3KR4A

Structure of a protease 3
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
total genus 177
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr4A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr4A02
4NGNA 2PE3A 4ESSA 2AFMA 2I3CA 3SIJA 3D67A 4DJLA 1CBXA 4MHPA 2C6GA 3BXMA 3IWWA 3D66A 3VFQA 2PVVA 3TX8A 3QNVA 3B2YA 4NFRA 1F2PA 3K2KA 1NSAA 1LOKA 4R8FA 3D68A 4J4ZA 3FEDA 1HDUA 4PXBA 2JBJA 2J9AA 4KYBA 2EEEA 4H2KA 3HUVA 3Q6ZA 4JLLA 3KASA 2AFCA 3V2BA 4P45A 4NGTA 3NH5A 1XJOA 4NGQA 3BI1A 1GYTA 3PRTA 4MHYA 3V45A 3SJEA 4W9YA 5HXDA 3D4UA 1CG2A 3ETIA 2PJ5A 2XEIA 3KL9A 5FSZA 2FXKA 3IO1A 4PPZA 1VHUA 4JYWA 4FBEA 2GLJA 4DUKA 1F2OA 1TKHA 4D86A 3T8WA 4P4EA 2C6CA 1TF9A 3WC7A 4DYOA 1BLLE 2O53A 4ETJA 1XMBA 2JBKA 2PVWA 3IJ3A 5CBMA 5CB5A 2EK9A 5HIHA 4OC1A 1AYEA 2WYRA 3KQXA 1HEEA 3FJUA 4MXUA 1YLOA 5J1QA 1R3NA 2GREA 4Z65A 2QJ8A 2V8VA 4PXCA 3V38A 2AFUA 4F8ZA 1TY8A 3JZTA 3CT9A 3IFEA 2BFQA 2V8HA 7CPAA 1LFWA 2AFWA 2ZOGA 1M4LA 1VHEA 4OC4A 2FG1A 3FECA 2PJ0A 4OP4A 4A37A 2ZENA 4UIAA 5DS0A 3LWUA 5FSXA 4P4BA 4WJBA 4UIBA 1LAMA 1Z2LA 3D7DA 3VH9A 4P44A 4A39A 1SPVA 3GQEA 3MRUA 2ZEHA 3VATA 5HVHA 1ZR3A 3KI9A 4OC3A 4B6ZA 4K3NA 2PRQA 5JM6A 5FSVA 5FSYA 1YW6A 2PIYA 4CPAA 4R7MA 2AFOA 3KR5A 1TXRA 4PXEA 1XRYA 1LAPA 3VARA 3SI0A 4EWTA 3L2NA 2GU2A 3SI2A 2PJ8A 3EWPA 2C1CA 1KWMA 1YW4A 5AILA 2EK8A 3H8EA 3EW5A 2O4HA 4UEEA 1PYTB 3B3VA 4ABKA 4EFDA 4OIDA 4ZYQA 4JCAA 1ZG7A 1BAVA 2VRIA 4YU9A 2QVPA 4FUUA 3PFOA 3RZAA 2PJ2A 3PB4X 4ETKA 4WWVA 3ISXA 3GPOA 3LMSA 4R6TA 3IIFA 2PJAA 1ZR5A 3BHXA 3NFZA 5THWA 5K8MA 1Z5RA 1IGBA 1AMPA 4ZY2A 3H8GA 4IHMA 3EWRA 2CIJA 4FWUA 6CPAA 2ANPA 2DEAA 2ZEMA 3EWOA 4ZY0A 4OIWA 5DUSA 2PJ9A 4F9UA 2AFXA 3IC1A 4X8IA 1CP6A 4AXVA 1FT7A 2XD7A 4ZI6A 1ZLIA 4ZX8A 2WZNA 2V77A 2ABZA 4TU0A 3SJFA 2BO9A 2HC9A 4NGMA 3GPQA 5ELYA 5HOLA 3KR4A 4OC5A 3GQOA 3FMCA 3EKEA 4MMOA 2RFHA 2ZOFA 4ZX9A 2G9DA 2XEGA 4GVVA 3IIBA 2Q4ZA 3PBBA 2PCUA 5LRGA 1VGYA 1BPNA 5LYIA 4ONWA 2LGRA 4MRIA 3PB7X 2PJ4A 4PQAA 2F8HA 5K8PA 2BCOA 2OR4A 3FF3A 4P4FA 5JH9A 3KZWA 1TKJA 3CDXA 5LRKA 2CTCA 5CB3A 3B3SA 4J5QA 3EJFA 2V8DA 3WC5A 2POKA 3GB0A 1YSJA 4UF4A 4GUAA 3RBUA 2L8RA 2FVGA 2BOAA 3V7ZA 3B3CA 2CF4A 3FEEA 2V8GA 3I1UA 1TF8A 1ELMP 3B35A 1QMUA 3PFEA 