4I49 A;  4CGP A;  1EE3 P;  2QVP A;  5HOL A;  4ABK A;  1R43 A;  2Q4Z A;  3IWE A;  3IEH A;  1S7K A;  1WK4 A;  1ZG8 A;  1SQH A;  2AFO A;  1Q2C A;  3N7Z A;  3PFE A;  4KVM E;  2FSR A;  4NSQ A;  1ZG7 A;  3TOA A;  4JCA A;  4OC3 A;  5DS0 A;  3S9L A;  3D4U A;  4UCN A;  4WJB A;  1S60 A;  1NJR A;  5HH1 A;  4X8I A;  4UA3 A;  3EWO A;  4DYO A;  2PJ6 A;  3MN8 A;  2CIJ A;  2YNC A;  1HEE A;  2QML A;  2HV2 A;  5HIH A;  4CAF A;  3ISX A;  4EME A;  4ETJ A;  4LQG A;  2HQY A;  2VBQ A;  2NMT A;  4NGM A;  4EWT A;  4ZY0 A;  3KAS A;  4RS2 A;  3TO9 A;  3NH4 A;  2C6C A;  2RC4 A;  3NH8 A;  2AFC A;  4KOY A;  4FBE A;  2K5T A;  3BI1 A;  4A38 A;  2PSW A;  1VHO A;  3D7D A;  4OAD A;  1V0C A;  4CYP A;  6CPA A;  4P45 A;  5KTD A;  2ARH A;  5HMN A;  3PZJ A;  4A2Z A;  1KUY A;  4IK2 A;  4B6Z A;  3CZX A;  2BO9 A;  4UBR A;  3TC8 A;  4EFD A;  3GIU A;  3R1K A;  4MCP A;  3RYO A;  2ZW4 A;  3D7G A;  2EK9 A;  4CGM A;  1TF9 A;  2PJB A;  5EC4 A;  3GLJ A;  4NJR A;  4OAE A;  4R6T A;  2CNT A;  4UWJ A;  4B5P B;  1QSN A;  4LQ6 A;  4JWP A;  4A39 A;  2YNE A;  4JLL A;  2PJC A;  2PJ4 A;  4QB9 A;  3SI0 A;  2B3V A;  3R9E A;  3S9M A;  1A2Z A;  2FG1 A;  4NFR A;  4AXV A;  3MGD A;  5H86 A;  4MHY A;  2ZXV A;  4P4F A;  3EJF A;  2VEZ A;  4KLV A;  3SIG A;  4UCP A;  2FXK A;  3TO7 A;  1YR0 A;  1YD9 A;  3H5Z A;  2Z11 A;  2AFU A;  5FSX A;  4QBJ A;  3P2H A;  1YLO A;  4OKO A;  3KQZ A;  1XMT A;  3SIH A;  2ZEO A;  1IYK A;  1VHU A;  1IIC A;  1CM0 A;  3SI1 A;  3PEI A;  4Y49 B;  3TOB A;  1CP7 A;  1ZLI A;  4P4E A;  1XFO A;  4IF5 A;  4H89 A;  4XPD B;  5F09 A;  2C6P A;  4OME A;  1F2P A;  2Z3P A;  3GKR A;  2G3T A;  3PP9 A;  4FD4 A;  4ZBG A;  4NCZ A;  4MY3 A;  3RNZ A;  4CYQ A;  1KWM A;  3BI0 A;  4B13 A;  3WT4 A;  4OIW A;  3GPQ A;  3JVN A;  2Q04 A;  3MRU A;  5AG6 A;  1LRZ A;  1Z8T A;  2BEI A;  2PC1 A;  3D66 A;  4LUA A;  1BAV A;  2VL1 A;  3DGV A;  5LYL A;  2BOA A;  3C26 A;  2ZEE A;  4GVV A;  2JEW A;  2PJ1 A;  1L0C A;  3N5F A;  4NGP A;  4B10 A;  5F46 A;  3EXN A;  1ZG9 A;  1LAP A;  2GLF A;  5JPH A;  1IOF A;  4DUK A;  1CP6 A;  3FVL A;  