3KR4A

Structure of a protease 3
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr4A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr4A02
2LGRA 2JEWA 2ZEPA 4CPAA 1CX8A 4J5RA 4DUKA 3SJFA 1NJRA 2PJ7A 4Z65A 1VHUA 2AFCA 1GYTA 1XJOA 5AILA 4ETKA 4F9VA 1LFWA 1Y0RA 3EW5A 3TX8A 4RUHA 1FNOA 4J4ZA 2Q4ZA 3KGQA 4BD9A 4P4EA 3SIGA 4P4DA 5LYDA 3GPQA 4F8ZA 2ZEOA 4MCQA 3CDXA 5JM6A 2CTBA 1YLOA 3PBBA 1HDQA 3NH5A 1XMBA 2WZNA 2EEEA 2PJCA 1ZR5A 3H8FA 4OMEA 1AMPA 4TU0A 1H8LA 3WT4A 2EK8A 3D7FA 3B3CA 4MMOA 1VIXA 5CB3A 3BI1A 3PB6X 8CPAA 3PEIA 3PBEA 1ARLA 1IGBA 1TXZA 4JLLA 1TKJA 1SPVA 4JYWA 3GPOA 1ZR3A 2PJ6A 2GU2A 2NYQA 2XEIA 5D29A 4R76A 1CP7A 1YW4A 2PIZA 7CPAA 3CPAA 5K8PA 2PJAA 3HLPA 3D68A 3D67A 3NFZA 2I3CA 1Z8LA 2PJ4A 4NGPA 5J1QA 4NGNA 3Q6ZA 1CPSA 1TF8A 2F7VA 1LANA 1TY8A 3VFQA 1KWMA 4UEZA 3V2BA 1ZG8A 1YD9A 2AFWA 4ZI6A 1CPXA 3HUVA 1CBXA 3SJXA 4ZY1A 1LAMA 3JZTA 3ISZA 3D7DA 3S9LA 4TWEA 3KQXA 2QJ8A 4R8FA 4NGSA 4NGMA 1ZG7A 3H8EA 4NJRA 5HOLA 1XFOA 3FVLA 1Z2LA 2F8HA 5FSYA 5DUSA 1PCAA 3EKEA 4F9UA 1BPMA 1IY7A 4P6YA 3WC5A 5LRGA 4W9YA 4P4BA 4MHZA 3RAMA 2VRIA 3FJUA 4WJBA 3N5FA 4OIDA 2AFSA 2ZEDA 6CPAA 2FAVA 4ABLA 3IC1A 4ZX8A 4IQYA 2BO9A 3MN8A 3TC8A 3SJGA 2HC9A 1QMUA 3DLJA 1DE4C 1QQ9A 2XD7A 3SI1A 3VARA 2PJ9A 4P44A 2BCOA 3IEHA 3K9TA 3KQZA 4FWUA 1VHEA 2POKA 2PJ2A 3Q71A 3DGVA 4YWYA 3ETIA 1AYEA 3IIBA 4NJQA 3FMCA 4O23A 4FAIA 2AFZA 1CP6A 2NSMA 3WC6A 2XEGA 2PE3A 5CPAA 3IIDA 1F2PA 1BAVA 3VATA 3S9NA 4IK2A 2AFXA 4J5SA 4PQAA 3VH9A 1BLLE 5DS0A 2CTCA 2FXKA 2ANPA 3B3SA 4ZYQA 1RTQA 5ELYA 4IHMA 4MCPA 2IJZA 2PJ3A 2PRQA 5HVGA 4DJLA 4NGRA 3PB4X 2IQ6A 4P45A 1UWYA 3KR4A 1LOKA 3SIJA 4D86A 1TKHA 4Q7AA 3B2YA 2EWBA 3PFEA 4P10A 1VGYA 5I4MA 1EE3P 2GLJA 1TKFA 4OIWA 2BFRA 4GVVA 4K0CA 3CT9A 2ZOFA 4MHNA 4AXVA 3B3WA 4P4FA 4A94A 3GB0A 1XRYA 4PXEA 4P4IA 2BOAA 2GREA 4JVVA 2Q43A 3IFEA 2AFMA 4JCAA 5LYLA 3B35A 4DYOA 1M4LA 4NFRA 3RZAA 4ESSA 5FSVA 2FVGA 4ZY0A 4EFDA 3FECA 2L8RA 1Z5RA 2PVWA 2XEFA 3SI2A 2HB6A 3KHXA 4B6ZA 1ELLP 2Q51A 3T8WA 4A39A 3PRTA 3PFOA 3FEDA 4MCRA 2PVVA 4MXUA 1ZG9A 3GQEA 4GVWA 3B7IA 4H2KA 3KR5A 4OC2A 5JH9A 4ONWA 1YW6A 4OC5A 3LMSA 3GUXA 1HEEA 2ZELA 4A37A 4GM5A 5K8MA 2CF4A 2C6PA 1ZLHA 5LRKA 1PYTB 3RBUA 2ZEMA 1YMEA 3I1UA 4OC3A 2WYRA 4PXCA 4PPZA 5HVHA 3IO1A 5F09A 5IB9A 4JZ0A 4FUUA 3GPGA 2C1CA 3KASA 5LYIA 2RB7A 4UIAA 2OOTA 2PCUA 5CB5A 4ETJA 5HVFA 4OP4A 4J5QA 1OBRA 2DX6A 3PB7X 2O4HA 4PXDA 3FX6A 3B3TA 5HXDA 5LRJA 2V8HA 2ZEGA 3IIFA 4G1PA 3CPXA 5LYFA 5K8NA 4NGTA 1F2OA 3V45A 3KI9A 2ZEFA 4OC0A 2VL1A 3D66A 2JBJA 2G9DA 4P4JA 3S9MA 2EK9A 4EMEA 1FT7A 3FEEA 3SIHA 2X47A 3V7ZA 3FF3A 2AFUA 4ZX9A 3GQOA 5D8NA 3NH8A 4GUAA 1LCPA 1TF9A 2RFHA 3KZWA 1VHOA 4PXBA 1R3NA 1ELMP 3EWQA 2FG1A 3EWRA 3EJFA 2ZENA 3NA6A 5JGFA 4OC1A 4YU9A 3V38A 4A38A 2DEAA 5CMSA 3LWUA 4UEEA 2PIYA 3WC7A 2QYVA 4UF4A 3JRUA 3K2KA 3BXMA 3KHZA 4UEFA 1Y0YA 4FBEA 1XBUA 4OC4A 4R7MA 2PJ0A 1F57A 1HDUA 2CIJA 3SI0A 3SJEA 1BPNA 3L2NA 3EWPA 2J9AA 2C6GA 3BHXA 3BI0A 3QNVA 3D4UA 1NSAA 4OKOA 2ABZA 3IWWA 3H8GA 4X8IA 2V8GA 3EWOA 2IMOA 2GLFA 2C6CA 3D7HA 5FSZA 2ZEEA 1HJZA 2BFQA 3FH4A 2ZEHA 4X3RA 4X2TA 2V77A 1YSJA 1ARMA 3MRUA 2PJ1A 4NGQA 1CG2A 4MCSA 5FSXA 1JQGA 4R6TA 4K3NA 5E3BA 1DTDA 2V8VA 5CBMA 2ZOGA 4ZY2A 4JGKA 4WWVA 2AFOA 4MHPA 5K8OA 2OR4A 1Y7EA 5HIHA 1R43A 3D7GA 1Q7LA 2PJ8A 2PJBA 3WABA 4KYBA 4IAVA 4ABKA 4LQGA 2PJ5A 3PB9X 3GLJA 2V8DA 3EJGA 3PB8X 2ACFA 5FSUA 4MHYA 1TXRA 3IJ3A 5THWA 4UMLA 1LAPA 2XEJA 4MRIA 2JBKA 2QVPA 4UIBA 1ZLIA 2O53A 3KL9A 4TNUA 3ISXA 3SIIA 4EWTA 3NH4A 3B3VA 4KSIA
chains in the Genus database with same CATH superfamily
2LGRA 2R98A 1Z8XA 2JEWA 4XPKA 4MFPA 4KVOE 2ZEPA 3NE8A 1CX8A 4CPAA 4J5RA 4X5KA 2JLMA 5EC4A 3TE4A 5IB0A 2ATRA 4DUKA 3SJFA 1NJRA 2PJ7A 3FYNA 4Z65A 1VHUA 2AFCA 1GYTA 3JVNA 1XJOA 5AILA 4ETKA 4LUAA 4R9MA 4F9VA 1LFWA 1Y0RA 3EW5A 3E0KA 2J8NA 2FCKA 3TX8A 4RUHA 3B8GA 2Z11A 4AB7A 4KOXA 1FNOA 3I3GA 4KSAA 3CZXA 2OZGA 4C68A 4J4ZA 1XF8A 2Q4ZA 4MFLA 3KGQA 4BD9A 3EO4A 5HH1A 4P4EA 3SIGA 4P4DA 4U5YA 5ISVA 4BMHA 5LYDA 3IU1A 3GPQA 4A31A 4AG7A 2ZEOA 4MCQA 3CDXA 5AG6A 4CGMA 4F8ZA 3F0AA 5F46A 5JM6A 2CTBA 1YLOA 1QSRA 1HDQA 3PBBA 3NH5A 5H84A 1XMBA 4CGNA 4HNWB 2WZNA 2EEEA 2PJCA 1A2ZA 1ZR5A 2B4DA 1ZO0A 3H8FA 3QAYA 2RNKA 4KVXA 4OMEA 2B58A 3W6XA 4CAXA 1AMPA 4TU0A 1H8LA 3WT4A 4YRHA 2R1IA 2EK8A 4CAVA 1Z4RA 3B3CA 3D7FA 1Y9WA 3S6KA 4MMOA 2PQ8A 1VIXA 4KUAA 5CB3A 