4O23A 4IK2A 1EE3P 1Z8LA 2IQ6A 4JVVA 2ZEOA 3KHXA 3Q71A 4J5SA 1IY7A 4NGPA 2ZEDA 4NJRA 1CPSA 3EJGA 3JRUA 4BD9A 4MHZA 4A38A 5HVGA 2ZEEA 1PCAA 1ZG9A 5LYLA 4TWEA 3B3TA 3RAMA 3WC6A 2XEFA 3PB6X 4KSIA 2ZELA 4J5RA 4JZ0A 3SJGA 2IJZA 3CPXA 2GLFA 3ISZA 4PXDA 3SIHA 4MCRA 4A94A 4ZY1A 3K9TA 1R43A 2PJ1A 2PJ7A 4MCQA 4OMEA 3S9NA 2FAVA 3SIIA 1Y7EA 2F7VA 2JEWA 2OOTA 3PEIA 1ZLHA 5LYFA 3B3WA 4YWYA 3B7IA 1CP7A 2PIZA 1H8LA 2VL1A 4P4IA 1RTQA 1HDQA 3IEHA 4NGSA 2BFRA 1DTDA 3PBEA 3WT4A 5JGFA 3SIGA 5E3BA 2PJ6A 2RB7A 4NGRA 4K0CA 3S9LA 3N5FA 3EWQA 1JQGA 2ZEFA 4OKOA 3PB9X 2DX6A 3KQZA 3DGVA 1QQ9A 5CPAA 4MCPA 5IB9A 3BI0A 4NJQA 3WABA 4FAIA 5FSUA 2XEJA 5I4MA 2Q51A 4F9VA 4UMLA 2ACFA 5F09A 3S9MA 3PB8X 3HLPA 3DLJA 1VIXA 2CTBA 4TNUA 1ELLP 1Q7LA 5K8NA 1YD9A 4X3RA 1VHOA 1TXZA 4IQYA 1XFOA 3FVLA 4P4DA 3H8FA 1TKFA 1OBRA 1Y0RA 1LCPA 3D7HA 4UEFA 5HVFA 5CMSA 4RUHA 3TC8A 3NH4A 3SJXA 4P6YA 1NJRA 1HJZA 3NA6A 4MCSA 4MHNA 4OC0A 5D29A 2NSMA 2PJCA 3IIDA 3KHZA 3D7FA 3MN8A 4GM5A 1ZG8A 2QYVA 4GVWA 1LANA 3GPGA 2HB6A 3KGQA 4P10A 4JGKA 3D7GA 4OC2A 3SI1A 2ZEPA 1F57A 5LYDA 3FX6A 1Y0YA 1FNOA 1DE4C 2NYQA 4P4JA 4X2TA 2AFZA 8CPAA 5LRJA 2EWBA 2C6PA 2PJ3A 4EMEA 3CPAA 1CX8A 1ARMA 4R76A 1BPMA 2ZEGA 2PJBA 3GLJA 3FH4A 5D8NA 2IMOA 2Q43A 1UWYA 1ARLA 5K8OA 1CPXA 4Q7AA 4UEZA 4ABLA 3GUXA 4LQGA 2X47A 3NH8A 2AFSA 4IAVA 1XBUA 4G1PA 1YMEA
chains in the Genus database with same CATH superfamily
3S6KA 4NGNA 5C88A 2PE3A 3S6HA 3E0KA 4JWPA 4ESSA 2VI7A 2AFMA 2I3CA 4CAFA 5G22A 3R95A 1P0HA 3SIJA 1M4GA 2P6GA 4KOYA 4UBRA 4CYPA 3D67A 4DJLA 4E0AA 1CBXA 4MHPA 2C6GA 3EY5A 3BXMA 4A2ZA 3G8WA 3IWWA 3D66A 3VFQA 1KUVA 4F6AA 4KVXA 4XNHB 2EUIA 4PSWA 1AUGA 2PVVA 2REFA 5F49A 2AE6A 4JJXA 3TX8A 3QNVA 2PC1A 4QC6A 4M6HA 3B2YA 4NFRA 1F2PA 2JEVA 3K2KA 1NSAA 1LOKA 4R8FA 1S7LA 4J4ZA 3D68A 2WCTA 3FEDA 1HDUA 4PXBA 2JBJA 3D3SA 1PU9A 2J9AA 4KYBA 3FRMA 2EEEA 4H2KA 4B14A 4LX9A 3TFYA 4F0YA 3HUVA 3Q6ZA 4JLLA 2ATRA 3KASA 2AFCA 4OAEA 4UFXA 3V2BA 2D4OA 2KCWA 4P45A 4NGTA 3NH5A 3SHPA 1XJOA 4Q36A 4MFKA 4B5OA 4NGQA 4K30A 3BI1A 1GYTA 3B8GA 3PRTA 2FCKA 4MHYA 2B5GA 4OADA 3V45A 1TIQA 3SJEA 1Y7RA 4W9YA 4ZGYB 4UFWA 5HXDA 3D4UA 4KLVA 4M85A 1CG2A 4DNCA 3ETIA 3JUWA 1YREA 2PJ5A 2XEIA 3KL9A 2F5IA 5FSZA 5AG6A 2QECA 