4OLL A;  4FD6 A;  4UWI A;  4KOU A;  3B35 A;  2REE A;  4B11 A;  1QSR A;  1Y0Y A;  3IC1 A;  2Q0Y A;  4KZT A;  2FVG A;  4Z65 A;  4GVW A;  4KUB A;  3TFY A;  1Z4E A;  5DWM A;  3KKW A;  1M4G A;  3IIF A;  1MJA A;  4Q7A A;  3OWC A;  4E2A A;  1RTQ A;  1Y7R A;  1YVK A;  2FL4 A;  4MFK A;  3R96 A;  2B58 A;  1SPV A;  2Q4V A;  3CT9 A;  4W9Y A;  1YW4 A;  1IID A;  5EBV A;  2JZF A;  3BJ7 A;  4NGQ A;  3S9N A;  3G3S A;  4P4J A;  2V8G A;  3FEC A;  4MFZ A;  4GXH A;  3SJE A;  4ESS A;  2PJ2 A;  3EC4 A;  3FMC A;  2O53 A;  2POK A;  2PRB A;  3KZW A;  4E8O A;  5J8C A;  4F8Z A;  2OH1 A;  2QYV A;  2NYQ A;  4HNY B;  3FF3 A;  2DPS A;  2PVV A;  4C2Z A;  3V38 A;  4UEZ A;  4E0A A;  4P44 A;  4J5S A;  4D86 A;  4CGO A;  2ODF A;  2OZG A;  2CNM A;  2VI7 A;  4UFW A;  3VAT A;  2XEJ A;  2REF A;  3FX6 A;  3CPX A;  3RZA A;  4G1P A;  4PK3 A;  2XEG A;  2PIZ A;  3T8W A;  2D4P A;  3F5B A;  4K3N A;  3CDX A;  3PBE A;  4MY0 A;  4ONW A;  3KGQ A;  4P6Y A;  2W2G A;  4M3S A;  2J9A A;  3B8G A;  2PQ8 A;  4M6I A;  5K8N A;  4JVV A;  2DPT A;  1Y0R A;  2Z10 A;  2ZW6 A;  4B5O A;  1BPN A;  4R7M A;  3PB6 X;  4KOR A;  2KQV A;  4A94 A;  3B3S A;  3NE7 A;  1VKC A;  4MMO A;  1S7F A;  4MFL A;  2H5M A;  3KI9 A;  1YW6 A;  4H2K A;  1NMT A;  5LYF A;  2C27 A;  3IWG A;  3NE8 A;  3K9U A;  4NJQ A;  2FE7 A;  7CPA A;  1TKF A;  5IX3 A;  5DWN A;  2C1C A;  1ZR5 A;  1Y9W A;  2Q4Y A;  2QEC A;  1Z5R A;  5J1Q A;  4XNH B;  4A33 A;  2OZH A;  5HVH A;  4PV6 A;  4PXD A;  1BO4 A;  2CTB A;  4U9Z A;  5F49 A;  1KUV A;  2VZY A;  4OC1 A;  3T9Y A;  2ZED A;  2OB0 A;  3B2Y A;  3KL9 A;  3LOD A;  1NSL A;  4CAV A;  2HC9 A;  3WC7 A;  5D29 A;  3D68 A;  4HPS A;  4U9Y A;  4MCS A;  2V8D A;  2Q43 A;  2Z3O A;  1K4J A;  1HJZ A;  3D2M A;  1IGB A;  3I9S A;  1XMB A;  1TIQ A;  2R98 A;  3LMS A;  2ZEG A;  3CXP A;  4JJX A;  4K0C A;  5I4M A;  1LOK A;  5K8M A;  1YVO A;  4XPL A;  2Z3L A;  3BXM A;  4WWV A;  4X5K A;  2PDO A;  3HUV A;  5K8O A;  3B3W A;  3RBU A;  4XPK A;  2R1I A;  4KOW A;  4KYB A;  4NXY A;  3SI2 A;  4R3L A;  2GFQ A;  5AGE A;  2C6G A;  2OR4 A;  4HNX B;  