3KR4A

Structure of a protease 3
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
518
Chain Sequence
b'ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
total genus 177
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr4A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr4A02
3CPAA 4MHNA 3IFEA 3Q71A 3B7IA 4WJBA 1F57A 1Z5RA 1LCPA 1FNOA 3D66A 3PBBA 4ONWA 3ISXA 4BD9A 5DS0A 2OOTA 4O23A 1IGBA 4P45A 4P4EA 3B3CA 3SIHA 1HDQA 5DUSA 1JQGA 2PJ4A 3VARA 2ZEFA 4FAIA 2ZEPA 5JGFA 3FJUA 2PJ9A 4OC1A 4OC3A 2PJAA 2BFRA 5AILA 4MCPA 3H8GA 3FMCA 4JVVA 2HB6A 3IEHA 4TU0A 4G1PA 3PB9X 2GREA 4P4DA 1OBRA 3QNVA 4UEEA 1YLOA 4GUAA 3KHXA 5K8OA 3FVLA 3NFZA 3D67A 3VFQA 3KGQA 2QJ8A 1TKHA 5FSZA 3FX6A 5J1QA 1Y7EA 2Q4ZA 2CTCA 3TC8A 3LWUA 2IMOA 1TKJA 4EMEA 2PJ7A 2V8HA 2AFOA 1YW6A 4K3NA 4X2TA 4JYWA 3GPOA 2J9AA 3DLJA 4PQAA 2PJ1A 4NGTA 2ZEGA 2PE3A 2BFQA 2PVWA 3SJEA 3B3TA 1ZR3A 3I1UA 3SI0A 5LYLA 1ZR5A 1CP7A 5JH9A 1XJOA 5ELYA 3PFOA 4X8IA 5CMSA 3WC6A 2FG1A 3WT4A 2PJ2A 4J5RA 1YSJA 1H8LA 2ANPA 5K8MA 2LGRA 2AFMA 5FSYA 1M4LA 5FSUA 3IIFA 2EK9A 1LAPA 3VATA 3NH8A 4GM5A 3WC5A 1Z8LA 4PXCA 1TXZA 2ZEOA 4ZY0A 4DUKA 2IJZA 3EJGA 3KASA 2ZEEA 4Z65A 3S9NA 2ZENA 1VHEA 3IC1A 4P44A 4R76A 3EWQA 4A94A 4F8ZA 4ZI6A 4J5SA 3NH5A 4IK2A 4TWEA 3CPXA 1HDUA 3PFEA 2AFSA 3SJXA 2C1CA 1PYTB 1Y0YA 5E3BA 3VH9A 1ARLA 3H8EA 3K9TA 3FEEA 4NGRA 3IO1A 3MRUA 3D68A 4MMOA 5HXDA 4OC2A 4IAVA 4CPAA 3BXMA 4R7MA 1GYTA 4ZY2A 4PPZA 4MCSA 5HVGA 5I4MA 2NYQA 3PB7X 3PEIA 4KSIA 3NA6A 1XBUA 1ARMA 3PB4X 2AFZA 2V77A 3RZAA 4EWTA 2I3CA 2V8DA 4ABLA 1HJZA 4MHPA 2BO9A 4YWYA 3K2KA 2PCUA 2RFHA 4NGQA 4UEZA 1VGYA 1CP6A 2F7VA 2Q51A 4R8FA 1ZG7A 5LRKA 3GPQA 2PIYA 2EEEA 3L2NA 2GU2A 2PJ5A 3SIGA 2XEFA 3PB6X 4P10A 4IQYA 3SIJA 3SIIA 2NSMA 1F2OA 2XD7A 3ISZA 3B3WA 2HC9A 3EWRA 2PRQA 5K8PA 1DTDA 4X3RA 1SPVA 3DGVA 4NJRA 5CB3A 4ZX8A 2BCOA 4J5QA 2JBKA 4NGPA 1ZLIA 3PBEA 1ZLHA 4OKOA 4OMEA 5K8NA 4PXEA 1VHOA 2JBJA 1TKFA 4F9VA 3EKEA 4ETKA 5D8NA 4R6TA 4MHYA 4FWUA 3CDXA 2PJCA 2FVGA 4ESSA 4J4ZA 5THWA 4ABKA 2EK8A 3CT9A 4ZX9A 1XRYA 4PXBA 3WABA 1CG2A 3HLPA 4NGNA 4NGSA 2F8HA 3KL9A 2XEIA 4UF4A 3T8WA 2VL1A 4OP4A 4DJLA 1YMEA 2PJ0A 3B3SA 1XMBA 5LYFA 3KHZA 1NSAA 3D7FA 1Z2LA 5HVFA 4A37A 2ACFA 4JCAA 4UIAA 2ZELA 4EFDA 3BHXA 4WWVA 1BAVA 4TNUA 3FF3A 4A39A 3ETIA 2POKA 3V2BA 4H2KA 5D29A 3GLJA 3Q6ZA 2O4HA 4IHMA 3WC7A 2L8RA 1TXRA 3GB0A 4JZ0A 2V8GA 4OIWA 2V8VA 2GLJA 1LAMA 3HUVA 1RTQA 4JGKA 1TF8A 3RBUA 4P6YA 2ZEHA 5FSXA 3KQXA 1CX8A 4F9UA 2EWBA 3BI0A 2C6CA 3BI1A 3GQOA 1QMUA 4P4IA 1ZG8A 3FEDA 1EE3P 3SJFA 4JLLA 4W9YA 5HIHA 2AFXA 3KQZA 2PVVA 1ZG9A 1ELMP 1HEEA 4OC0A 1BLLE 3D7DA 2C6PA 3GUXA 1KWMA 1BPNA 4KYBA 1UWYA 3SJGA 4P4FA 2AFCA 2JEWA 2RB7A 8CPAA 2DEAA 3NH4A 3B35A 3IIBA 3PRTA 3H8FA 1PCAA 2GLFA 4MRIA 3LMSA 4LQGA 3GPGA 1TF9A 1CPSA 1VHUA 1XFOA 3GQEA 2WYRA 4YU9A 4ZYQA 4A38A 3IJ3A 2QVPA 2ZOFA 3B2YA 3MN8A 2IQ6A 4GVVA 2XEGA 4PXDA 2AFWA 2G9DA 5IB9A 5CB5A 1Q7LA 4NFRA 1YW4A 1CPXA 3KZWA 1CBXA 5JM6A 4OC4A 3D7GA 3V38A 3V7ZA 5HOLA 2CF4A 4MCRA 5LYIA 6CPAA 3EJFA 1ELLP 2WZNA 4P4BA 1NJRA 4Q7AA 3KI9A 3EW5A 1QQ9A 1VIXA 2O53A 3IIDA 3KR5A 2ZEDA 3IWWA 5CPAA 4FBEA 1LOKA 2QYVA 3FECA 5LRGA 1TY8A 2DX6A 2OR4A 4NGMA 3EWOA 4UIBA 4UMLA 2VRIA 5HVHA 4GVWA 5LRJA 3D7HA 3KR4A 7CPAA 1FT7A 3D4UA 2CIJA 3SI1A 1IY7A 2PJ6A 1AYEA 3JZTA 2ZOGA 4B6ZA 4DYOA 5F09A 3V45A 3N5FA 3SI2A 1R43A 2CTBA 2FAVA 1YD9A 1DE4C 1LFWA 2PJ3A 3FH4A 3S9MA 2PIZA 4FUUA 3RAMA 5LYDA 4OIDA 1R3NA 3B3VA 5FSVA 1LANA 5CBMA 2AFUA 2Q43A 2X47A 4K0CA 4MCQA 4RUHA 3S9LA 4ZY1A 2ABZA 4MHZA 2FXKA 4P4JA 2C6GA 2BOAA 4UEFA 4D86A 3TX8A 2XEJA 1F2PA 3EWPA 2PJBA 3PB8X 2PJ8A 4AXVA 4OC5A 4MXUA 2ZEMA 1Y0RA 1BPMA 1AMPA 3JRUA 4ETJA 4NJQA
chains in the Genus database with same CATH superfamily