2I79A 3BI1A 3PB6X 1N71A 8CPAA 3V8IA 1M4DA 3PEIA 4AG9A 3PBEA 1V0CA 2OH1A 1ARLA 1IGBA 2VZYA 1TXZA 1IOIA 4JLLA 3W91A 1Q2DA 1TKJA 4A32A 1SPVA 1XE4A 4JYWA 3GPOA 1ON0A 4CYQA 4H6UA 4ONUA 3TTHA 4MY3A 1ZR3A 2PJ6A 2BSWA 4QB9A 4KORA 2GU2A 2B3UA 4QVTA 1K4JA 4UCPA 2NYQA 2XEIA 5D29A 3KKWA 4FD4A 4R76A 3CXQA 1CP7A 4KVME 1YW4A 2PIZA 7CPAA 3CPAA 5K8PA 5KTCA 4H6ZA 2PJAA 2JDCA 3D68A 3HLPA 3D67A 3IGRA 1JWQA 3NFZA 3PP9A 2I3CA 1Z8LA 2Q0YA 5G1ZA 1Q2CA 2PJ4A 4NGPA 4OLLA 5J1QA 2A4NA 4NGNA 3Q6ZA 1CPSA 1TF8A 2F7VA 1LANA 1TY8A 3VFQA 1KWMA 4R57A 4UEZA 2Z3NA 4FD6A 3V2BA 1ZG8A 3D2PA 2Z3KA 1QSMA 2DPTA 2G3AA 1YD9A 4UFWA 2AFWA 2JEVA 4ZI6A 3C26A 1CPXA 3HUVA 1CBXA 3SJXA 4XPDC 3VWEA 4ZY1A 5HMNA 1IYLA 2P6EA 4CGOA 1LAMA 1Z4EA 3JZTA 3ISZA 3R95A 3DDDA 3SHPA 3TO6A 2WUUA 4HKFA 4Q38A 4B5PA 3D7DA 3P2FA 4TWEA 5A28A 3S9LA 2CNTA 2ZXVA 3KQXA 1IIDA 2QJ8A 4R8FA 4NGSA 4NGMA 1ZG7A 5F49A 3H8EA 4NJRA 5HOLA 1XFOA 3FVLA 4JXRA 3R9EA 3LD2A 1Z2LA 2F8HA 5FSYA 1WWZA 4K30A 4F6AA 5DUSA 1PCAA 3EKEA 4FD5A 4CYNA 4AVCA 1NSLA 4F9UA 5J8FA 1BPMA 1IY7A 4P6YA 4M6HA 3WC5A 4C2ZA 1CJWA 5JQ4A 4QUSA 2Q7SA 3NE7A 1IYKA 3EY5A 5LRGA 4W9YA 4P4BA 3IWEA 4MHZA 2REEA 4UBRA 3RAMA 3VWDA 2ZW7A 2VRIA 3CXPA 2Q4YA 3FJUA 4WJBA 3N5FA 4OIDA 1X10A 2AFSA 5BWAB 4MFJA 1KUVA 2ZEDA 6CPAA 2FAVA 4U9YA 4ABLA 3IC1A 4IF5A 3EFAA 4ZX8A 4IQYA 1S7LA 2BO9A 4L89A 2VI7A 3MN8A 3TC8A 3SJGA 2HC9A 3D2MA 1QMUA 3DLJA 4CS0B 1DE4C 1QQ9A 2XD7A 3SI1A 2O28A 2PJ9A 3VARA 4R87A 4P44A 5J8CA 3D8PA 3I9SA 1CM0A 2CY2A 1NMTA 3T90A 2DPSA 2CXAA 1XOVA 2BCOA 3LACA 1BOBA 1PU9A 2JDDA 2REFA 1IB1E 3DR6A 3H5ZA 4UWIA 4AVAA 3CXSA 4CAEA 4KOYA 3IEHA 5DWMA 4UCMA 3F8KA 3K9TA 3S6FA 1M44A 4CGPA 3KQZA 4FWUA 4QBJA 1VHEA 2POKA 3PZJA 1VKCA 2QECA 4II9A 1YVOA 2PJ2A 3Q71A 1XEBA 2EUIA 3DGVA 4YWYA 4AVBA 2WSAA 3TFYA 3ETIA 1AYEA 3IIBA 4NJQA 3FMCA 3JUWA 4O23A 4C7HA 4FAIA 2AFZA 2Y0MA 1CP6A 2NSMA 3W6SA 3WC6A 2XEGA 2PE3A 2FSRA 4MY0A 4NEXA 3FXTA 3IIDA 5CPAA 3K9UA 1Y9KA 1F2PA 1BAVA 3VATA 3S9NA 1S7FA 1IU8A 4IK2A 2AFXA 3GKRA 4J5SA 3PGPA 2Q04A 4B5OA 3TCVA 4PQAA 3VH9A 1BLLE 1Q2YA 2H5MA 4MJ8A 1KZFA 4MFQA 1YQEA 5DS0A 2CTCA 2FXKA 2QMLA 2ANPA 1I21A 1PUAA 2PRBA 3B3SA 4ZYQA 4KOTA 4KSFA 1RTQA 4UA3A 5ELYA 4IHMA 4MCPA 4B13A 2IJZA 2IL4A 2PJ3A 4E0AA 2PRQA 4B14A 5HVGA 4DJLA 4NGRA 2JZDA 3PB4X 1X12A 3JTKA 1TIQA 2IQ6A 3DR8A 4P45A 1U6MA 1UWYA 1XMTA 3KR4A 1LOKA 3SIJA 2FIWA 4D86A 2FL4A 2I00A 2Q44A 1TKHA 1QSTA 4Q7AA 2Z3MA 3B2YA 2EWBA 2F5IA 3PFEA 4P10A 1VGYA 2ZW6A 4OADA 5I4MA 1YGHA 4HNXB 1EE3P 2GLJA 3H4QA 3SXOA 3UY5A 1TKFA 2ODFA 4RN7A 4A30A 2JZEA 2FIAA 2WPXA 4UFVA 4OIWA 2BFRA 4PK2A 4GVVA 4K0CA 4L8AA 3CT9A 2ZOFA 3GYAA 4MHNA 4AXVA 3B3WA 4P4FA 4A94A 3GB0A 1XRYA 1GHEA 1NE9A 2VQYA 4HPSA 5G21A 3R9FA 4PV6A 4PXEA 4P4IA 5F48A 2BOAA 2GREA 4JVVA 2YNDA 3FNCA 2Q43A 3IFEA 2AFMA 2EVNA 4R3KA 1L0CA 5IV0A 4JCAA 3P2HA 1IOFA 3S6HA 4KS9A 5LYLA 4KLVA 4Q36A 3B35A 2GANA 2HUZA 2R7HA 1M4LA 2QIRA 2B4DB 3GY9A 3S6GA 4NFRA 3RZAA 2EBJA 4R3LA 1YREA 4ESSA 5FSVA 2GFQA 2FVGA 2Z3OA 4ZY0A 4EFDA 5KTAA 1M4IA 4MBUA 3R96A 1VHSA 3FECA 3TOAA 4PSWA 2L8RA 1Z5RA 2K5TA 2PVWA 2BL1A 4H89A 4UFXA 2Q4VA 2XEFA 3SI2A 2YNCC 2P0WA 4YFJA 3G3SA 2HB6A 3KHXA 4B6ZA 1ELLP 1WK4A 2Q51A 2VBQA 4KOVA 4NCZA 4UWJA 3TO9A 3T8WA 3SXNA 2WPWA 2DF5A 4A39A 3FBUA 3PRTA 2X7BA 2ARHA 3PFOA 3FEDA 4MCRA 5AG5A 1QSOA 1SQHA 2PVVA 3R1KA 4MXUA 1ZG9A 3GQEA 1Z8WA 4CAFA 4GVWA 4E2AA 3B7IA 4H2KA 4KUBA 2ZPAA 3KR5A 5E96A 4KLWA 4OC2A 4ONWA 5DWNA 5JH9A 1YW6A 2KCWA 2Z0ZA 4OC5A 3LMSA 3GUXA 1HEEA 2ZELA 1MK4A 4A37A 4GM5A 3WR7A 1B6BA 5K8MA 5C88A 2CF4A 4MI4A 1AUGA 3DSBA 4XNHB 4F0XA 1P4NA 1ZLHA 2C6PA 1Z8TA 4B12A 1PYTB 5LRKA 1KUYA 3RBUA 2ZEMA 1S5KA 4A95A 1YMEA 3I1UA 4OC3A 4QC6A 4JWPA 2WYRA 4PXCA 4Y49B 4KOSA 4PPZA 1OZPA 1Z9UA 3BJ7A 1FY7A 5HVHA 3IO1A 5F09A 5IB9A 4FD7A 4GXHA 4FUUA 4JZ0A 3EC4A 3GPGA 2C1CA 3KASA 4MFKA 4U9ZA 5LYIA 5IX3A 2C27A 2RB7A 4UIAA 2OOTA 2PCUA 5FVJA 5CB5A 1I1DA 4B5PB 4ETJA 5HVFA 2B5GB 1YLEA 4OP4A 5GCNA 2OU2A 1QSNA 4J5QA 3T9YA 1OBRA 1MJAA 2AE6A 1RO5A 4EVYA 2DX6A 2VEZA 2D4OA 4PSXA 3PB7X 2PDOA 2WCTA 3A9LA 2FE7A 2O4HA 1KUXA 2OZHA 4PXDA 3FX6A 2GE3A 3B3TA 1MJBA 4NSQA 5HXDA 2NMTA 2Z3PA 3R9GA 4CYPA 5LRJA 2V8HA 2ZEGA 3IIFA 4G1PA 4ZBGA 3CPXA 4B10A 5LYFA 1S3ZA 1J4JA 5K8NA 3RYOA 4NGTA 3F5BA 4JD6A 4HNYB 1F2OA 4M6GA 3TT2A 3ZZIA 3V45A 2CNSA 3N7ZA 4C7IA 4LX9A 1YVKA 3KI9A 2ZEFA 2CNMA 4I49A 4OC0A 2J8RA 2VL1A 3D66A 2JBJA 