1ZR3 A;  1CPS A;  4XNH C;  2B4D B;  4C68 A;  3B7I A;  3WR7 A;  2GLJ A;  1M4I A;  4OC4 A;  4B12 A;  4L8A A;  3D67 A;  2PJ8 A;  1B87 A;  3VWD A;  2Y0M A;  3SJF A;  2GIV A;  1TKJ A;  4A30 A;  1TXZ A;  2HB6 A;  3B3T A;  4H6Z A;  4MBU A;  2ACF A;  2HUZ A;  4CGL A;  1M44 A;  2V8H A;  3FH4 A;  3DSB A;  1LFW A;  1PU9 A;  2BSW A;  1YX0 A;  3PFO A;  3QAY A;  4R3K A;  2PVW A;  1PYT B;  3EW5 A;  4KOV A;  4Q36 A;  4DNC A;  5I0C A;  1YGH A;  4F6A A;  1MJB A;  1IYL A;  3V8I A;  2AJ6 A;  2VZZ A;  5CB5 A;  1BOB A;  1F57 A;  4KVO E;  1IB1 E;  3PB7 X;  3RO0 A;  2JEV A;  2XEI A;  1R3N A;  4JXQ A;  5KTC A;  2ATR A;  4J4Z A;  3H8G A;  3S6G A;  1ELL P;  4ETK A;  4OP4 A;  3KHZ A;  2G3A A;  4PSX A;  4Y49 C;  5F48 A;  4B14 A;  1JWQ A;  4NGT A;  4YWY A;  2DX6 A;  2J8M A;  4KLW A;  1AMP A;  3D7H A;  1OZP A;  1NE9 A;  2VQY A;  4MFJ A;  3TT2 A;  1VIX A;  4AVA A;  2WUU A;  4YGO A;  4MHZ A;  2PR8 A;  2BCO A;  1YQE A;  2OU2 A;  4KSI A;  5AIL A;  5ELY A;  2AFM A;  2X47 A;  1ON0 A;  1AYE A;  1WWZ A;  4UFV A;  4C2X A;  3FBU A;  2EK8 A;  1P4N A;  4KOX A;  2L8R A;  1RXT A;  3D7F A;  2FIA A;  3FJU A; 
#chains in the Genus database with same CATH homology
 4GUA A;  2PJ7 A;  1DTD A;  3PB4 X;  4NGS A;  2F8H A;  1H8L A;  1CBX A;  3B3V A;  2RFH A;  3KR5 A;  2FAV A;  2CF4 A;  5JGF A;  1FT7 A;  4MHP A;  4ZY2 A;  3VFQ A;  1CPX A;  5LRK A;  4OC0 A;  5K8P A;  2O4H A;  3EJG A;  2PCU A;  4ZX8 A;  3GPG A;  1M4L A;  3IIB A;  2GU2 A;  1YME A;  3NFZ A;  3JZT A;  2ANP A;  3K9T A;  2IJZ A;  4PQA A;  1TY8 A;  2IMO A;  1DE4 C;  1HDU A;  1XJO A;  5LRG A;  1HDQ A;  3PBB A;  2WZN A;  3WAB A;  3WC6 A;  4BD9 A;  4J5R A;  4ZY1 A;  3IJ3 A;  2ZEF A;  3KHX A;  3LWU A;  5FSZ A;  8CPA A;  4O23 A;  2PJA A;  3Q6Z A;  2AFW A;  2EWB A;  4ZI6 A;  1CX8 A;  1XRY A;  2PE3 A;  2ZOG A;  3QNV A;  2JBJ A;  3KR4 A;  3GQE A;  3GQO A;  3EWR A;  3Q71 A;  4MHN A;  1LAN A;  2AFZ A;  2I3C A;  4IAV A;  4JZ0 A;  3GB0 A;  4NGN A;  4UIB A;  4R8F A;  2CTC A;  3SJX A;  1TF8 A;  5CBM A;  2AFX A;  5LYD A;  5CPA A;  4R76 A;  1IY7 A;  5IB9 