1LRZA 3CPAA 4MHNA 1VKCA 3OWCA 3IFEA 4OADA 3Q71A 3B7IA 2KQVA 2X7BA 4UFWA 4WJBA 3SXOA 3FBUA 3R9FA 2FT0A 2YNCA 1F57A 1Z5RA 4LX9A 4CRZB 1LCPA 4CGLA 1FNOA 5JPHA 3WR7A 4KOUA 3D66A 2Q7SA 3PBBA 4MFLA 4ONWA 3TOBA 4AG9A 2EO8A 4DNCA 2I00A 3ISXA 4BD9A 3ZZIA 4KOSA 5DS0A 2VI7A 4UCNA 2OOTA 4O23A 1IGBA 4KS9A 4A30A 4P45A 4P4EA 3B3CA 3S6KA 4B13A 1V0CA 3SIHA 1HDQA 5DUSA 1JQGA 4M3SA 2ARHA 2PJ4A 2PDOA 2Z0ZA 3QB8A 1UFHA 2J8MA 3VARA 2ZEFA 4IUSA 4FAIA 2ZEPA 1OZPA 3IU1A 4C2ZA 4JLYA 3VWEA 5JGFA 3IWGA 2AE6A 1KZFA 1XOVA 2EUIA 3FJUA 2PJ9A 4OC1A 1Z8XA 4KVXA 4FD4A 4OC3A 2PJAA 2BFRA 4KSFA 2QIRA 5AILA 2VQYA 4MCPA 4Y49C 3ZJ0A 5ISVA 3H8GA 1Y7RA 2R8VA 2YGWA 3FMCA 4JVVA 4B12A 2HB6A 4Y49B 3D8PA 3IEHA 4TU0A 2P6GA 4G1PA 3PB9X 3FIXA 3CXQA 2GREA 4P4DA 1OBRA 2VXKA 2Z3NA 3F5BA 3G3SA 3QNVA 4L89A 4UEEA 2WPWA 1YLOA 4E0AA 4GUAA 3FB3A 3KHXA 1S7LA 1YGHA 2BL1A 5AG5A 3FVLA 3NFZA 4JD6A 3T9YA 3TCVA 3TT2A 5K8OA 3D67A 3VFQA 3KGQA 3QAHA 4KVME 3RYOA 2QJ8A 2ZW4A 1TKHA 2D4PA 5FSZA 3FX6A 2O28A 5J1QA 1Y7EA 5G21A 2Q4ZA 2CTCA 2P0WA 4XNHC 1QSNA 1XE4A 2Z3OA 1QSRA 4OAEA 3TC8A 3LWUA 2IMOA 2FXFA 1TKJA 1YK3A 2Q4VA 4EMEA 2PJ7A 2V8HA 3W91A 4FD7A 2AFOA 1YW6A 2B5GA 4JXQA 4K3NA 1NSLA 4J3GA 4M6GA 2JZEA 5AG6A 4X2TA 4KOVA 4JYWA 4UA3A 3GPOA 1J4JA 5KTAA 2J9AA 3DLJA 4PQAA 2PJ1A 1CM0A 3D2PA 4NGTA 2G3TA 3P2HA 2ZEGA 4AB7A 4CGPA 3KKWA 2PE3A 2BFQA 2PVWA 4MFZA 3SJEA 3B3TA 1ZR3A 2D4OA 3I1UA 5G20A 3SI0A 3B8GA 2Z3MA 5LYLA 4QB9A 3EXNA 1ZR5A 1CP7A 3GYAA 5JH9A 1XJOA 1XIXA 1M1DA 1KUYA 3PFOA 4OLLA 5ELYA 1M4DA 4X8IA 5CMSA 3WC6A 4E2AA 2FG1A 3WT4A 2PJ2A 2FSRA 4E8OA 4J5RA 2ZW6A 4YRHA 1YSJA 2B58A 4B5PB 1H8LA 2ANPA 5K8MA 2LGRA 4PSXA 2AFMA 2EBJA 3SHPA 4NCZA 5FSYA 1M4LA 1Z4RA 5FSUA 3IIFA 4F0XA 3JTKA 5I0CA 2EK9A 4L8AA 1Z8WA 1LAPA 3DNSA 3VATA 1IB1E 3NH8A 3TO7A 4GM5A 3WC5A 4C2XA 1Z8LA 4MFJA 4PXCA 1TXZA 2CNTA 2ZEOA 2R1IA 4ZY0A 2Q7BA 3W6XA 1Z4EA 4DUKA 2JZDA 2B4DA 2IJZA 2Q44A 2RC4A 2OZGA 4KZTA 3EJGA 3S6HA 3KASA 1PU9A 3TTHA 3R9EA 1IICA 2ZEEA 4Z65A 3S9NA 1I21A 3CZXA 2ZENA 2HUZA 4H6ZA 1S7KA 3G8WA 1VHEA 4MFKA 3C26A 4A31A 3IC1A 3NE7A 4P44A 4R76A 4XPKA 4MI4A 3EWQA 2Z3PA 4A94A 4AVAA 4RS2A 4JXRA 4F8ZA 4ZI6A 4J5SA 3NH5A 4IK2A 1JWQA 2J8RA 4TWEA 3CPXA 5A27A 3H5ZA 1HDUA 3PFEA 4R87A 2AFSA 3SJXA 2H5MA 2C1CA 1PYTB 1Y0YA 5AGEA 5E3BA 3VH9A 2Z3KA 1ARLA 2KCWA 1I1DA 3H8EA 4NXYA 3IWEA 4ONUA 3K9TA 4R57A 4ZGYB 3FEEA 4UFVA 1YLEA 2DPSA 4NGRA 3IO1A 4C7IA 2WUUA 3MRUA 5F49A 3EY5A 4R9MA 3D68A 4MMOA 3P2FA 4XPDB 5H86A 4OC2A 5HXDA 4KOTA 4IAVA 4CPAA 3BXMA 3R95A 4R7MA 1GYTA 4ZY2A 2WSAA 1RO5A 1A2ZA 1IOIA 2OH1A 4PPZA 4MCSA 5HVGA 5I4MA 1S60A 2NYQA 1X10A 3PB7X 1ON0A 1YQEA 1QSOA 2DF5A 4HNXB 3PEIA 4KSIA 2PR1A 3NA6A 1QSMA 2BUEA 5FVJA 1XBUA 1ARMA 3PB4X 1WK4A 1Q2DA 2PR8A 1MJBA 2AFZA 2V77A 3RZAA 4EWTA 4CAFA 2I3CA 1FY7A 3DDDA 2V8DA 4ABLA 2F5IA 1YVKA 1HJZA 1KUXA 2BO9A 4MHPA 4M6IA 3CXPA 4YWYA 2G3AA 1IU8A 3K2KA 2PCUA 2RFHA 4C2YA 4HPSA 2QECA 1IYKA 5G1ZA 3V8IA 4NGQA 2FIAA 1VGYA 4UEZA 1CP6A 2B3VA 2F7VA 2Q51A 4PSWA 5C82A 2ZPAA 5AG4A 4R8FA 4HNWB 4UCMA 5E96A 1P0HA 1ZG7A 5LRKA 3GPQA 3PZJA 3TFYA 4C7HA 4K30A 2JLMA 2PIYA 2EEEA 3L2NA 4MFQA 4MBUA 3GIUA 2GU2A 1YX0A 3TOAA 4CGNA 4ORFA 2PJ5A 4GS4A 3SIGA 2FE7A 2XEFA 3PB6X 4KOWA 4P10A 3PGPA 3TO9A 5KTDA 4IQYA 3SIJA 3SIIA 1MJ9A 2VEZA 2NSMA 4UWJA 5IB0A 1N71A 1F2OA 1GHEA 2XD7A 3FXTA 3ISZA 4QBJA 2OU2A 3B3WA 4CAVA 3JVNA 2HC9A 2CNMA 3QAYA 3EWRA 2PRQA 5K8PA 1DTDA 4X3RA 1SPVA 3DGVA 4NJRA 5CB3A 4ZX8A 2BCOA 4J5QA 2JBKA 4HNYB 1ZLIA 3PBEA 4NGPA 1ZLHA 5EBVA 4OKOA 4OMEA 5K8NA 5G22A 4PXEA 3I9SA 1VHOA 1U6MA 2HV2A 4KORA 2JBJA 1TKFA 2ZXVA 3N7ZA 4F9VA 3EKEA 2OB0A 4ETKA 4KUBA 5D8NA 2Z11A 4R6TA 3DR6A 4FWUA 4MHYA 5DWNA 3CDXA 3R96A 2C27A 2PJCA 2J8NA 2CY2A 4CRYB 2FVGA 4ESSA 2FIWA 4J4ZA 5THWA 3A9LA 4ABKA 2EK8A 4KOYA 2Z3LA 3CT9A 5EMIA 4ZX9A 1NE9A 1XRYA 4PXBA 3WABA 1CG2A 1IIDA 4Q36A 3HLPA 2IL4A 1S3ZA 3LD2A 4NGNA 5GCNA 4NGSA 2K5TA 4F0YA 2F8HA 4YGOA 1YREA 4A2ZA 1QSTA 3KL9A 4RN7A 2XEIA 4I49A 4AVCA 2DPTA 2DXQA 2Q0YA 4UF4A 3T8WA 2VL1A 3EFAA 1L0CA 4OP4A 2YNEA 4DJLA 1YMEA 5JQ4A 1CJWA 2PJ0A 3B3SA 3MGDA 2Q04A 4NF1A 1XMBA 5LYFA 3KHZA 1NSAA 3D7FA 4NEXA 2B3UA 3D3SA 1Z2LA 2PQ8A 2JEVA 5HVFA 4CYNA 4A37A 2ACFA 3K9UA 5F47A 4PK2A 4FD5A 2QMLA 3T90A 3PP9A 4JCAA 5EC4A 3LACA 4Q38A 4UIAA 4CGOA 1VHSA 1Y9KA 2ZELA 3DSBA 5DWMA 4EFDA 1XEBA 3EC4A 3BHXA 4WWVA 2ATRA 4FD6A 1BAVA 1RXTA 4TNUA 3FF3A 4UWIA 4A39A 4KLVA 3ETIA 4R3LA 4H6UA 2POKA 3V2BA 4H2KA 5D29A 3GLJA 3Q6ZA 2O4HA 3BLNA 4IHMA 4MHDA 3WC7A 2L8RA 2JDDA 1B87A 3FNCA 4U9ZA 1TXRA 1KUVA 3GB0A 4B5PA 4JZ0A 2V8GA 4KSAA 1NMTA 4OIWA 2V8VA 2GLJA 4QUSA 4LQ6A 4MY0A 4XPDC 5F48A 4A95A 1LAMA 3FRMA 3HUVA 1RTQA 4JGKA 4EVYA 1TF8A 3RBUA 4P6YA 2ZEHA 4UCPA 4X5KA 5FSXA 3KQXA 1CX8A 4F9UA 2EWBA 4MJ8A 3BI0A 1BOBA 2C6CA 2YNDA 3BI1A 3TO6A 5AG7A 3GQOA 1QMUA 3DR8A 1IOFA 4P4IA 1ZG8A 3FEDA 4JWPA 1EE3P 1WWZA 2EVNA 5F46A 3SJFA 4JLLA 1K4JA 4W9YA 5HIHA 2VZZA 2W2GA 2FL4A 2AFXA 3KQZA 2PVVA 1ZG9A 2OZHA 4B10A 1YR0A 2PRBA 2A4NA 4MY3A 1ELMP 1HEEA 4OC0A 4U5YA 1BLLE 3D7DA 2C6PA 3GUXA 3W6SA 1S7NA 2OZUA 2Q4YA 1KWMA 