2G9DA 4P4JA 3S9MA 2EK9A 4EMEA 1P0HA 1FT7A 3FEEA 3FRMA 2VXKA 4B11A 2HV2A 3SIHA 2X47A 3V7ZA 5AG7A 2ZW4A 2J8MA 2PR1A 3FF3A 1RXTA 2AFUA 2VZZA 4ZX9A 3GQOA 2PC1A 5D8NA 2G0BA 3NH8A 2B3VA 3GIUA 4GUAA 1LCPA 4RS2A 3BJ8A 1TF9A 2RFHA 3KZWA 1VHOA 4PXBA 1R3NA 1ELMP 3EWQA 2FG1A 3EWRA 3LODA 3EJFA 4E8OA 2ZENA 2Q7BA 4CRYB 3NA6A 4A2ZA 3ZJ0A 3G8WA 3IU2A 4OC1A 4YU9A 3RO0A 5JGFA 3V38A 3TOBA 2FT0A 4A38A 4MHDA 2DEAA 5CMSA 3LWUA 2GIVA 4UEEA 4A33A 1S60A 2EO8A 2HQYA 2PIYA 3MGDA 3WC7A 2QYVA 4UF4A 4CRZB 3JRUA 4UCNA 1YX0A 3K2KA 2ZW5A 2RC4A 4NF1A 1Y7RA 3BXMA 3KHZA 4UEFA 1Y0YA 3QAHA 2OB0A 2Z10A 4MFZA 4C2YA 3RNZA 4FBEA 1XBUA 2FXFA 4GS4A 4OC4A 4YGOA 4R7MA 2PJ0A 2D4PA 4KZTA 4BBHA 1F57A 4PK3A 4NXYA 2AJ6A 1HDUA 2PR8A 2Z3LA 2CIJA 3SI0A 3SJEA 1I12A 1BPNA 3L2NA 3DNSA 4JJXA 4ZGYB 3EWPA 2J9AA 3TO7A 2C6GA 3BHXA 3BI0A 4JXQA 3QNVA 1UFHA 3D4UA 2FS5A 1NSAA 4OKOA 4RI1A 4XNHC 5H86A 2ABZA 2YNCA 3IWWA 3H8GA 2G3TA 4CAWA 5A27A 4X8IA 2JZFA 2R8VA 1B87A 1YR0A 1IICA 3EWOA 2IMOA 2GLFA 2C6CA 2V8GA 3D7HA 4M3SA 5FSZA 2ZEEA 1HJZA 2BFQA 3FH4A 3QB8A 4XPLA 4F0YA 4Y49C 2ZEHA 2PSWA 4X3RA 4X2TA 4OAEA 4CYOA 1S7NA 2V77A 4M6IA 4ORFA 1YSJA 1ARMA 5CNPA 3MRUA 2PJ1A 5AG4A 4NGQA 1CG2A 2W2GA 1XIXA 2B4BA 5FSXA 4KOUA 1JQGA 4MCSA 4R6TA 4K3NA 5E3BA 1DTDA 3IWGA 2V8VA 5CBMA 2ZOGA 4ZY2A 5G22A 1MJ9A 4JGKA 2B5GA 4WWVA 5F47A 5JPHA 2YGWA 2AFOA 2BEIA 4MHPA 5K8OA 2OR4A 1Y7EA 5HIHA 1YK3A 1R43A 3FIXA 2YNEA 3D7GA 2P6GA 1Q7LA 2PJ8A 4CGLA 2PJBA 3WABA 3FB3A 4KYBA 2BUEA 1M4GA 3BLNA 4IAVA 4C2XA 4ABKA 4DYOA 4LQGA 2PJ5A 5EBVA 3PB9X 3GLJA 4IUSA 2V8DA 4LQ6A 3EJGA 3PB8X 5G20A 2ACFA 5FSUA 4MHYA 3D3SA 1R57A 1TXRA 3IJ3A 1LRZA 4UMLA 5THWA 5C82A 1LAPA 4DNCA 1S7KA 5EMIA 1BO4A 2XEJA 4J3GA 3OWCA 4MRIA 4BINA 2OZUA 2JBKA 2QVPA 4XPDB 4KOWA 4UIBA 2KQVA 1ZLIA 2O53A 3KL9A 4TNUA 2DXQA 2P6FA 5AGEA 3ISXA 3SIIA 5I0CA 4EWTA 4JLYA 3EXNA 3NH4A 5KTDA 4M85A 3B3VA 1M1DA 4KSIA
chains in the Genus database with same CATH topology
2LGRA 2JEWA 2ZEPA 4CPAA 1CX8A 4J5RA 4DUKA 3SJFA 1NJRA 2PJ7A 4Z65A 1VHUA 2AFCA 1GYTA 1XJOA 5AILA 4ETKA 4F9VA 1LFWA 1Y0RA 3EW5A 3TX8A 4RUHA 1FNOA 4J4ZA 2Q4ZA 3KGQA 4BD9A 4P4EA 3SIGA 4P4DA 5LYDA 3GPQA 4F8ZA 2ZEOA 4MCQA 3CDXA 5JM6A 2CTBA 1YLOA 3PBBA 1HDQA 3NH5A 1XMBA 2WZNA 2EEEA 2PJCA 1ZR5A 3H8FA 4OMEA 1AMPA 4TU0A 1H8LA 3WT4A 2EK8A 3D7FA 3B3CA 4MMOA 1VIXA 5CB3A 3BI1A 3PB6X 8CPAA 3PEIA 3PBEA 1ARLA 1IGBA 1TXZA 4JLLA 1TKJA 1SPVA 4JYWA 3GPOA 1ZR3A 2PJ6A 2GU2A 2NYQA 2XEIA 5D29A 4R76A 1CP7A 1YW4A 2PIZA 7CPAA 3CPAA 5K8PA 2PJAA 3HLPA 3D68A 3D67A 3NFZA 2I3CA 1Z8LA 2PJ4A 4NGPA 5J1QA 4NGNA 3Q6ZA 1CPSA 1TF8A 2F7VA 1LANA 1TY8A 3VFQA 1KWMA 4UEZA 3V2BA 1ZG8A 1YD9A 2AFWA 4ZI6A 1CPXA 3HUVA 1CBXA 3SJXA 4ZY1A 1LAMA 3JZTA 3ISZA 3D7DA 3S9LA 4TWEA 3KQXA 2QJ8A 4R8FA 4NGSA 4NGMA 1ZG7A 3H8EA 4NJRA 5HOLA 1XFOA 3FVLA 1Z2LA 2F8HA 5FSYA 5DUSA 1PCAA 3EKEA 4F9UA 1BPMA 1IY7A 4P6YA 3WC5A 5LRGA 4W9YA 4P4BA 4MHZA 3RAMA 2VRIA 3FJUA 4WJBA 3N5FA 4OIDA 2AFSA 2ZEDA 6CPAA 2FAVA 4ABLA 3IC1A 4ZX8A 4IQYA 2BO9A 3MN8A 3TC8A 3SJGA 2HC9A 1QMUA 3DLJA 1DE4C 1QQ9A 2XD7A 3SI1A 3VARA 2PJ9A 4P44A 2BCOA 3IEHA 3K9TA 3KQZA 4FWUA 1VHEA 2POKA 2PJ2A 3Q71A 3DGVA 4YWYA 3ETIA 1AYEA 3IIBA 4NJQA 3FMCA 4O23A 4FAIA 2AFZA 1CP6A 2NSMA 3WC6A 2XEGA 2PE3A 5CPAA 3IIDA 1F2PA 1BAVA 3VATA 3S9NA 4IK2A 2AFXA 4J5SA 4PQAA 3VH9A 1BLLE 5DS0A 2CTCA 2FXKA 2ANPA 3B3SA 4ZYQA 1RTQA 5ELYA 4IHMA 4MCPA 2IJZA 2PJ3A 2PRQA 5HVGA 4DJLA 4NGRA 3PB4X 2IQ6A 4P45A 1UWYA 3KR4A 1LOKA 3SIJA 4D86A 1TKHA 4Q7AA 3B2YA 2EWBA 3PFEA 4P10A 1VGYA 5I4MA 1EE3P 2GLJA 1TKFA 4OIWA 2BFRA 4GVVA 4K0CA 3CT9A 2ZOFA 4MHNA 4AXVA 3B3WA 4P4FA 4A94A 3GB0A 1XRYA 4PXEA 4P4IA 2BOAA 2GREA 4JVVA 2Q43A 3IFEA 2AFMA 4JCAA 5LYLA 3B35A 4DYOA 1M4LA 4NFRA 3RZAA 4ESSA 5FSVA 2FVGA 4ZY0A 4EFDA 3FECA 2L8RA 1Z5RA 2PVWA 2XEFA 3SI2A 2HB6A 3KHXA 4B6ZA 1ELLP 2Q51A 3T8WA 4A39A 3PRTA 3PFOA 3FEDA 4MCRA 2PVVA 4MXUA 1ZG9A 3GQEA 4GVWA 3B7IA 4H2KA 3KR5A 4OC2A 5JH9A 4ONWA 1YW6A 4OC5A 3LMSA 3GUXA 1HEEA 2ZELA 4A37A 4GM5A 5K8MA 2CF4A 2C6PA 1ZLHA 5LRKA 1PYTB 3RBUA 2ZEMA 1YMEA 3I1UA 4OC3A 2WYRA 4PXCA 4PPZA 5HVHA 3IO1A 5F09A 5IB9A 4JZ0A 4FUUA 3GPGA 2C1CA 3KASA 5LYIA 2RB7A 4UIAA 2OOTA 2PCUA 5CB5A 4ETJA 5HVFA 4OP4A 4J5QA 1OBRA 2DX6A 3PB7X 2O4HA 4PXDA 3FX6A 3B3TA 5HXDA 5LRJA 2V8HA 2ZEGA 3IIFA 4G1PA 3CPXA 5LYFA 5K8NA 4NGTA 1F2OA 3V45A 3KI9A 2ZEFA 4OC0A 2VL1A 3D66A 2JBJA 2G9DA 4P4JA 3S9MA 2EK9A 4EMEA 