A;  4P10 A;  2PJ9 A;  5D8N A;  2ZEM A;  4UIA A;  4DJL A;  3SJG A;  3WC5 A;  4X2T A;  4UEF A;  1ARL A;  1ZLH A;  2RB7 A;  4GM5 A;  2ZEL A;  1XBU A;  2LGR A;  2G9D A;  1LAM A;  1PCA A;  1GYT A;  1VHE A;  1FNO A;  4OID A;  4JGK A;  1F2O A;  2V77 A;  4P4B A;  2BFR A;  3DLJ A;  2PRQ A;  3EKE A;  2ABZ A;  5FSY A;  3L2N A;  5LRJ A;  4P4I A;  3H8F A;  1Y7E A;  5LYI A;  1TXR A;  3JRU A;  3I1U A;  2EEE A;  1BLL E;  4PXB A;  5THW A;  1QQ9 A;  4P4D A;  3ISZ A;  2ZEN A;  2IQ6 A;  4UEE A;  3K2K A;  1UWY A;  2JBK A;  3KQX A;  4ZX9 A;  2V8V A;  1BPM A;  2WYR A;  5E3B A;  1CG2 A;  3IWW A;  4ZYQ A;  4YU9 A;  4JYW A;  4F9U A;  3IID A;  2PIY A;  5HXD A;  4TU0 A;  4OC2 A;  2AFS A;  1ARM A;  1Z8L A;  4TWE A;  5CMS A;  2DEA A;  4MCQ A;  3FEE A;  2BFQ A;  1VGY A;  4X3R A;  3PB9 X;  3B3C A;  2ZEP A;  2PJ5 A;  3ETI A;  3TX8 A;  4MRI A;  2QJ8 A;  4UF4 A;  3V7Z A;  3FED A;  2GRE A;  5FSU A;  1NSA A;  2PJ3 A;  2OOT A;  4A37 A;  5JM6 A;  1ELM P;  4MXU A;  5CB3 A;  3NA6 A;  4OC5 A;  3GUX A;  3BHX A;  1TKH A;  3SII A;  5FSV A;  3EWQ A;  5DUS A;  2ZEH A;  3NH5 A;  3PRT A;  1YSJ A;  3IFE A;  4PXE A;  2NSM A;  1LCP A;  4FWU A;  4IHM A;  4CPA A;  3CPA A;  4RUH A;  3IO1 A;  2ZOF A;  4J5Q A;  3EWP A;  3VH9 A;  4UML A;  4NGR A;  3V2B A;  5JH9 A;  2Q51 A;  1JQG A;  4IQY A;  3GPO A;  3HLP A;  3RAM A;  3PB8 X;  4FUU A;  3H8E A;  2F7V A;  4FAI A;  2VRI A;  3VAR A;  5HVF A;  1Z2L A;  3SIJ A;  5HVG A;  1QMU A;  2XD7 A;  2PJ0 A;  4PXC A;  4MCR A;  1Q7L A;  4F9V A;  4ABL A;  2XEF A;  3V45 A;  4PPZ A;  1OBR A;  1EE3 P;  2QVP A;  5HOL A;  4ABK A;  1R43 A;  2Q4Z A;  3IEH A;  1ZG8 A;  2AFO A;  3PFE A;  1ZG7 A;  4JCA A;  4OC3 A;  5DS0 A;  3S9L A;  3D4U A;  4WJB A;  1NJR A;  4X8I A;  3EWO A;  4DYO A;  2PJ6 A;  3MN8 A;  2CIJ A;  1HEE A;  5HIH A;  3ISX A;  4EME A;  4ETJ A;  4LQG A;  4NGM A;  4EWT A;  4ZY0 A;  3KAS A;  3NH4 A;  2C6C A;  3NH8 A;  2AFC A;  4FBE A;  3BI1 A;  4A38 A;  1VHO A;  3D7D A;  6CPA A;  4P45 A;  4IK2 A;  4B6Z A;  2BO9 A;  3TC8 A;  4EFD A;  4MCP A;  3D7G A;  2EK9 A;  1TF9 A;  2PJB