4CAEA 1BPNA 4KYBA 1UWYA 3SJGA 3VWDA 4P4FA 2AFCA 2JEWA 2RB7A 8CPAA 1S5KA 2DEAA 3NH4A 3B35A 3IIBA 1XMTA 3PRTA 3H8FA 1Y9WA 1PCAA 2BEIA 2GANA 1R57A 2GLFA 2ODFA 4BINA 5IX3A 2B5GB 3R1KA 4MRIA 1YVOA 2G0BA 4A33A 3LMSA 2RNKA 4LQGA 3GPGA 4CS0B 1TF9A 1CPSA 1VHUA 4H89A 1XFOA 3GQEA 4CYQA 2WYRA 5CNPA 4YU9A 4ZYQA 1M4IA 1ZO0A 3IJ3A 4GXHA 4A38A 5BWAB 2QVPA 2ZOFA 1MJAA 2AJ6A 3B2YA 3MN8A 2IQ6A 1Z8TA 4GVVA 1TIQA 2XEGA 3IGRA 4PXDA 2AFWA 2G9DA 5IB9A 4B14A 5CB5A 1Q7LA 4BBHA 4NFRA 5C88A 1YW4A 3GKRA 5KTCA 5A28A 3BJ7A 2CNSA 1CPXA 3NE8A 4QC6A 3GY9A 3KZWA 1CBXA 1Z9UA 5JM6A 4AG7A 4OC4A 2I79A 3D7GA 1AUGA 3V38A 5HOLA 2CF4A 3V7ZA 4B5OA 4NGMA 2FCKA 2REEA 3IU2A 4MCRA 5LYIA 2R7HA 6CPAA 5J8FA 4II9A 3EJFA 1ELLP 2R98A 2WZNA 4P4BA 2REFA 1NJRA 4Q7AA 3KI9A 3EW5A 1QQ9A 4CAWA 1VIXA 2O53A 4M6HA 4CAXA 1M44A 4XNHB 3IIDA 4F6AA 1MK4A 3KR5A 2ZEDA 3BJ8A 3IWWA 5CPAA 4AVBA 4LUAA 4RI1A 4FBEA 1LOKA 2QYVA 3F8KA 3FECA 5LRGA 1TY8A 2DX6A 2B4DB 2WCTA 2OR4A 3EWOA 2PC1A 4HKFA 4UMLA 2VRIA 1XF8A 2VBQA 4IF5A 4UIBA 5HVHA 4GVWA 3SXNA 5LRJA 2GFQA 3D7HA 3I3GA 4B11A 3KR4A 7CPAA 1FT7A 3D4UA 3JUWA 2GIVA 2CIJA 2JZFA 4UBRA 1IY7A 3D2MA 3SI1A 3S6GA 2PJ6A 3F0AA 5J8CA 1AYEA 3JZTA 2ZOGA 2NMTA 4B6ZA 1S7FA 2BSWA 4KUAA 4DYOA 5HMNA 3S6FA 3TE4A 4UFXA 4M85A 5H84A 3E0KA 4C68A 5F09A 4PV6A 3V45A 3N5FA 2YNCC 1R43A 3SI2A 2Y0MA 2CTBA 3RNZA 2FAVA 4KLWA 4BMHA 1YD9A 2ZW5A 4KVOE 4R3KA 1M4GA 1DE4C 1X12A 1LFWA 4NSQA 2PJ3A 3FH4A 3S9MA 2PIZA 4FUUA 3RAMA 1PUAA 4XPLA 5LYDA 1I12A 2JDCA 2VZYA 4OIDA 2Z10A 4KOXA 2P6FA 3LODA 4JJXA 1R3NA 1SQHA 2CXAA 3B3VA 2PSWA 2P6EA 5FSVA 3RO0A 1LANA 5CBMA 2AFUA 2Q43A 2X47A 4K0CA 4YFJA 2FS5A 3H4QA 4MCQA 4RUHA 3S9LA 1B6BA 4ZY1A 2ABZA 4CGMA 4MHZA 4U9YA 1Q2CA 2FXKA 4PK3A 4P4JA 2HQYA 4CYOA 2C6GA 5IV0A 2BOAA 4UEFA 5HH1A 4D86A 2B4BA 3TX8A 2XEJA 1F2PA 2GE3A 3FYNA 3EWPA 4MFPA 2PJBA 3PB8X 2PJ8A 4AXVA 3UY5A 4ZBGA 1Q2YA 4A32A 1IYLA 4OC5A 3R9GA 4MXUA 4QVTA 2ZEMA 1BO4A 3CXSA 4CYPA 1P4NA 2ZW7A 1Y0RA 2WPXA 1BPMA 1AMPA 3EO4A 3JRUA 4ETJA 4NJQA
chains in the Genus database with same CATH topology
3CPAA 4MHNA 3IFEA 3Q71A 3B7IA 4WJBA 1F57A 1Z5RA 1LCPA 1FNOA 3D66A 3PBBA 4ONWA 3ISXA 4BD9A 5DS0A 2OOTA 4O23A 1IGBA 4P45A 4P4EA 3B3CA 3SIHA 1HDQA 5DUSA 1JQGA 2PJ4A 3VARA 2ZEFA 4FAIA 2ZEPA 5JGFA 3FJUA 2PJ9A 4OC1A 4OC3A 2PJAA 2BFRA 5AILA 4MCPA 3H8GA 3FMCA 4JVVA 2HB6A 3IEHA 4TU0A 4G1PA 3PB9X 2GREA 4P4DA 1OBRA 3QNVA 4UEEA 1YLOA 4GUAA 3KHXA 5K8OA 3FVLA 3NFZA 3D67A 3VFQA 3KGQA 2QJ8A 1TKHA 5FSZA 3FX6A 5J1QA 1Y7EA 2Q4ZA 2CTCA 3TC8A 3LWUA 2IMOA 1TKJA 4EMEA 2PJ7A 2V8HA 2AFOA 1YW6A 4K3NA 4X2TA 4JYWA 3GPOA 2J9AA 3DLJA 4PQAA 2PJ1A 4NGTA 2ZEGA 2PE3A 2BFQA 2PVWA 3SJEA 3B3TA 1ZR3A 3I1UA 3SI0A 5LYLA 1ZR5A 1CP7A 5JH9A 1XJOA 5ELYA 3PFOA 4X8IA 5CMSA 3WC6A 2FG1A 3WT4A 2PJ2A 4J5RA 1YSJA 1H8LA 2ANPA 5K8MA 2LGRA 2AFMA 5FSYA 1M4LA 5FSUA 3IIFA 2EK9A 1LAPA 3VATA 3NH8A 4GM5A 3WC5A 1Z8LA 4PXCA 1TXZA 2ZEOA 4ZY0A 4DUKA 2IJZA 3EJGA 3KASA 2ZEEA 4Z65A 3S9NA 2ZENA 1VHEA 3IC1A 4P44A 4R76A 3EWQA 4A94A 4F8ZA 4ZI6A 4J5SA 3NH5A 4IK2A 4TWEA 3CPXA 1HDUA 3PFEA 2AFSA 3SJXA 2C1CA 1PYTB 1Y0YA 5E3BA 3VH9A 1ARLA 3H8EA 3K9TA 3FEEA 4NGRA 3IO1A 3MRUA 3D68A 4MMOA 5HXDA 4OC2A 4IAVA 4CPAA 3BXMA 4R7MA 1GYTA 4ZY2A 4PPZA 4MCSA 5HVGA 5I4MA 2NYQA 3PB7X 3PEIA 4KSIA 3NA6A 1XBUA 1ARMA 3PB4X 2AFZA 2V77A 3RZAA 4EWTA 2I3CA 2V8DA 4ABLA 1HJZA 4MHPA 2BO9A 4YWYA 3K2KA 2PCUA 2RFHA 4NGQA 4UEZA 1VGYA 1CP6A 2F7VA 2Q51A 4R8FA 1ZG7A 5LRKA 3GPQA 2PIYA 2EEEA 3L2NA 2GU2A 2PJ5A 3SIGA 2XEFA 3PB6X 4P10A 4IQYA 3SIJA 3SIIA 2NSMA 1F2OA 2XD7A 3ISZA 3B3WA 2HC9A 3EWRA 2PRQA 5K8PA 1DTDA 4X3RA 1SPVA 3DGVA 4NJRA 5CB3A 4ZX8A 2BCOA 4J5QA 2JBKA 4NGPA 1ZLIA 3PBEA 1ZLHA 4OKOA 4OMEA 5K8NA 4PXEA 1VHOA 2JBJA 1TKFA 4F9VA 3EKEA 4ETKA 5D8NA 4R6TA 4MHYA 4FWUA 3CDXA 2PJCA 2FVGA 4ESSA 4J4ZA 5THWA 4ABKA 2EK8A 3CT9A 4ZX9A 1XRYA 4PXBA 3WABA 1CG2A 3HLPA 4NGNA 4NGSA 2F8HA 3KL9A 2XEIA 4UF4A 3T8WA 2VL1A 4OP4A 4DJLA 1YMEA 2PJ0A 3B3SA 1XMBA 5LYFA 3KHZA 1NSAA 3D7FA 1Z2LA 5HVFA 4A37A 2ACFA 4JCAA 4UIAA 2ZELA 4EFDA 3BHXA 4WWVA 1BAVA 4TNUA 3FF3A 4A39A 3ETIA 2POKA 3V2BA 4H2KA 5D29A 3GLJA 3Q6ZA 2O4HA 4IHMA 3WC7A 2L8RA 1TXRA 3GB0A 4JZ0A 2V8GA 4OIWA 2V8VA 2GLJA 1LAMA 3HUVA 1RTQA 4JGKA 1TF8A 3RBUA 4P6YA 2ZEHA 5FSXA 3KQXA 1CX8A 4F9UA 2EWBA 3BI0A 2C6CA 3BI1A 3GQOA 1QMUA 4P4IA 1ZG8A 3FEDA 1EE3P 3SJFA 4JLLA 4W9YA 5HIHA 2AFXA 3KQZA 2PVVA 1ZG9A 1ELMP 1HEEA 4OC0A 1BLLE 3D7DA 