1FT7A 3FEEA 3SIHA 2X47A 3V7ZA 3FF3A 2AFUA 4ZX9A 3GQOA 5D8NA 3NH8A 4GUAA 1LCPA 1TF9A 2RFHA 3KZWA 1VHOA 4PXBA 1R3NA 1ELMP 3EWQA 2FG1A 3EWRA 3EJFA 2ZENA 3NA6A 5JGFA 4OC1A 4YU9A 3V38A 4A38A 2DEAA 5CMSA 3LWUA 4UEEA 2PIYA 3WC7A 2QYVA 4UF4A 3JRUA 3K2KA 3BXMA 3KHZA 4UEFA 1Y0YA 4FBEA 1XBUA 4OC4A 4R7MA 2PJ0A 1F57A 1HDUA 2CIJA 3SI0A 3SJEA 1BPNA 3L2NA 3EWPA 2J9AA 2C6GA 3BHXA 3BI0A 3QNVA 3D4UA 1NSAA 4OKOA 2ABZA 3IWWA 3H8GA 4X8IA 2V8GA 3EWOA 2IMOA 2GLFA 2C6CA 3D7HA 5FSZA 2ZEEA 1HJZA 2BFQA 3FH4A 2ZEHA 4X3RA 4X2TA 2V77A 1YSJA 1ARMA 3MRUA 2PJ1A 4NGQA 1CG2A 4MCSA 5FSXA 1JQGA 4R6TA 4K3NA 5E3BA 1DTDA 2V8VA 5CBMA 2ZOGA 4ZY2A 4JGKA 4WWVA 2AFOA 4MHPA 5K8OA 2OR4A 1Y7EA 5HIHA 1R43A 3D7GA 1Q7LA 2PJ8A 2PJBA 3WABA 4KYBA 4IAVA 4ABKA 4LQGA 2PJ5A 3PB9X 3GLJA 2V8DA 3EJGA 3PB8X 2ACFA 5FSUA 4MHYA 1TXRA 3IJ3A 5THWA 4UMLA 1LAPA 2XEJA 4MRIA 2JBKA 2QVPA 4UIBA 1ZLIA 2O53A 3KL9A 4TNUA 3ISXA 3SIIA 4EWTA 3NH4A 3B3VA 4KSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGR A;  2JEW A;  2ZEP A;  4CPA A;  1CX8 A;  4J5R A;  4DUK A;  3SJF A;  1NJR A;  2PJ7 A;  4Z65 A;  1VHU A;  2AFC A;  1GYT A;  1XJO A;  5AIL A;  4ETK A;  4F9V A;  1LFW A;  1Y0R A;  3EW5 A;  3TX8 A;  4RUH A;  1FNO A;  4J4Z A;  2Q4Z A;  3KGQ A;  4BD9 A;  4P4E A;  3SIG A;  4P4D A;  5LYD A;  3GPQ A;  4F8Z A;  2ZEO A;  4MCQ A;  3CDX A;  5JM6 A;  2CTB A;  1YLO A;  3PBB A;  1HDQ A;  3NH5 A;  1XMB A;  2WZN A;  2EEE A;  2PJC A;  1ZR5 A;  3H8F A;  4OME A;  1AMP A;  4TU0 A;  1H8L A;  3WT4 A;  2EK8 A;  3D7F A;  3B3C A;  4MMO A;  1VIX A;  5CB3 A;  3BI1 A;  3PB6 X;  8CPA A;  3PEI A;  3PBE A;  1ARL A;  1IGB A;  1TXZ A;  4JLL A;  1TKJ A;  1SPV A;  4JYW A;  3GPO A;  1ZR3 A;  2PJ6 A;  2GU2 A;  2NYQ A;  2XEI A;  5D29 A;  4R76 A;  1CP7 A;  1YW4 A;  2PIZ A;  7CPA A;  3CPA A;  5K8P A;  2PJA A;  3HLP A;  3D68 A;  3D67 A;  3NFZ A;  2I3C A;  1Z8L A;  2PJ4 A;  4NGP A;  5J1Q A;  4NGN A;  3Q6Z A;  1CPS A;  1TF8 A;  2F7V A;  1LAN A;  1TY8 A;  3VFQ A;  1KWM A;  4UEZ A;  3V2B A;  1ZG8 A;  1YD9 A;  2AFW A;  4ZI6 A;  1CPX A;  3HUV A;  1CBX A;  3SJX A;  4ZY1 A;  1LAM A;  3JZT A;  3ISZ A;  3D7D A;  3S9L A;  4TWE A;  3KQX A;  2QJ8 A;  4R8F A;  4NGS A;  4NGM A;  1ZG7 A;  3H8E A;  4NJR A;  5HOL A;  1XFO A;  3FVL A;  1Z2L A;  2F8H A;  5FSY A;  5DUS A;  1PCA A;  3EKE A;  4F9U A;  1BPM A;  1IY7 A;  4P6Y A;  3WC5 A;  5LRG A;  4W9Y A;  4P4B A;  4MHZ A;  3RAM A;  2VRI A;  3FJU A;  4WJB A;  3N5F A;  4OID A;  2AFS A;  2ZED A;  6CPA A;  2FAV A;  4ABL A;  3IC1 A;  4ZX8 A;  4IQY A;  2BO9 A;  3MN8 A;  3TC8 A;  3SJG A;  2HC9 A;  1QMU A;  3DLJ A;  1DE4 C;  1QQ9 A;  2XD7 A;  3SI1 A;  3VAR A;  2PJ9 A;  4P44 A;  2BCO A;  3IEH A;  3K9T A;  3KQZ A;  4FWU A;  1VHE A;  2POK A;  2PJ2 A;  3Q71 A;  3DGV A;  4YWY A;  3ETI A;  1AYE A;  3IIB A;  4NJQ A;  3FMC A;  4O23 A;  4FAI A;  2AFZ A;  1CP6 A;  2NSM A;  3WC6 A;  2XEG A;  2PE3 A;  5CPA A;  3IID A;  1F2P A;  1BAV A;  3VAT A;  3S9N A;  4IK2 A;  2AFX A;  4J5S A;  4PQA A;  3VH9 A;  1BLL E;  5DS0 A;  2CTC A;  2FXK A;  2ANP A;  3B3S A;  4ZYQ A;  1RTQ A;  5ELY A;  4IHM A;  4MCP A;  2IJZ A;  2PJ3 A;  2PRQ A;  5HVG A;  4DJL A;  4NGR A;  3PB4 X;  2IQ6 A;  4P45 A;  1UWY A;  3KR4 A;  1LOK A;  3SIJ A;  4D86 A;  1TKH A;  4Q7A A;  3B2Y A;  2EWB A;  3PFE A;  4P10 A;  1VGY A;  5I4M A;  1EE3 P;  2GLJ A;  1TKF A;  4OIW A;  2BFR A;  4GVV A;  4K0C A;  3CT9 A;  2ZOF A;  4MHN A;  4AXV A;  3B3W A;  4P4F A;  4A94 A;  3GB0 A;  1XRY A;  4PXE A;  4P4I A;  2BOA A;  2GRE A;  4JVV A;  2Q43 A;  3IFE A;  2AFM A;  4JCA A;  5LYL A;  3B35 A;  4DYO A;  1M4L A;  4NFR A;  3RZA A;  4ESS A;  5FSV A;  2FVG A;  4ZY0 A;  4EFD A;  3FEC A;  2L8R A;  1Z5R A;  2PVW A;  2XEF A;  3SI2 A;  2HB6 A;  3KHX A;  4B6Z A;  1ELL P;  2Q51 A;  3T8W A;  4A39 A;  3PRT A;  3PFO A;  3FED A;  4MCR A;  2PVV A;  4MXU A;  1ZG9 A;  3GQE A;  4GVW A;  3B7I A;  4H2K A;  3KR5 A;  4OC2 A;  5JH9 A;  4ONW A;  1YW6 A;  4OC5 A;  3LMS A;  3GUX A;  1HEE A;  2ZEL A;  4A37 A;  4GM5 A;  5K8M A;  2CF4 A;  2C6P A;  1ZLH A;  5LRK A;  1PYT B;  3RBU A;  2ZEM A;  1YME A;  3I1U A;  4OC3 A;  2WYR A;  4PXC A;  4PPZ A;  5HVH A;  3IO1 A;  5F09 A;  5IB9 A;  4JZ0 A;  4FUU A;  3GPG A;  2C1C A;  3KAS A;  5LYI A;  2RB7 A;  4UIA A;  2OOT A;  2PCU A;  5CB5 A;  4ETJ A;  5HVF A;  4OP4 A;  4J5Q A;  1OBR A;  2DX6 A;  3PB7 X;  