A;  3GLJ A;  4NJR A;  4R6T A;  4A39 A;  4JLL A;  2PJC A;  2PJ4 A;  3SI0 A;  3S9M A;  2FG1 A;  4NFR A;  4AXV A;  4MHY A;  4P4F A;  3EJF A;  3SIG A;  2FXK A;  1YD9 A;  2AFU A;  5FSX A;  1YLO A;  4OKO A;  3KQZ A;  3SIH A;  2ZEO A;  1VHU A;  3SI1 A;  3PEI A;  1CP7 A;  1ZLI A;  4P4E A;  1XFO A;  5F09 A;  2C6P A;  4OME A;  1F2P A;  1KWM A;  3BI0 A;  3WT4 A;  4OIW A;  3GPQ A;  3MRU A;  3D66 A;  1BAV A;  2VL1 A;  3DGV A;  5LYL A;  2BOA A;  2ZEE A;  4GVV A;  2JEW A;  2PJ1 A;  3N5F A;  4NGP A;  1ZG9 A;  1LAP A;  2GLF A;  4DUK A;  1CP6 A;  3FVL A;  3B35 A;  1Y0Y A;  3IC1 A;  2FVG A;  4Z65 A;  4GVW A;  4Q7A A;  3IIF A;  1RTQ A;  1SPV A;  3CT9 A;  4W9Y A;  1YW4 A;  4NGQ A;  3S9N A;  4P4J A;  2V8G A;  3FEC A;  3SJE A;  4ESS A;  2PJ2 A;  3FMC A;  2O53 A;  2POK A;  3KZW A;  4F8Z A;  2QYV A;  2NYQ A;  3FF3 A;  2PVV A;  3V38 A;  4UEZ A;  4P44 A;  4J5S A;  4D86 A;  3VAT A;  2XEJ A;  3FX6 A;  3CPX A;  3RZA A;  4G1P A;  2XEG A;  2PIZ A;  3T8W A;  4K3N A;  3CDX A;  3PBE A;  4ONW A;  3KGQ A;  4P6Y A;  2J9A A;  5K8N A;  4JVV A;  1Y0R A;  1BPN A;  4R7M A;  3PB6 X;  4A94 A;  3B3S A;  4MMO A;  3KI9 A;  1YW6 A;  4H2K A;  5LYF A;  4NJQ A;  7CPA A;  1TKF A;  2C1C A;  1ZR5 A;  1Z5R A;  5J1Q A;  5HVH A;  4PXD A;  2CTB A;  4OC1 A;  2ZED A;  3B2Y A;  3KL9 A;  2HC9 A;  3WC7 A;  5D29 A;  3D68 A;  4MCS A;  2V8D A;  2Q43 A;  1HJZ A;  1IGB A;  1XMB A;  3LMS A;  2ZEG A;  4K0C A;  5I4M A;  1LOK A;  5K8M A;  3BXM A;  4WWV A;  3HUV A;  5K8O A;  3B3W A;  3RBU A;  4KYB A;  3SI2 A;  2C6G A;  2OR4 A;  1ZR3 A;  1CPS A;  3B7I A;  2GLJ A;  4OC4 A;  3D67 A;  2PJ8 A;  3SJF A;  1TKJ A;  1TXZ A;  2HB6 A;  3B3T A;  2ACF A;  2V8H A;  3FH4 A;  1LFW A;  4TNU A;  3PFO A;  2PVW A;  1PYT B;  3EW5 A;  5CB5 A;  1F57 A;  3PB7 X;  2XEI A;  1R3N A;  4J4Z A;  3H8G A;  1ELL P;  4ETK A;  4OP4 A;  3KHZ A;  4NGT A;  4YWY A;  2DX6 A;  1AMP A;  3D7H A;  1VIX A;  4MHZ A;  4KSI A;  5AIL A;  5ELY A;  2AFM A;  2X47 A;  1AYE A;  2EK8 A;  2L8R A;  2BCO A;  3D7F A;  3FJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...