2C6PA 3GUXA 1KWMA 1BPNA 4KYBA 1UWYA 3SJGA 4P4FA 2AFCA 2JEWA 2RB7A 8CPAA 2DEAA 3NH4A 3B35A 3IIBA 3PRTA 3H8FA 1PCAA 2GLFA 4MRIA 3LMSA 4LQGA 3GPGA 1TF9A 1CPSA 1VHUA 1XFOA 3GQEA 2WYRA 4YU9A 4ZYQA 4A38A 3IJ3A 2QVPA 2ZOFA 3B2YA 3MN8A 2IQ6A 4GVVA 2XEGA 4PXDA 2AFWA 2G9DA 5IB9A 5CB5A 1Q7LA 4NFRA 1YW4A 1CPXA 3KZWA 1CBXA 5JM6A 4OC4A 3D7GA 3V38A 3V7ZA 5HOLA 2CF4A 4MCRA 5LYIA 6CPAA 3EJFA 1ELLP 2WZNA 4P4BA 1NJRA 4Q7AA 3KI9A 3EW5A 1QQ9A 1VIXA 2O53A 3IIDA 3KR5A 2ZEDA 3IWWA 5CPAA 4FBEA 1LOKA 2QYVA 3FECA 5LRGA 1TY8A 2DX6A 2OR4A 4NGMA 3EWOA 4UIBA 4UMLA 2VRIA 5HVHA 4GVWA 5LRJA 3D7HA 3KR4A 7CPAA 1FT7A 3D4UA 2CIJA 3SI1A 1IY7A 2PJ6A 1AYEA 3JZTA 2ZOGA 4B6ZA 4DYOA 5F09A 3V45A 3N5FA 3SI2A 1R43A 2CTBA 2FAVA 1YD9A 1DE4C 1LFWA 2PJ3A 3FH4A 3S9MA 2PIZA 4FUUA 3RAMA 5LYDA 4OIDA 1R3NA 3B3VA 5FSVA 1LANA 5CBMA 2AFUA 2Q43A 2X47A 4K0CA 4MCQA 4RUHA 3S9LA 4ZY1A 2ABZA 4MHZA 2FXKA 4P4JA 2C6GA 2BOAA 4UEFA 4D86A 3TX8A 2XEJA 1F2PA 3EWPA 2PJBA 3PB8X 2PJ8A 4AXVA 4OC5A 4MXUA 2ZEMA 1Y0RA 1BPMA 1AMPA 3JRUA 4ETJA 4NJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPA A;  4MHN A;  3IFE A;  3Q71 A;  3B7I A;  4WJB A;  1F57 A;  1Z5R A;  1LCP A;  1FNO A;  3D66 A;  3PBB A;  4ONW A;  3ISX A;  4BD9 A;  5DS0 A;  2OOT A;  4O23 A;  1IGB A;  4P45 A;  4P4E A;  3B3C A;  3SIH A;  1HDQ A;  5DUS A;  1JQG A;  2PJ4 A;  3VAR A;  2ZEF A;  4FAI A;  2ZEP A;  5JGF A;  3FJU A;  2PJ9 A;  4OC1 A;  4OC3 A;  2PJA A;  2BFR A;  5AIL A;  4MCP A;  3H8G A;  3FMC A;  4JVV A;  2HB6 A;  3IEH A;  4TU0 A;  4G1P A;  3PB9 X;  2GRE A;  4P4D A;  1OBR A;  3QNV A;  4UEE A;  1YLO A;  4GUA A;  3KHX A;  5K8O A;  3FVL A;  3NFZ A;  3D67 A;  3VFQ A;  3KGQ A;  2QJ8 A;  1TKH A;  5FSZ A;  3FX6 A;  5J1Q A;  1Y7E A;  2Q4Z A;  2CTC A;  3TC8 A;  3LWU A;  2IMO A;  1TKJ A;  4EME A;  2PJ7 A;  2V8H A;  2AFO A;  1YW6 A;  4K3N A;  4X2T A;  4JYW A;  3GPO A;  2J9A A;  3DLJ A;  4PQA A;  2PJ1 A;  4NGT A;  2ZEG A;  2PE3 A;  2BFQ A;  2PVW A;  3SJE A;  3B3T A;  1ZR3 A;  3I1U A;  3SI0 A;  5LYL A;  1ZR5 A;  1CP7 A;  5JH9 A;  1XJO A;  5ELY A;  3PFO A;  4X8I A;  5CMS A;  3WC6 A;  2FG1 A;  3WT4 A;  2PJ2 A;  4J5R A;  1YSJ A;  1H8L A;  2ANP A;  5K8M A;  2LGR A;  2AFM A;  5FSY A;  1M4L A;  5FSU A;  3IIF A;  2EK9 A;  1LAP A;  3VAT A;  3NH8 A;  4GM5 A;  3WC5 A;  1Z8L A;  4PXC A;  1TXZ A;  2ZEO A;  4ZY0 A;  4DUK A;  2IJZ A;  3EJG A;  3KAS A;  2ZEE A;  4Z65 A;  3S9N A;  2ZEN A;  1VHE A;  3IC1 A;  4P44 A;  4R76 A;  3EWQ A;  4A94 A;  4F8Z A;  4ZI6 A;  4J5S A;  3NH5 A;  4IK2 A;  4TWE A;  3CPX A;  1HDU A;  3PFE A;  2AFS A;  3SJX A;  2C1C A;  1PYT B;  1Y0Y A;  5E3B A;  3VH9 A;  1ARL A;  3H8E A;  3K9T A;  3FEE A;  4NGR A;  3IO1 A;  3MRU A;  3D68 A;  4MMO A;  5HXD A;  4OC2 A;  4IAV A;  4CPA A;  3BXM A;  4R7M A;  1GYT A;  4ZY2 A;  4PPZ A;  4MCS A;  5HVG A;  5I4M A;  2NYQ A;  3PB7 X;  3PEI A;  4KSI A;  3NA6 A;  1XBU A;  1ARM A;  3PB4 X;  2AFZ A;  2V77 A;  3RZA A;  4EWT A;  2I3C A;  2V8D A;  4ABL A;  1HJZ A;  4MHP A;  2BO9 A;  4YWY A;  3K2K A;  2PCU A;  2RFH A;  4NGQ A;  4UEZ A;  1VGY A;  1CP6 A;  2F7V A;  2Q51 A;  4R8F A;  1ZG7 A;  5LRK A;  3GPQ A;  2PIY A;  2EEE A;  3L2N A;  2GU2 A;  2PJ5 A;  3SIG A;  2XEF A;  3PB6 X;  4P10 A;  4IQY A;  3SIJ A;  3SII A;  2NSM A;  1F2O A;  2XD7 A;  3ISZ A;  3B3W A;  2HC9 A;  3EWR A;  2PRQ A;  5K8P A;  1DTD A;  4X3R A;  1SPV A;  3DGV A;  4NJR A;  5CB3 A;  4ZX8 A;  2BCO A;  4J5Q A;  2JBK A;  4NGP A;  1ZLI A;  3PBE A;  1ZLH A;  4OKO A;  4OME A;  5K8N A;  4PXE A;  1VHO A;  2JBJ A;  1TKF A;  4F9V A;  3EKE A;  4ETK A;  5D8N A;  4R6T A;  4MHY A;  4FWU A;  3CDX A;  2PJC A;  2FVG A;  4ESS A;  4J4Z A;  5THW A;  4ABK A;  2EK8 A;  3CT9 A;  4ZX9 A;  1XRY A;  4PXB A;  3WAB A;  1CG2 A;  3HLP A;  4NGN A;  4NGS A;  2F8H A;  3KL9 A;  2XEI A;  4UF4 A;  3T8W A;  2VL1 A;  4OP4 A;  4DJL A;  1YME A;  2PJ0 A;  3B3S A;  1XMB A;  5LYF A;  3KHZ A;  1NSA A;  3D7F A;  1Z2L A;  5HVF A;  4A37 A;  2ACF A;  4JCA A;  4UIA A;  2ZEL A;  4EFD A;  3BHX A;  4WWV A;  1BAV A;  4TNU A;  3FF3 A;  4A39 A;  3ETI A;  2POK A;  3V2B A;  4H2K A;  5D29 A;  3GLJ A;  3Q6Z A;  2O4H A;  4IHM A;  3WC7 A;  2L8R A;  1TXR A;  3GB0 A;  4JZ0 A;  2V8G A;  4OIW A;  2V8V A;  2GLJ A;  1LAM A;  3HUV A;  1RTQ A;  4JGK A;  1TF8 A;  3RBU A;  4P6Y A;  2ZEH A;  5FSX A;  3KQX A;  1CX8 A;  4F9U A;  2EWB A;  3BI0 A;  2C6C A;  