2O4H A;  4PXD A;  3FX6 A;  3B3T A;  5HXD A;  5LRJ A;  2V8H A;  2ZEG A;  3IIF A;  4G1P A;  3CPX A;  5LYF A;  5K8N A;  4NGT A;  1F2O A;  3V45 A;  3KI9 A;  2ZEF A;  4OC0 A;  2VL1 A;  3D66 A;  2JBJ A;  2G9D A;  4P4J A;  3S9M A;  2EK9 A;  4EME A;  1FT7 A;  3FEE A;  3SIH A;  2X47 A;  3V7Z A;  3FF3 A;  2AFU A;  4ZX9 A;  3GQO A;  5D8N A;  3NH8 A;  4GUA A;  1LCP A;  1TF9 A;  2RFH A;  3KZW A;  1VHO A;  4PXB A;  1R3N A;  1ELM P;  3EWQ A;  2FG1 A;  3EWR A;  3EJF A;  2ZEN A;  3NA6 A;  5JGF A;  4OC1 A;  4YU9 A;  3V38 A;  4A38 A;  2DEA A;  5CMS A;  3LWU A;  4UEE A;  2PIY A;  3WC7 A;  2QYV A;  4UF4 A;  3JRU A;  3K2K A;  3BXM A;  3KHZ A;  4UEF A;  1Y0Y A;  4FBE A;  1XBU A;  4OC4 A;  4R7M A;  2PJ0 A;  1F57 A;  1HDU A;  2CIJ A;  3SI0 A;  3SJE A;  1BPN A;  3L2N A;  3EWP A;  2J9A A;  2C6G A;  3BHX A;  3BI0 A;  3QNV A;  3D4U A;  1NSA A;  4OKO A;  2ABZ A;  3IWW A;  3H8G A;  4X8I A;  2V8G A;  3EWO A;  2IMO A;  2GLF A;  2C6C A;  3D7H A;  5FSZ A;  2ZEE A;  1HJZ A;  2BFQ A;  3FH4 A;  2ZEH A;  4X3R A;  4X2T A;  2V77 A;  1YSJ A;  1ARM A;  3MRU A;  2PJ1 A;  4NGQ A;  1CG2 A;  4MCS A;  5FSX A;  1JQG A;  4R6T A;  4K3N A;  5E3B A;  1DTD A;  2V8V A;  5CBM A;  2ZOG A;  4ZY2 A;  4JGK A;  4WWV A;  2AFO A;  4MHP A;  5K8O A;  2OR4 A;  1Y7E A;  5HIH A;  1R43 A;  3D7G A;  1Q7L A;  2PJ8 A;  2PJB A;  3WAB A;  4KYB A;  4IAV A;  4ABK A;  4LQG A;  2PJ5 A;  3PB9 X;  3GLJ A;  2V8D A;  3EJG A;  3PB8 X;  2ACF A;  5FSU A;  4MHY A;  1TXR A;  3IJ3 A;  5THW A;  4UML A;  1LAP A;  2XEJ A;  4MRI A;  2JBK A;  2QVP A;  4UIB A;  1ZLI A;  2O53 A;  3KL9 A;  4TNU A;  3ISX A;  3SII A;  4EWT A;  3NH4 A;  3B3V A;  4KSI A; 
#chains in the Genus database with same CATH topology
 2LGR A;  2R98 A;  1Z8X A;  2JEW A;  4XPK A;  4MFP A;  4KVO E;  2ZEP A;  3NE8 A;  1CX8 A;  4CPA A;  4J5R A;  4X5K A;  2JLM A;  5EC4 A;  3TE4 A;  5IB0 A;  2ATR A;  4DUK A;  3SJF A;  1NJR A;  2PJ7 A;  3FYN A;  4Z65 A;  1VHU A;  2AFC A;  1GYT A;  3JVN A;  1XJO A;  5AIL A;  4ETK A;  4LUA A;  4R9M A;  4F9V A;  1LFW A;  1Y0R A;  3EW5 A;  3E0K A;  2J8N A;  2FCK A;  3TX8 A;  4RUH A;  3B8G A;  2Z11 A;  4AB7 A;  4KOX A;  1FNO A;  3I3G A;  4KSA A;  3CZX A;  2OZG A;  4C68 A;  4J4Z A;  1XF8 A;  2Q4Z A;  4MFL A;  3KGQ A;  4BD9 A;  3EO4 A;  5HH1 A;  4P4E A;  3SIG A;  4P4D A;  4U5Y A;  5ISV A;  4BMH A;  5LYD A;  3IU1 A;  3GPQ A;  4A31 A;  4AG7 A;  2ZEO A;  4MCQ A;  3CDX A;  5AG6 A;  4CGM A;  4F8Z A;  3F0A A;  5F46 A;  5JM6 A;  2CTB A;  1YLO A;  1QSR A;  1HDQ A;  3PBB A;  3NH5 A;  5H84 A;  1XMB A;  4CGN A;  4HNW B;  2WZN A;  2EEE A;  2PJC A;  1A2Z A;  1ZR5 A;  2B4D A;  1ZO0 A;  3H8F A;  3QAY A;  2RNK A;  4KVX A;  4OME A;  2B58 A;  3W6X A;  4CAX A;  1AMP A;  4TU0 A;  1H8L A;  3WT4 A;  4YRH A;  2R1I A;  2EK8 A;  4CAV A;  1Z4R A;  3B3C A;  3D7F A;  1Y9W A;  3S6K A;  4MMO A;  2PQ8 A;  1VIX A;  4KUA A;  5CB3 A;  2I79 A;  3BI1 A;  3PB6 X;  1N71 A;  8CPA A;  3V8I A;  1M4D A;  3PEI A;  4AG9 A;  3PBE A;  1V0C A;  2OH1 A;  1ARL A;  1IGB A;  2VZY A;  1TXZ A;  1IOI A;  4JLL A;  3W91 A;  1Q2D A;  1TKJ A;  4A32 A;  1SPV A;  1XE4 A;  4JYW A;  3GPO A;  1ON0 A;  4CYQ A;  4H6U A;  4ONU A;  3TTH A;  4MY3 A;  1ZR3 A;  2PJ6 A;  2BSW A;  4QB9 A;  4KOR A;  2GU2 A;  2B3U A;  4QVT A;  1K4J A;  4UCP A;  2NYQ A;  2XEI A;  5D29 A;  3KKW A;  4FD4 A;  4R76 A;  3CXQ A;  1CP7 A;  4KVM E;  1YW4 A;  2PIZ A;  7CPA A;  3CPA A;  5K8P A;  5KTC A;  4H6Z A;  2PJA A;  2JDC A;  3D68 A;  3HLP A;  3D67 A;  3IGR A;  1JWQ A;  3NFZ A;  3PP9 A;  2I3C A;  1Z8L A;  2Q0Y A;  5G1Z A;  1Q2C A;  2PJ4 A;  4NGP A;  4OLL A;  5J1Q A;  2A4N A;  4NGN A;  3Q6Z A;  1CPS A;  1TF8 A;  2F7V A;  1LAN A;  1TY8 A;  3VFQ A;  1KWM A;  4R57 A;  4UEZ A;  2Z3N A;  4FD6 A;  3V2B A;  1ZG8 A;  3D2P A;  2Z3K A;  1QSM A;  2DPT A;  2G3A A;  1YD9 A;  4UFW A;  2AFW A;  2JEV A;  4ZI6 A;  3C26 A;  1CPX A;  3HUV A;  1CBX A;  3SJX A;  4XPD C;  3VWE A;  4ZY1 A;  5HMN A;  1IYL A;  2P6E A;  4CGO A;  1LAM A;  1Z4E A;  3JZT A;  3ISZ A;  3R95 A;  3DDD A;  3SHP A;  3TO6 A;  2WUU A;  4HKF A;  4Q38 A;  4B5P A;  3D7D A;  3P2F A;  4TWE A;  5A28 A;  3S9L A;  2CNT A;  2ZXV A;  3KQX A;  1IID A;  2QJ8 A;  4R8F A;  4NGS A;  4NGM A;  1ZG7 A;  5F49 A;  3H8E A;  4NJR A;  5HOL A;  1XFO A;  3FVL A;  4JXR A;  3R9E A;  3LD2 A;  1Z2L A;  2F8H A;  5FSY