3BI1 A;  3GQO A;  1QMU A;  4P4I A;  1ZG8 A;  3FED A;  1EE3 P;  3SJF A;  4JLL A;  4W9Y A;  5HIH A;  2AFX A;  3KQZ A;  2PVV A;  1ZG9 A;  1ELM P;  1HEE A;  4OC0 A;  1BLL E;  3D7D A;  2C6P A;  3GUX A;  1KWM A;  1BPN A;  4KYB A;  1UWY A;  3SJG A;  4P4F A;  2AFC A;  2JEW A;  2RB7 A;  8CPA A;  2DEA A;  3NH4 A;  3B35 A;  3IIB A;  3PRT A;  3H8F A;  1PCA A;  2GLF A;  4MRI A;  3LMS A;  4LQG A;  3GPG A;  1TF9 A;  1CPS A;  1VHU A;  1XFO A;  3GQE A;  2WYR A;  4YU9 A;  4ZYQ A;  4A38 A;  3IJ3 A;  2QVP A;  2ZOF A;  3B2Y A;  3MN8 A;  2IQ6 A;  4GVV A;  2XEG A;  4PXD A;  2AFW A;  2G9D A;  5IB9 A;  5CB5 A;  1Q7L A;  4NFR A;  1YW4 A;  1CPX A;  3KZW A;  1CBX A;  5JM6 A;  4OC4 A;  3D7G A;  3V38 A;  3V7Z A;  5HOL A;  2CF4 A;  4MCR A;  5LYI A;  6CPA A;  3EJF A;  1ELL P;  2WZN A;  4P4B A;  1NJR A;  4Q7A A;  3KI9 A;  3EW5 A;  1QQ9 A;  1VIX A;  2O53 A;  3IID A;  3KR5 A;  2ZED A;  3IWW A;  5CPA A;  4FBE A;  1LOK A;  2QYV A;  3FEC A;  5LRG A;  1TY8 A;  2DX6 A;  2OR4 A;  4NGM A;  3EWO A;  4UIB A;  4UML A;  2VRI A;  5HVH A;  4GVW A;  5LRJ A;  3D7H A;  3KR4 A;  7CPA A;  1FT7 A;  3D4U A;  2CIJ A;  3SI1 A;  1IY7 A;  2PJ6 A;  1AYE A;  3JZT A;  2ZOG A;  4B6Z A;  4DYO A;  5F09 A;  3V45 A;  3N5F A;  3SI2 A;  1R43 A;  2CTB A;  2FAV A;  1YD9 A;  1DE4 C;  1LFW A;  2PJ3 A;  3FH4 A;  3S9M A;  2PIZ A;  4FUU A;  3RAM A;  5LYD A;  4OID A;  1R3N A;  3B3V A;  5FSV A;  1LAN A;  5CBM A;  2AFU A;  2Q43 A;  2X47 A;  4K0C A;  4MCQ A;  4RUH A;  3S9L A;  4ZY1 A;  2ABZ A;  4MHZ A;  2FXK A;  4P4J A;  2C6G A;  2BOA A;  4UEF A;  4D86 A;  3TX8 A;  2XEJ A;  1F2P A;  3EWP A;  2PJB A;  3PB8 X;  2PJ8 A;  4AXV A;  4OC5 A;  4MXU A;  2ZEM A;  1Y0R A;  1BPM A;  1AMP A;  3JRU A;  4ETJ A;  4NJQ A; 
#chains in the Genus database with same CATH topology
 1LRZ A;  3CPA A;  4MHN A;  1VKC A;  3OWC A;  3IFE A;  4OAD A;  3Q71 A;  3B7I A;  2KQV A;  2X7B A;  4UFW A;  4WJB A;  3SXO A;  3FBU A;  3R9F A;  2FT0 A;  2YNC A;  1F57 A;  1Z5R A;  4LX9 A;  4CRZ B;  1LCP A;  4CGL A;  1FNO A;  5JPH A;  3WR7 A;  4KOU A;  3D66 A;  2Q7S A;  3PBB A;  4MFL A;  4ONW A;  3TOB A;  4AG9 A;  2EO8 A;  4DNC A;  2I00 A;  3ISX A;  4BD9 A;  3ZZI A;  4KOS A;  5DS0 A;  2VI7 A;  4UCN A;  2OOT A;  4O23 A;  1IGB A;  4KS9 A;  4A30 A;  4P45 A;  4P4E A;  3B3C A;  3S6K A;  4B13 A;  1V0C A;  3SIH A;  1HDQ A;  5DUS A;  1JQG A;  4M3S A;  2ARH A;  2PJ4 A;  2PDO A;  2Z0Z A;  3QB8 A;  1UFH A;  2J8M A;  3VAR A;  2ZEF A;  4IUS A;  4FAI A;  2ZEP A;  1OZP A;  3IU1 A;  4C2Z A;  4JLY A;  3VWE A;  5JGF A;  3IWG A;  2AE6 A;  1KZF A;  1XOV A;  2EUI A;  3FJU A;  2PJ9 A;  4OC1 A;  1Z8X A;  4KVX A;  4FD4 A;  4OC3 A;  2PJA A;  2BFR A;  4KSF A;  2QIR A;  5AIL A;  2VQY A;  4MCP A;  4Y49 C;  3ZJ0 A;  5ISV A;  3H8G A;  1Y7R A;  2R8V A;  2YGW A;  3FMC A;  4JVV A;  4B12 A;  2HB6 A;  4Y49 B;  3D8P A;  3IEH A;  4TU0 A;  2P6G A;  4G1P A;  3PB9 X;  3FIX A;  3CXQ A;  2GRE A;  4P4D A;  1OBR A;  2VXK A;  2Z3N A;  3F5B A;  3G3S A;  3QNV A;  4L89 A;  4UEE A;  2WPW A;  1YLO A;  4E0A A;  4GUA A;  3FB3 A;  3KHX A;  1S7L A;  1YGH A;  2BL1 A;  5AG5 A;  3FVL A;  3NFZ A;  4JD6 A;  3T9Y A;  3TCV A;  3TT2 A;  5K8O A;  3D67 A;  3VFQ A;  3KGQ A;  3QAH A;  4KVM E;  3RYO A;  2QJ8 A;  2ZW4 A;  1TKH A;  2D4P A;  5FSZ A;  3FX6 A;  2O28 A;  5J1Q A;  1Y7E A;  5G21 A;  2Q4Z A;  2CTC A;  2P0W A;  4XNH C;  1QSN A;  1XE4 A;  2Z3O A;  1QSR A;  4OAE A;  3TC8 A;  3LWU A;  2IMO A;  2FXF A;  1TKJ A;  1YK3 A;  2Q4V A;  4EME A;  2PJ7 A;  2V8H A;  3W91 A;  4FD7 A;  2AFO A;  1YW6 A;  2B5G A;  4JXQ A;  4K3N A;  1NSL A;  4J3G A;  4M6G A;  2JZE A;  5AG6 A;  4X2T A;  4KOV A;  4JYW A;  4UA3 A;  3GPO A;  1J4J A;  5KTA A;  2J9A A;  3DLJ A;  4PQA A;  2PJ1 A;  1CM0 A;  3D2P A;  4NGT A;  2G3T A;  3P2H A;  2ZEG A;  4AB7 A;  4CGP A;  3KKW A;  2PE3 A;  2BFQ A;  2PVW A;  4MFZ A;  3SJE A;  3B3T A;  1ZR3 A;  2D4O A;  3I1U A;  5G20 A;  3SI0 A;  3B8G A;  2Z3M A;  5LYL A;  4QB9 A;  3EXN A;  1ZR5 A;  1CP7 A;  3GYA A;  5JH9 A;  1XJO A;  1XIX A;  1M1D A;  1KUY A;  3PFO A;  4OLL A;  5ELY A;  1M4D A;  4X8I A;  5CMS A;  3WC6 A;  4E2A A;  2FG1 A;  3WT4 A;  2PJ2 A;  2FSR A;  4E8O A;  4J5R A;  2ZW6 A;  4YRH A;  1YSJ A;  2B58 A;  4B5P B;  1H8L A;  2ANP A;  5K8M A;  2LGR A;  4PSX A;  2AFM A;  2EBJ A;  3SHP A;  4NCZ A;  5FSY A;  1M4L A;  1Z4R A;  5FSU A;  3IIF A;  4F0X A;  3JTK A;  5I0C A;  2EK9 A;  4L8A A;  1Z8W A;  1LAP A;  3DNS A;  3VAT A;  1IB1 E;  3NH8 A;  3TO7 A;  4GM5 A;  3WC5 A;  4C2X A;  1Z8L A;  4MFJ A;  4PXC A;  1TXZ A;  2CNT A;  2ZEO A;  2R1I A;  4ZY0 A;  2Q7B A;  3W6X A;  1Z4E A;  4DUK A;  2JZD A;  2B4D A;  2IJZ A;  2Q44 A;  2RC4 A;  2OZG A;  4KZT A;  3EJG A;  3S6H A;  3KAS A;  1PU9 A;  3TTH A;  3R9E A;  1IIC A;  2ZEE A;  4Z65 A;  3S9N A;  1I21 A;  3CZX A;  2ZEN A;  2HUZ A;  4H6Z A;  1S7K A;  3G8W A;  1VHE A;  4MFK A;  3C26 A;  4A31 A;  3IC1 A;  3NE7 A;  4P44 A;  4R76 A;  4XPK A;  4MI4 A;  3EWQ A;  2Z3P A;  4A94 A;  4AVA A;  4RS2 A;  4JXR A;  4F8Z A;  4ZI6 A;  4J5S A;  3NH5 A;  4IK2 A;  1JWQ A;  2J8R A;  4TWE A;  3CPX A;  5A27 A;  3H5Z A;  1HDU A;  3PFE A;  4R87 A;  2AFS A;  3SJX A;  2H5M A;  2C1C A;  1PYT B;  1Y0Y A;  5AGE A;  5E3B A;  3VH9 A;  2Z3K A;  1ARL A;  2KCW A;  1I1D A;  3H8E A;  4NXY A;  3IWE A;  4ONU A;  3K9T A;  4R57 A;  4ZGY B;  3FEE A;  4UFV A;  1YLE A;  2DPS A;  4NGR A;  3IO1 A;  4C7I A;  2WUU A;  3MRU A;  5F49 A;  3EY5 A;  4R9M A;  3D68 A;  4MMO A;  3P2F A;  4XPD B;  5H86 A;  4OC2 A;  5HXD A;  4KOT A;  4IAV A;  4CPA A;  3BXM A;  3R95 A;  4R7M A;  1GYT A;  4ZY2 A;  2WSA A;  1RO5 A;  1A2Z A;  1IOI A;  2OH1 A;  4PPZ A;  4MCS A;  5HVG A;  5I4M A;  1S60 A;  2NYQ A;  1X10 A;  3PB7 X;  1ON0 A;  1YQE A;  1QSO A;  2DF5 A;  4HNX B;  3PEI A;  4KSI A;  2PR1 A;  3NA6 A;  1QSM A;  2BUE A;  5FVJ A;  1XBU A;  1ARM A;  3PB4 X;  1WK4 A;  1Q2D A;  2PR8 A;  1MJB A;  2AFZ A;  2V77 A;  3RZA A;  4EWT A;  4CAF A;  2I3C A;  1FY7 A;  3DDD A;  2V8D A;  4ABL A;  2F5I A;  1YVK A;  1HJZ A;  1KUX A;  2BO9 A;  4MHP A;  4M6I A;  3CXP A;  4YWY A;  2G3A A;  1IU8 A;  3K2K A;  2PCU A;  2RFH A;  4C2Y A;  4HPS A;  2QEC A;  1IYK A;  5G1Z A;  3V8I A;  4NGQ A;  2FIA A;  1VGY A;  4UEZ A;  1CP6 A;  2B3V A;  2F7V A;  2Q51 A;  4PSW A;  5C82 A;  2ZPA A;  5AG4 A;  4R8F A;  4HNW B;  4UCM A;  5E96 A;  1P0H A;  1ZG7 A;  5LRK A;  3GPQ A;  3PZJ A;  3TFY A;  4C7H A;  4K30 A;  2JLM A;  2PIY A;  2EEE A;  3L2N A;  4MFQ A;  4MBU A;  3GIU A;  2GU2 A;  1YX0 A;  3TOA A;  4CGN A;  4ORF A;  2PJ5 A;  4GS4 A;  3SIG A;  2FE7 A;  2XEF A;  3PB6 X;  4KOW A;  4P10 A;  3PGP A;  3TO9 A;  5KTD A;  4IQY A;  3SIJ A;  3SII A;  1MJ9 A;  2VEZ A;  2NSM A;  4UWJ A;  5IB0 A;  1N71 A;  1F2O A;  1GHE A;  2XD7 A;  3FXT A;  3ISZ A;  4QBJ A;  2OU2 A;  3B3W A;  4CAV A;  3JVN A;  2HC9 A;  2CNM A;  3QAY A;  3EWR A;  2PRQ A;  5K8P A;  1DTD A;  4X3R A;  1SPV A;  3DGV A;  4NJR A;  5CB3 A;  4ZX8 A;  2BCO A;  4J5Q A;  2JBK A;  4HNY B;  1ZLI A;  3PBE A;  4NGP A;  1ZLH A;  5EBV A;  4OKO A;  4OME A;  5K8N A;  5G22 A;  4PXE A;  3I9S A;  1VHO A;  1U6M A;  2HV2 A;  4KOR A;  2JBJ A;  1TKF A;  2ZXV A;  3N7Z A;  4F9V A;  3EKE A;  2OB0 A;  4ETK A;  4KUB A;  5D8N A;  2Z11 A;  4R6T A;  3DR6 A;  4FWU A;  4MHY A;  5DWN A;  3CDX A;  3R96 A;  2C27 A;  2PJC A;  2J8N A;  2CY2 A;  4CRY B;  2FVG A;  4ESS A;  2FIW A;  4J4Z A;  5THW A;  3A9L A;  4ABK A;  2EK8 A;  4KOY A;  2Z3L A;  3CT9 A;  5EMI A;  4ZX9 A;  1NE9 A;  1XRY A;  4PXB A;  3WAB A;  1CG2 A;  1IID A;  4Q36 A;  3HLP A;  2IL4 A;  1S3Z A;  3LD2 A;  4NGN A;  5GCN A;  4NGS A;  2K5T A;  4F0Y A;  2F8H A;  4YGO A;  1YRE A;  4A2Z A;  1QST A;  3KL9 A;  4RN7 A;  2XEI A;  4I49 A;  4AVC A;  2DPT A;  2DXQ A;  2Q0Y A;  4UF4 A;  3T8W A;  2VL1 A;  3EFA A;  1L0C A;  4OP4 A;  2YNE A;  4DJL A;  1YME A;  5JQ4 A;  1CJW A;  2PJ0 A;  3B3S A;  3MGD A;  2Q04 A;  4NF1 A;  1XMB A;  5LYF A;  3KHZ A;  1NSA A;  3D7F A;  4NEX A;  2B3U A;  3D3S A;  1Z2L A;  2PQ8 A;  2JEV A;  5HVF A;  4CYN A;  4A37 A;  2ACF A;  3K9U A;  5F47 A;  4PK2 A;  4FD5 A;  2QML A;  3T90 A;  3PP9 A;  4JCA A;  5EC4 A;  3LAC A;  4Q38 A;  4UIA A;  4CGO A;  1VHS A;  1Y9K A;  2ZEL A;  3DSB A;  5DWM A;  4EFD A;  1XEB A;  3EC4 A;  3BHX A;  4WWV A;  2ATR A;  4FD6 A;  1BAV A;  1RXT A;  4TNU A;  3FF3 A;  4UWI A;  4A39 A;  4KLV A;  3ETI A;  4R3L A;  4H6U A;  2POK A;  3V2B A;  4H2K A;  5D29 A;  3GLJ A;  3Q6Z A;  2O4H A;  3BLN A;  4IHM A;  4MHD A;  3WC7 A;  2L8R A;  2JDD A;  1B87 A;  3FNC A;  4U9Z A;  1TXR A;  1KUV A;  3GB0 A;  4B5P A;  4JZ0 A;  2V8G A;  4KSA A;  1NMT A;  4OIW A;  2V8V A;  2GLJ A;  4QUS A;  4LQ6 A;  4MY0 A;  4XPD C;  5F48 A;  4A95 A;  1LAM A;  3FRM A;  3HUV A;  1RTQ A;  4JGK A;  4EVY