A;  1WWZ A;  4K30 A;  4F6A A;  5DUS A;  1PCA A;  3EKE A;  4FD5 A;  4CYN A;  4AVC A;  1NSL A;  4F9U A;  5J8F A;  1BPM A;  1IY7 A;  4P6Y A;  4M6H A;  3WC5 A;  4C2Z A;  1CJW A;  5JQ4 A;  4QUS A;  2Q7S A;  3NE7 A;  1IYK A;  3EY5 A;  5LRG A;  4W9Y A;  4P4B A;  3IWE A;  4MHZ A;  2REE A;  4UBR A;  3RAM A;  3VWD A;  2ZW7 A;  2VRI A;  3CXP A;  2Q4Y A;  3FJU A;  4WJB A;  3N5F A;  4OID A;  1X10 A;  2AFS A;  5BWA B;  4MFJ A;  1KUV A;  2ZED A;  6CPA A;  2FAV A;  4U9Y A;  4ABL A;  3IC1 A;  4IF5 A;  3EFA A;  4ZX8 A;  4IQY A;  1S7L A;  2BO9 A;  4L89 A;  2VI7 A;  3MN8 A;  3TC8 A;  3SJG A;  2HC9 A;  3D2M A;  1QMU A;  3DLJ A;  4CS0 B;  1DE4 C;  1QQ9 A;  2XD7 A;  3SI1 A;  2O28 A;  2PJ9 A;  3VAR A;  4R87 A;  4P44 A;  5J8C A;  3D8P A;  3I9S A;  1CM0 A;  2CY2 A;  1NMT A;  3T90 A;  2DPS A;  2CXA A;  1XOV A;  2BCO A;  3LAC A;  1BOB A;  1PU9 A;  2JDD A;  2REF A;  1IB1 E;  3DR6 A;  3H5Z A;  4UWI A;  4AVA A;  3CXS A;  4CAE A;  4KOY A;  3IEH A;  5DWM A;  4UCM A;  3F8K A;  3K9T A;  3S6F A;  1M44 A;  4CGP A;  3KQZ A;  4FWU A;  4QBJ A;  1VHE A;  2POK A;  3PZJ A;  1VKC A;  2QEC A;  4II9 A;  1YVO A;  2PJ2 A;  3Q71 A;  1XEB A;  2EUI A;  3DGV A;  4YWY A;  4AVB A;  2WSA A;  3TFY A;  3ETI A;  1AYE A;  3IIB A;  4NJQ A;  3FMC A;  3JUW A;  4O23 A;  4C7H A;  4FAI A;  2AFZ A;  2Y0M A;  1CP6 A;  2NSM A;  3W6S A;  3WC6 A;  2XEG A;  2PE3 A;  2FSR A;  4MY0 A;  4NEX A;  3FXT A;  3IID A;  5CPA A;  3K9U A;  1Y9K A;  1F2P A;  1BAV A;  3VAT A;  3S9N A;  1S7F A;  1IU8 A;  4IK2 A;  2AFX A;  3GKR A;  4J5S A;  3PGP A;  2Q04 A;  4B5O A;  3TCV A;  4PQA A;  3VH9 A;  1BLL E;  1Q2Y A;  2H5M A;  4MJ8 A;  1KZF A;  4MFQ A;  1YQE A;  5DS0 A;  2CTC A;  2FXK A;  2QML A;  2ANP A;  1I21 A;  1PUA A;  2PRB A;  3B3S A;  4ZYQ A;  4KOT A;  4KSF A;  1RTQ A;  4UA3 A;  5ELY A;  4IHM A;  4MCP A;  4B13 A;  2IJZ A;  2IL4 A;  2PJ3 A;  4E0A A;  2PRQ A;  4B14 A;  5HVG A;  4DJL A;  4NGR A;  2JZD A;  3PB4 X;  1X12 A;  3JTK A;  1TIQ A;  2IQ6 A;  3DR8 A;  4P45 A;  1U6M A;  1UWY A;  1XMT A;  3KR4 A;  1LOK A;  3SIJ A;  2FIW A;  4D86 A;  2FL4 A;  2I00 A;  2Q44 A;  1TKH A;  1QST A;  4Q7A A;  2Z3M A;  3B2Y A;  2EWB A;  2F5I A;  3PFE A;  4P10 A;  1VGY A;  2ZW6 A;  4OAD A;  5I4M A;  1YGH A;  4HNX B;  1EE3 P;  2GLJ A;  3H4Q A;  3SXO A;  3UY5 A;  1TKF A;  2ODF A;  4RN7 A;  4A30 A;  2JZE A;  2FIA A;  2WPX A;  4UFV A;  4OIW A;  2BFR A;  4PK2 A;  4GVV A;  4K0C A;  4L8A A;  3CT9 A;  2ZOF A;  3GYA A;  4MHN A;  4AXV A;  3B3W A;  4P4F A;  4A94 A;  3GB0 A;  1XRY A;  1GHE A;  1NE9 A;  2VQY A;  4HPS A;  5G21 A;  3R9F A;  4PV6 A;  4PXE A;  4P4I A;  5F48 A;  2BOA A;  2GRE A;  4JVV A;  2YND A;  3FNC A;  2Q43 A;  3IFE A;  2AFM A;  2EVN A;  4R3K A;  1L0C A;  5IV0 A;  4JCA A;  3P2H A;  1IOF A;  3S6H A;  4KS9 A;  5LYL A;  4KLV A;  4Q36 A;  3B35 A;  2GAN A;  2HUZ A;  2R7H A;  1M4L A;  2QIR A;  2B4D B;  3GY9 A;  3S6G A;  4NFR A;  3RZA A;  2EBJ A;  4R3L A;  1YRE A;  4ESS A;  5FSV A;  2GFQ A;  2FVG A;  2Z3O A;  4ZY0 A;  4EFD A;  5KTA A;  1M4I A;  4MBU A;  3R96 A;  1VHS A;  3FEC A;  3TOA A;  4PSW A;  2L8R A;  1Z5R A;  2K5T A;  2PVW A;  2BL1 A;  4H89 A;  4UFX A;  2Q4V A;  2XEF A;  3SI2 A;  2YNC C;  2P0W A;  4YFJ A;  3G3S A;  2HB6 A;  3KHX A;  4B6Z A;  1ELL P;  1WK4 A;  2Q51 A;  2VBQ A;  4KOV A;  4NCZ A;  4UWJ A;  3TO9 A;  3T8W A;  3SXN A;  2WPW A;  2DF5 A;  4A39 A;  3FBU A;  3PRT A;  2X7B A;  2ARH A;  3PFO A;  3FED A;  4MCR A;  5AG5 A;  1QSO A;  1SQH A;  2PVV A;  3R1K A;  4MXU A;  1ZG9 A;  3GQE A;  1Z8W A;  4CAF A;  4GVW A;  4E2A A;  3B7I A;  4H2K A;  4KUB A;  2ZPA A;  3KR5 A;  5E96 A;  4KLW A;  4OC2 A;  4ONW A;  5DWN A;  5JH9 A;  1YW6 A;  2KCW A;  2Z0Z A;  4OC5 A;  3LMS A;  3GUX A;  1HEE A;  2ZEL A;  1MK4 A;  4A37 A;  4GM5 A;  3WR7 A;  1B6B A;  5K8M A;  5C88 A;  2CF4 A;  4MI4 A;  1AUG A;  3DSB A;  4XNH B;  4F0X A;  1P4N A;  1ZLH A;  2C6P A;  1Z8T A;  4B12 A;  1PYT B;  5LRK A;  1KUY A;  3RBU A;  2ZEM A;  1S5K A;  4A95 A;  1YME A;  3I1U A;  4OC3 A;  4QC6 A;  4JWP A;  2WYR A;  4PXC A;  4Y49 B;  4KOS A;  4PPZ A;  1OZP A;  1Z9U A;  3BJ7 A;  1FY7 A;  5HVH A;  3IO1 A;  5F09 A;  5IB9 A;  4FD7 A;  4GXH A;  4FUU A;  4JZ0 A;  3EC4 A;  3GPG A;  2C1C A;  3KAS A;  4MFK A;  4U9Z A;  5LYI A;  5IX3 A;  2C27 A;  2RB7 A;  4UIA A;  2OOT A;  2PCU A;  5FVJ A;  5CB5 A;  1I1D A;  4B5P B;  4ETJ A;  5HVF A;  2B5G B;  1YLE A;  4OP4 A;  5GCN A;  2OU2 A;  1QSN A;  4J5Q A;  3T9Y A;  1OBR A;  1MJA A;  2AE6 A;  1RO5 A;  4EVY A;  2DX6 A;  2VEZ A;  2D4O A;  4PSX A;  3PB7 X;  2PDO A;  2WCT A;  3A9L A;  2FE7 A;  2O4H A;  1KUX A;  2OZH A;  4PXD A;  3FX6 A;  2GE3 A;  3B3T A;  1MJB A;  4NSQ A;  5HXD A;  2NMT A;  2Z3P A;  3R9G A;  4CYP A;  5LRJ A;  2V8H A;  2ZEG A;  3IIF A;  4G1P A;  4ZBG A;  3CPX A;  4B10 A;  5LYF A;  1S3Z A;  1J4J A;  5K8N A;  3RYO A;  4NGT A;  3F5B A;  4JD6 A;  4HNY B;  1F2O A;  4M6G A;  3TT2 A;  3ZZI A;  3V45 A;  2CNS A;  3N7Z A;  4C7I A;  4LX9 A;  1YVK A;  3KI9 A;  2ZEF A;  2CNM A;  4I49 A;  4OC0 A;  2J8R A;  2VL1 A;  3D66 A;  2JBJ A;  2G9D A;  4P4J A;  3S9M A;  2EK9 A;  4EME A;  1P0H A;  1FT7 A;  3FEE A;  3FRM A;  2VXK A;  4B11 A;  2HV2 A;  3SIH A;  2X47 A;  3V7Z A;  5AG7 A;  2ZW4 A;  2J8M A;  2PR1 A;  3FF3 A;  1RXT A;  2AFU A;  2VZZ A;  4ZX9 A;  3GQO A;  2PC1 A;  5D8N A;  2G0B A;  3NH8 A;  2B3V A;  3GIU A;  4GUA A;  1LCP A;  4RS2 A;  3BJ8 A;  1TF9 A;  2RFH A;  3KZW A;  1VHO A;  4PXB A;  1R3N A;  1ELM P;  3EWQ A;  2FG1 A;  3EWR A;  3LOD A;  3EJF A;  4E8O A;  2ZEN A;  2Q7B A;  4CRY B;  3NA6 A;  4A2Z A;  3ZJ0 A;  3G8W A;  3IU2 A;  4OC1 A;  4YU9 A;  3RO0 A;  5JGF A;  3V38 A;  3TOB A;  2FT0 A;  4A38 A;  4MHD A;  2DEA A;  5CMS A;  3LWU A;  2GIV A;  4UEE A;  4A33 A;  1S60 A;  2EO8 A;  2HQY A;  2PIY A;  3MGD A;  3WC7 A;  2QYV A;  4UF4 A;  4CRZ B;  3JRU A;  4UCN A;  1YX0 A;  3K2K A;  2ZW5 A;  2RC4 A;  4NF1 A;  1Y7R A;  3BXM A;  3KHZ A;  4UEF A;  1Y0Y A;  3QAH A;  2OB0 A;  2Z10 A;  4MFZ A;  4C2Y A;  3RNZ A;  4FBE A;  1XBU A;  2FXF A;  4GS4 A;  4OC4 A;  4YGO A;  4R7M A;  2PJ0 A;  2D4P A;  4KZT A;  4BBH A;  1F57 A;  4PK3 A;  4NXY A;  2AJ6 A;  1HDU A;  2PR8 A;  2Z3L A;  2CIJ A;  3SI0 A;  3SJE A;  1I12 A;  1BPN A;  3L2N A;  3DNS A;  4JJX A;  4ZGY B;  3EWP A;  2J9A A;  3TO7 A;  2C6G A;  3BHX A;  3BI0 A;  4JXQ A;  3QNV A;  1UFH A;  3D4U A;  2FS5 A;  1NSA A;  4OKO A;  4RI1 A;  4XNH C;  5H86 A;  2ABZ A;  2YNC A;  3IWW A;  3H8G A;  2G3T A;  4CAW A;  5A27 A;  4X8I A;  2JZF A;  2R8V A;  1B87 A;  1YR0 A;  1IIC A;  3EWO A;  2IMO A;  2GLF A;  2C6C A;  2V8G A;  3D7H A;  4M3S A;  5FSZ A;  2ZEE A;  1HJZ A;  2BFQ A;  3FH4 A;  3QB8 A;  4XPL A;  4F0Y A;  4Y49 C;  2ZEH A;  2PSW A;  4X3R A;  4X2T A;  4OAE A;  4CYO A;  1S7N A;  2V77 A;  4M6I A;  4ORF A;  1YSJ A;  1ARM A;  5CNP A;  3MRU A;  2PJ1 A;  5AG4 A;  4NGQ A;  1CG2 A;  2W2G A;  1XIX A;  2B4B A;  5FSX A;  4KOU A;  1JQG A;  4MCS A;  4R6T A;  4K3N A;  5E3B A;  1DTD A;  3IWG A;  2V8V A;  5CBM A;  2ZOG A;  4ZY2 A;  5G22 A;  1MJ9 A;  4JGK A;  2B5G A;  4WWV A;  5F47 A;  5JPH A;  2YGW A;  2AFO A;  2BEI A;  4MHP A;  5K8O A;  2OR4 A;  1Y7E A;  5HIH A;  1YK3 A;  1R43 A;  3FIX A;  2YNE A;  3D7G A;  2P6G A;  1Q7L A;  2PJ8 A;  4CGL A;  2PJB A;  3WAB A;  3FB3 A;  4KYB A;  2BUE A;  1M4G A;  3BLN A;  4IAV A;  4C2X A;  4ABK A;  4DYO A;  4LQG A;  2PJ5 A;  5EBV A;  3PB9 X;  3GLJ A;  4IUS A;  2V8D A;  4LQ6 A;  3EJG A;  3PB8 X;  5G20 A;  2ACF A;  5FSU A;  4MHY A;  3D3S A;  1R57 A;  1TXR A;  3IJ3 A;  1LRZ A;  4UML A;  5THW A;  5C82 A;  1LAP A;  4DNC A;  1S7K A;  5EMI A;  1BO4 A;  2XEJ A;  4J3G A;  3OWC A;  4MRI A;  4BIN A;  2OZU A;  2JBK A;  2QVP A;  4XPD B;  4KOW A;  4UIB A;  2KQV A;  1ZLI A;  2O53 A;  3KL9 A;  4TNU A;  2DXQ A;  2P6F A;  5AGE A;  3ISX A;  3SII A;  5I0C A;  4EWT A;  4JLY A;  3EXN A;  3NH4 A;  5KTD A;  4M85 A;  3B3V A;  1M1D A;  4KSI A; 
#chains in the Genus database with same CATH homology
 2LGR A;  2JEW A;  2ZEP A;  4CPA A;  1CX8 A;  4J5R A;  4DUK A;  3SJF A;  1NJR A;  2PJ7 A;  4Z65 A;  1VHU A;  2AFC A;  1GYT A;  1XJO A;  5AIL A;  4ETK A;  4F9V A;  1LFW A;  1Y0R A;  3EW5 A;  3TX8 A;  4RUH A;  1FNO A;  4J4Z A;  2Q4Z A;  3KGQ A;  4BD9 A;  4P4E A;  3SIG A;  4P4D A;  5LYD A;  3GPQ A;  4F8Z A;  2ZEO A;  4MCQ A;  3CDX A;  5JM6 A;  2CTB A;  1YLO A;  3PBB A;  1HDQ A;  3NH5 A;  1XMB A;  2WZN A;  2EEE A;  2PJC A;  1ZR5 A;  3H8F A;  4OME A;  1AMP A;  4TU0 A;  1H8L A;  3WT4 A;  2EK8 A;  3D7F A;  3B3C A;  4MMO A;  1VIX A;  5CB3 A;  3BI1 A;  3PB6 X;  8CPA A;  3PEI A;  3PBE A;  1ARL A;  1IGB A;  1TXZ A;  4JLL A;  1TKJ A;  1SPV A;  4JYW A;  3GPO A;  1ZR3 A;  2PJ6 A;  2GU2 A;  2NYQ A;  