A;  1TF8 A;  3RBU A;  4P6Y A;  2ZEH A;  4UCP A;  4X5K A;  5FSX A;  3KQX A;  1CX8 A;  4F9U A;  2EWB A;  4MJ8 A;  3BI0 A;  1BOB A;  2C6C A;  2YND A;  3BI1 A;  3TO6 A;  5AG7 A;  3GQO A;  1QMU A;  3DR8 A;  1IOF A;  4P4I A;  1ZG8 A;  3FED A;  4JWP A;  1EE3 P;  1WWZ A;  2EVN A;  5F46 A;  3SJF A;  4JLL A;  1K4J A;  4W9Y A;  5HIH A;  2VZZ A;  2W2G A;  2FL4 A;  2AFX A;  3KQZ A;  2PVV A;  1ZG9 A;  2OZH A;  4B10 A;  1YR0 A;  2PRB A;  2A4N A;  4MY3 A;  1ELM P;  1HEE A;  4OC0 A;  4U5Y A;  1BLL E;  3D7D A;  2C6P A;  3GUX A;  3W6S A;  1S7N A;  2OZU A;  2Q4Y A;  1KWM A;  4CAE A;  1BPN A;  4KYB A;  1UWY A;  3SJG A;  3VWD A;  4P4F A;  2AFC A;  2JEW A;  2RB7 A;  8CPA A;  1S5K A;  2DEA A;  3NH4 A;  3B35 A;  3IIB A;  1XMT A;  3PRT A;  3H8F A;  1Y9W A;  1PCA A;  2BEI A;  2GAN A;  1R57 A;  2GLF A;  2ODF A;  4BIN A;  5IX3 A;  2B5G B;  3R1K A;  4MRI A;  1YVO A;  2G0B A;  4A33 A;  3LMS A;  2RNK A;  4LQG A;  3GPG A;  4CS0 B;  1TF9 A;  1CPS A;  1VHU A;  4H89 A;  1XFO A;  3GQE A;  4CYQ A;  2WYR A;  5CNP A;  4YU9 A;  4ZYQ A;  1M4I A;  1ZO0 A;  3IJ3 A;  4GXH A;  4A38 A;  5BWA B;  2QVP A;  2ZOF A;  1MJA A;  2AJ6 A;  3B2Y A;  3MN8 A;  2IQ6 A;  1Z8T A;  4GVV A;  1TIQ A;  2XEG A;  3IGR A;  4PXD A;  2AFW A;  2G9D A;  5IB9 A;  4B14 A;  5CB5 A;  1Q7L A;  4BBH A;  4NFR A;  5C88 A;  1YW4 A;  3GKR A;  5KTC A;  5A28 A;  3BJ7 A;  2CNS A;  1CPX A;  3NE8 A;  4QC6 A;  3GY9 A;  3KZW A;  1CBX A;  1Z9U A;  5JM6 A;  4AG7 A;  4OC4 A;  2I79 A;  3D7G A;  1AUG A;  3V38 A;  5HOL A;  2CF4 A;  3V7Z A;  4B5O A;  4NGM A;  2FCK A;  2REE A;  3IU2 A;  4MCR A;  5LYI A;  2R7H A;  6CPA A;  5J8F A;  4II9 A;  3EJF A;  1ELL P;  2R98 A;  2WZN A;  4P4B A;  2REF A;  1NJR A;  4Q7A A;  3KI9 A;  3EW5 A;  1QQ9 A;  4CAW A;  1VIX A;  2O53 A;  4M6H A;  4CAX A;  1M44 A;  4XNH B;  3IID A;  4F6A A;  1MK4 A;  3KR5 A;  2ZED A;  3BJ8 A;  3IWW A;  5CPA A;  4AVB A;  4LUA A;  4RI1 A;  4FBE A;  1LOK A;  2QYV A;  3F8K A;  3FEC A;  5LRG A;  1TY8 A;  2DX6 A;  2B4D B;  2WCT A;  2OR4 A;  3EWO A;  2PC1 A;  4HKF A;  4UML A;  2VRI A;  1XF8 A;  2VBQ A;  4IF5 A;  4UIB A;  5HVH A;  4GVW A;  3SXN A;  5LRJ A;  2GFQ A;  3D7H A;  3I3G A;  4B11 A;  3KR4 A;  7CPA A;  1FT7 A;  3D4U A;  3JUW A;  2GIV A;  2CIJ A;  2JZF A;  4UBR A;  1IY7 A;  3D2M A;  3SI1 A;  3S6G A;  2PJ6 A;  3F0A A;  5J8C A;  1AYE A;  3JZT A;  2ZOG A;  2NMT A;  4B6Z A;  1S7F A;  2BSW A;  4KUA A;  4DYO A;  5HMN A;  3S6F A;  3TE4 A;  4UFX A;  4M85 A;  5H84 A;  3E0K A;  4C68 A;  5F09 A;  4PV6 A;  3V45 A;  3N5F A;  2YNC C;  1R43 A;  3SI2 A;  2Y0M A;  2CTB A;  3RNZ A;  2FAV A;  4KLW A;  4BMH A;  1YD9 A;  2ZW5 A;  4KVO E;  4R3K A;  1M4G A;  1DE4 C;  1X12 A;  1LFW A;  4NSQ A;  2PJ3 A;  3FH4 A;  3S9M A;  2PIZ A;  4FUU A;  3RAM A;  1PUA A;  4XPL A;  5LYD A;  1I12 A;  2JDC A;  2VZY A;  4OID A;  2Z10 A;  4KOX A;  2P6F A;  3LOD A;  4JJX A;  1R3N A;  1SQH A;  2CXA A;  3B3V A;  2PSW A;  2P6E A;  5FSV A;  3RO0 A;  1LAN A;  5CBM A;  2AFU A;  2Q43 A;  2X47 A;  4K0C A;  4YFJ A;  2FS5 A;  3H4Q A;  4MCQ A;  4RUH A;  3S9L A;  1B6B A;  4ZY1 A;  2ABZ A;  4CGM A;  4MHZ A;  4U9Y A;  1Q2C A;  2FXK A;  4PK3 A;  4P4J A;  2HQY A;  4CYO A;  2C6G A;  5IV0 A;  2BOA A;  4UEF A;  5HH1 A;  4D86 A;  2B4B A;  3TX8 A;  2XEJ A;  1F2P A;  2GE3 A;  3FYN A;  3EWP A;  4MFP A;  2PJB A;  3PB8 X;  2PJ8 A;  4AXV A;  3UY5 A;  4ZBG A;  1Q2Y A;  4A32 A;  1IYL A;  4OC5 A;  3R9G A;  4MXU A;  4QVT A;  2ZEM A;  1BO4 A;  3CXS A;  4CYP A;  1P4N A;  2ZW7 A;  1Y0R A;  2WPX A;  1BPM A;  1AMP A;  3EO4 A;  3JRU A;  4ETJ A;  4NJQ A; 
#chains in the Genus database with same CATH homology
 3CPA A;  4MHN A;  3IFE A;  3Q71 A;  3B7I A;  4WJB A;  1F57 A;  1Z5R A;  1LCP A;  1FNO A;  3D66 A;  3PBB A;  4ONW A;  3ISX A;  4BD9 A;  5DS0 A;  2OOT A;  4O23 A;  1IGB A;  4P45 A;  4P4E A;  3B3C A;  3SIH A;  1HDQ A;  5DUS A;  1JQG A;  2PJ4 A;  3VAR A;  2ZEF A;  4FAI A;  2ZEP A;  5JGF A;  3FJU A;  2PJ9 A;  4OC1 A;  4OC3 A;  2PJA A;  2BFR A;  5AIL A;  4MCP A;  3H8G A;  3FMC A;  4JVV A;  2HB6 A;  3IEH A;  4TU0 A;  4G1P A;  3PB9 X;  2GRE A;  4P4D A;  1OBR A;  3QNV A;  4UEE A;  1YLO A;  4GUA A;  3KHX A;  5K8O A;  3FVL A;  3NFZ A;  3D67 A;  3VFQ A;  3KGQ A;  2QJ8 A;  1TKH A;  5FSZ A;  3FX6 A;  5J1Q A;  1Y7E A;  2Q4Z A;  2CTC A;  3TC8 A;  3LWU A;  2IMO A;  1TKJ A;  4EME A;  