2XEI A;  5D29 A;  4R76 A;  1CP7 A;  1YW4 A;  2PIZ A;  7CPA A;  3CPA A;  5K8P A;  2PJA A;  3HLP A;  3D68 A;  3D67 A;  3NFZ A;  2I3C A;  1Z8L A;  2PJ4 A;  4NGP A;  5J1Q A;  4NGN A;  3Q6Z A;  1CPS A;  1TF8 A;  2F7V A;  1LAN A;  1TY8 A;  3VFQ A;  1KWM A;  4UEZ A;  3V2B A;  1ZG8 A;  1YD9 A;  2AFW A;  4ZI6 A;  1CPX A;  3HUV A;  1CBX A;  3SJX A;  4ZY1 A;  1LAM A;  3JZT A;  3ISZ A;  3D7D A;  3S9L A;  4TWE A;  3KQX A;  2QJ8 A;  4R8F A;  4NGS A;  4NGM A;  1ZG7 A;  3H8E A;  4NJR A;  5HOL A;  1XFO A;  3FVL A;  1Z2L A;  2F8H A;  5FSY A;  5DUS A;  1PCA A;  3EKE A;  4F9U A;  1BPM A;  1IY7 A;  4P6Y A;  3WC5 A;  5LRG A;  4W9Y A;  4P4B A;  4MHZ A;  3RAM A;  2VRI A;  3FJU A;  4WJB A;  3N5F A;  4OID A;  2AFS A;  2ZED A;  6CPA A;  2FAV A;  4ABL A;  3IC1 A;  4ZX8 A;  4IQY A;  2BO9 A;  3MN8 A;  3TC8 A;  3SJG A;  2HC9 A;  1QMU A;  3DLJ A;  1DE4 C;  1QQ9 A;  2XD7 A;  3SI1 A;  3VAR A;  2PJ9 A;  4P44 A;  2BCO A;  3IEH A;  3K9T A;  3KQZ A;  4FWU A;  1VHE A;  2POK A;  2PJ2 A;  3Q71 A;  3DGV A;  4YWY A;  3ETI A;  1AYE A;  3IIB A;  4NJQ A;  3FMC A;  4O23 A;  4FAI A;  2AFZ A;  1CP6 A;  2NSM A;  3WC6 A;  2XEG A;  2PE3 A;  5CPA A;  3IID A;  1F2P A;  1BAV A;  3VAT A;  3S9N A;  4IK2 A;  2AFX A;  4J5S A;  4PQA A;  3VH9 A;  1BLL E;  5DS0 A;  2CTC A;  2FXK A;  2ANP A;  3B3S A;  4ZYQ A;  1RTQ A;  5ELY A;  4IHM A;  4MCP A;  2IJZ A;  2PJ3 A;  2PRQ A;  5HVG A;  4DJL A;  4NGR A;  3PB4 X;  2IQ6 A;  4P45 A;  1UWY A;  3KR4 A;  1LOK A;  3SIJ A;  4D86 A;  1TKH A;  4Q7A A;  3B2Y A;  2EWB A;  3PFE A;  4P10 A;  1VGY A;  5I4M A;  1EE3 P;  2GLJ A;  1TKF A;  4OIW A;  2BFR A;  4GVV A;  4K0C A;  3CT9 A;  2ZOF A;  4MHN A;  4AXV A;  3B3W A;  4P4F A;  4A94 A;  3GB0 A;  1XRY A;  4PXE A;  4P4I A;  2BOA A;  2GRE A;  4JVV A;  2Q43 A;  3IFE A;  2AFM A;  4JCA A;  5LYL A;  3B35 A;  4DYO A;  1M4L A;  4NFR A;  3RZA A;  4ESS A;  5FSV A;  2FVG A;  4ZY0 A;  4EFD A;  3FEC A;  2L8R A;  1Z5R A;  2PVW A;  2XEF A;  3SI2 A;  2HB6 A;  3KHX A;  4B6Z A;  1ELL P;  2Q51 A;  3T8W A;  4A39 A;  3PRT A;  3PFO A;  3FED A;  4MCR A;  2PVV A;  4MXU A;  1ZG9 A;  3GQE A;  4GVW A;  3B7I A;  4H2K A;  3KR5 A;  4OC2 A;  5JH9 A;  4ONW A;  1YW6 A;  4OC5 A;  3LMS A;  3GUX A;  1HEE A;  2ZEL A;  4A37 A;  4GM5 A;  5K8M A;  2CF4 A;  2C6P A;  1ZLH A;  5LRK A;  1PYT B;  3RBU A;  2ZEM A;  1YME A;  3I1U A;  4OC3 A;  2WYR A;  4PXC A;  4PPZ A;  5HVH A;  3IO1 A;  5F09 A;  5IB9 A;  4JZ0 A;  4FUU A;  3GPG A;  2C1C A;  3KAS A;  5LYI A;  2RB7 A;  4UIA A;  2OOT A;  2PCU A;  5CB5 A;  4ETJ A;  5HVF A;  4OP4 A;  4J5Q A;  1OBR A;  2DX6 A;  3PB7 X;  2O4H A;  4PXD A;  3FX6 A;  3B3T A;  5HXD A;  5LRJ A;  2V8H A;  2ZEG A;  3IIF A;  4G1P A;  3CPX A;  5LYF A;  5K8N A;  4NGT A;  1F2O A;  3V45 A;  3KI9 A;  2ZEF A;  4OC0 A;  2VL1 A;  3D66 A;  2JBJ A;  2G9D A;  4P4J A;  3S9M A;  2EK9 A;  4EME A;  1FT7 A;  3FEE A;  3SIH A;  2X47 A;  3V7Z A;  3FF3 A;  2AFU A;  4ZX9 A;  3GQO A;  5D8N A;  3NH8 A;  4GUA A;  1LCP A;  1TF9 A;  2RFH A;  3KZW A;  1VHO A;  4PXB A;  1R3N A;  1ELM P;  3EWQ A;  2FG1 A;  3EWR A;  3EJF A;  2ZEN A;  3NA6 A;  5JGF A;  4OC1 A;  4YU9 A;  3V38 A;  4A38 A;  2DEA A;  5CMS A;  3LWU A;  4UEE A;  2PIY A;  3WC7 A;  2QYV A;  4UF4 A;  3JRU A;  3K2K A;  3BXM A;  3KHZ A;  4UEF A;  1Y0Y A;  4FBE A;  1XBU A;  4OC4 A;  4R7M A;  2PJ0 A;  1F57 A;  1HDU A;  2CIJ A;  3SI0 A;  3SJE A;  1BPN A;  3L2N A;  3EWP A;  2J9A A;  2C6G A;  3BHX A;  3BI0 A;  3QNV A;  3D4U A;  1NSA A;  4OKO A;  2ABZ A;  3IWW A;  3H8G A;  4X8I A;  2V8G A;  3EWO A;  2IMO A;  2GLF A;  2C6C A;  3D7H A;  5FSZ A;  2ZEE A;  1HJZ A;  2BFQ A;  3FH4 A;  2ZEH A;  4X3R A;  4X2T A;  2V77 A;  1YSJ A;  1ARM A;  3MRU A;  2PJ1 A;  4NGQ A;  1CG2 A;  4MCS A;  5FSX A;  1JQG A;  4R6T A;  4K3N A;  5E3B A;  1DTD A;  2V8V A;  5CBM A;  2ZOG A;  4ZY2 A;  4JGK A;  4WWV A;  2AFO A;  4MHP A;  5K8O A;  2OR4 A;  1Y7E A;  5HIH A;  1R43 A;  3D7G A;  1Q7L A;  2PJ8 A;  2PJB A;  3WAB A;  4KYB A;  4IAV A;  4ABK A;  4LQG A;  2PJ5 A;  3PB9 X;  3GLJ A;  2V8D A;  3EJG A;  3PB8 X;  2ACF A;  5FSU A;  4MHY A;  1TXR A;  3IJ3 A;  5THW A;  4UML A;  1LAP A;  2XEJ A;  4MRI A;  2JBK A;  2QVP A;  4UIB A;  1ZLI A;  2O53 A;  3KL9 A;  4TNU A;  3ISX A;  3SII A;  4EWT A;  3NH4 A;  3B3V A;  4KSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...