2PJ7 A;  2V8H A;  2AFO A;  1YW6 A;  4K3N A;  4X2T A;  4JYW A;  3GPO A;  2J9A A;  3DLJ A;  4PQA A;  2PJ1 A;  4NGT A;  2ZEG A;  2PE3 A;  2BFQ A;  2PVW A;  3SJE A;  3B3T A;  1ZR3 A;  3I1U A;  3SI0 A;  5LYL A;  1ZR5 A;  1CP7 A;  5JH9 A;  1XJO A;  5ELY A;  3PFO A;  4X8I A;  5CMS A;  3WC6 A;  2FG1 A;  3WT4 A;  2PJ2 A;  4J5R A;  1YSJ A;  1H8L A;  2ANP A;  5K8M A;  2LGR A;  2AFM A;  5FSY A;  1M4L A;  5FSU A;  3IIF A;  2EK9 A;  1LAP A;  3VAT A;  3NH8 A;  4GM5 A;  3WC5 A;  1Z8L A;  4PXC A;  1TXZ A;  2ZEO A;  4ZY0 A;  4DUK A;  2IJZ A;  3EJG A;  3KAS A;  2ZEE A;  4Z65 A;  3S9N A;  2ZEN A;  1VHE A;  3IC1 A;  4P44 A;  4R76 A;  3EWQ A;  4A94 A;  4F8Z A;  4ZI6 A;  4J5S A;  3NH5 A;  4IK2 A;  4TWE A;  3CPX A;  1HDU A;  3PFE A;  2AFS A;  3SJX A;  2C1C A;  1PYT B;  1Y0Y A;  5E3B A;  3VH9 A;  1ARL A;  3H8E A;  3K9T A;  3FEE A;  4NGR A;  3IO1 A;  3MRU A;  3D68 A;  4MMO A;  5HXD A;  4OC2 A;  4IAV A;  4CPA A;  3BXM A;  4R7M A;  1GYT A;  4ZY2 A;  4PPZ A;  4MCS A;  5HVG A;  5I4M A;  2NYQ A;  3PB7 X;  3PEI A;  4KSI A;  3NA6 A;  1XBU A;  1ARM A;  3PB4 X;  2AFZ A;  2V77 A;  3RZA A;  4EWT A;  2I3C A;  2V8D A;  4ABL A;  1HJZ A;  4MHP A;  2BO9 A;  4YWY A;  3K2K A;  2PCU A;  2RFH A;  4NGQ A;  4UEZ A;  1VGY A;  1CP6 A;  2F7V A;  2Q51 A;  4R8F A;  1ZG7 A;  5LRK A;  3GPQ A;  2PIY A;  2EEE A;  3L2N A;  2GU2 A;  2PJ5 A;  3SIG A;  2XEF A;  3PB6 X;  4P10 A;  4IQY A;  3SIJ A;  3SII A;  2NSM A;  1F2O A;  2XD7 A;  3ISZ A;  3B3W A;  2HC9 A;  3EWR A;  2PRQ A;  5K8P A;  1DTD A;  4X3R A;  1SPV A;  3DGV A;  4NJR A;  5CB3 A;  4ZX8 A;  2BCO A;  4J5Q A;  2JBK A;  4NGP A;  1ZLI A;  3PBE A;  1ZLH A;  4OKO A;  4OME A;  5K8N A;  4PXE A;  1VHO A;  2JBJ A;  1TKF A;  4F9V A;  3EKE A;  4ETK A;  5D8N A;  4R6T A;  4MHY A;  4FWU A;  3CDX A;  2PJC A;  2FVG A;  4ESS A;  4J4Z A;  5THW A;  4ABK A;  2EK8 A;  3CT9 A;  4ZX9 A;  1XRY A;  4PXB A;  3WAB A;  1CG2 A;  3HLP A;  4NGN A;  4NGS A;  2F8H A;  3KL9 A;  2XEI A;  4UF4 A;  3T8W A;  2VL1 A;  4OP4 A;  4DJL A;  1YME A;  2PJ0 A;  3B3S A;  1XMB A;  5LYF A;  3KHZ A;  1NSA A;  3D7F A;  1Z2L A;  5HVF A;  4A37 A;  2ACF A;  4JCA A;  4UIA A;  2ZEL A;  4EFD A;  3BHX A;  4WWV A;  1BAV A;  4TNU A;  3FF3 A;  4A39 A;  3ETI A;  2POK A;  3V2B A;  4H2K A;  5D29 A;  3GLJ A;  3Q6Z A;  2O4H A;  4IHM A;  3WC7 A;  2L8R A;  1TXR A;  3GB0 A;  4JZ0 A;  2V8G A;  4OIW A;  2V8V A;  2GLJ A;  1LAM A;  3HUV A;  1RTQ A;  4JGK A;  1TF8 A;  3RBU A;  4P6Y A;  2ZEH A;  5FSX A;  3KQX A;  1CX8 A;  4F9U A;  2EWB A;  3BI0 A;  2C6C A;  3BI1 A;  3GQO A;  1QMU A;  4P4I A;  1ZG8 A;  3FED A;  1EE3 P;  3SJF A;  4JLL A;  4W9Y A;  5HIH A;  2AFX A;  3KQZ A;  2PVV A;  1ZG9 A;  1ELM P;  1HEE A;  4OC0 A;  1BLL E;  3D7D A;  2C6P A;  3GUX A;  1KWM A;  1BPN A;  4KYB A;  1UWY A;  3SJG A;  4P4F A;  2AFC A;  2JEW A;  2RB7 A;  8CPA A;  2DEA A;  3NH4 A;  3B35 A;  3IIB A;  3PRT A;  3H8F A;  1PCA A;  2GLF A;  4MRI A;  3LMS A;  4LQG A;  3GPG A;  1TF9 A;  1CPS A;  1VHU A;  1XFO A;  3GQE A;  2WYR A;  4YU9 A;  4ZYQ A;  4A38 A;  3IJ3 A;  2QVP A;  2ZOF A;  3B2Y A;  3MN8 A;  2IQ6 A;  4GVV A;  2XEG A;  4PXD A;  2AFW A;  2G9D A;  5IB9 A;  5CB5 A;  1Q7L A;  4NFR A;  1YW4 A;  1CPX A;  3KZW A;  1CBX A;  5JM6 A;  4OC4 A;  3D7G A;  3V38 A;  3V7Z A;  5HOL A;  2CF4 A;  4MCR A;  5LYI A;  6CPA A;  3EJF A;  1ELL P;  2WZN A;  4P4B A;  1NJR A;  4Q7A A;  3KI9 A;  3EW5 A;  1QQ9 A;  1VIX A;  2O53 A;  3IID A;  3KR5 A;  2ZED A;  3IWW A;  5CPA A;  4FBE A;  1LOK A;  2QYV A;  3FEC A;  5LRG A;  1TY8 A;  2DX6 A;  2OR4 A;  4NGM A;  3EWO A;  4UIB A;  4UML A;  2VRI A;  5HVH A;  4GVW A;  5LRJ A;  3D7H A;  3KR4 A;  7CPA A;  1FT7 A;  3D4U A;  2CIJ A;  3SI1 A;  1IY7 A;  2PJ6 A;  1AYE A;  3JZT A;  2ZOG A;  4B6Z A;  4DYO A;  5F09 A;  3V45 A;  3N5F A;  3SI2 A;  1R43 A;  2CTB A;  2FAV A;  1YD9 A;  1DE4 C;  1LFW A;  2PJ3 A;  3FH4 A;  3S9M A;  2PIZ A;  4FUU A;  3RAM A;  5LYD A;  4OID A;  1R3N A;  3B3V A;  5FSV A;  1LAN A;  5CBM A;  2AFU A;  2Q43 A;  2X47 A;  4K0C A;  4MCQ A;  4RUH A;  3S9L A;  4ZY1 A;  2ABZ A;  4MHZ A;  2FXK A;  4P4J A;  2C6G A;  2BOA A;  4UEF A;  4D86 A;  3TX8 A;  2XEJ A;  1F2P A;  3EWP A;  2PJB A;  3PB8 X;  2PJ8 A;  4AXV A;  4OC5 A;  4MXU A;  2ZEM A;  1Y0R A;  1BPM A;  1AMP A;  3JRU A;  4ETJ A;  4NJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...