4RI1A 3NE8A 2FXKA 3IO1A 1IB1E 5C82A 4PPZA 1VHUA 4JYWA 3JVNA 2GLJA 4FBEA 4DUKA 1F2OA 1TKHA 1Q2CA 2HV2A 2ZXVA 4D86A 3T8WA 4P4EA 2C6CA 4CAWA 1TF9A 3R9FA 3WC7A 4MFJA 3TCVA 4DYOA 4R9MA 4R57A 1BLLE 2O53A 2VZZA 3R1KA 4L8AA 4ETJA 1FY7A 1XMBA 2HUZA 2JBKA 2PVWA 4CGOA 3VWDA 4U5YA 3IJ3A 5CBMA 5CB5A 2EK9A 2Z0ZA 5HIHA 1RXTA 2PR8A 4OC1A 1AYEA 1MJ9A 1Z4EA 2WYRA 5A28A 3KQXA 3TO9A 1XOVA 5CNPA 1HEEA 3FJUA 4MXUA 1YLOA 1S7FA 5J1QA 1R3NA 2GREA 4Z65A 3K9UA 2QJ8A 2V8VA 4PXCA 3V38A 2AFUA 2EO8A 4F8ZA 1TY8A 3JZTA 2J8NA 3CT9A 2P6FA 3PZJA 4R3KA 1S7KA 3IFEA 5DWMA 4A31A 3T90A 2FIWA 2JZEA 2BFQA 1YK3A 2Z3KA 4CRZB 1WK4A 2HQYA 2V8HA 1LFWA 3A9LA 4PV6A 2BUEA 1XEBA 2AFWA 4OLLA 2ZOGA 1M4LA 4KZTA 4XPDC 1VHEA 4BINA 4OC4A 2FG1A 1Z8XA 3FECA 2PJ0A 4QVTA 1XIXA 2JZDA 3S6GA 4OP4A 2RNKA 4A37A 2ZENA 4UIAA 5DS0A 3LWUA 5FSXA 4P4BA 4WJBA 2NMTA 4CGPA 4UIBA 2VZYA 2W2GA 1LAMA 1Z2LA 2PDOA 3D7DA 4HKFA 3VH9A 1S7NA 4P44A 4A39A 1SPVA 3GQEA 2O28A 3MRUA 2ZEHA 3OWCA 3BJ8A 4H6ZA 1MJBA 1QSTA 1ZR3A 3KI9A 4PK2A 1K4JA 3VATA 5HVHA 4MI4A 4OC3A 4B6ZA 4EVYA 4K3NA 1M1DA 2PRQA 5JM6A 5FSVA 5FSYA 4YFJA 1YW6A 4JD6A 5IX3A 1LRZA 2PIYA 4AG9A 1Z9UA 4CPAA 2CY2A 4HPSA 4R7MA 2AFOA 3KR5A 2J8RA 2OH1A 2OZGA 1JWQA 3FIXA 1TXRA 4PXEA 4UWIA 5J8FA 1XRYA 3BJ7A 1LAPA 5AGEA 5A27A 2I00A 1KUXA 1ZO0A 4KVOE 3SI0A 3VARA 3L2NA 2GU2A 4J3GA 3SI2A 4EWTA 1ON0A 4Y49C 2PJ8A 3EWPA 2C1CA 1KWMA 4YGOA 2YNDA 2BEIA 5I0CA 1YW4A 5AILA 1V0CA 2EK8A 4CGNA 3H8EA 2FL4A 4CGMA 4F0XA 3EW5A 1YX0A 2O4HA 4E2AA 4UEEA 1PYTB 3B3VA 3JTKA 5DWNA 4KOSA 4ABKA 5BWAB 4B12A 2OZHA 4EFDA 4OIDA 4ZYQA 3ZJ0A 4MFLA 1B6BA 1ZG7A 4JCAA 1BAVA 2VRIA 4YU9A 2B4BA 2G3TA 2QVPA 4FUUA 4MFZA 2J8MA 2JLMA 3PFOA 3RZAA 2PJ2A 2ARHA 5J8CA 3PB4X 4FD5A 4ETKA 3D2PA 1MJAA 4WWVA 2ZW6A 4H6UA 3ISXA 5E96A 3GPOA 4CRYB 5JQ4A 3LMSA 1J4JA 4KVME 4C2XA 4R6TA 2EBJA 3IIFA 2PJAA 1ZR5A 3BHXA 3NFZA 1Z8WA 5THWA 3S6FA 5F46A 5K8MA 1Z5RA 5KTAA 1IGBA 1AMPA 2K5TA 3W6SA 2GFQA 3KKWA 4KUBA 4ZY2A 3H8GA 2BL1A 4ZBGA 3W91A 4C7IA 4IHMA 3N7ZA 3EWRA 4M3SA 1CM0A 4MFQA 4E8OA 2CIJA 2JZFA 2ZW5A 4KOVA 4FWUA 4Q38A 6CPAA 2ANPA 2DEAA 2ZEMA 3EWOA 3C26A 4ZY0A 1YQEA 3GYAA 3IU2A 4OIWA 4KLWA 3FBUA 3H5ZA 7CPAA 5DUSA 2GANA 4UWJA 2Z10A 2PJ9A 4F9UA 2AFXA 2I79A 4HNWB 3IC1A 4X8IA 1CP6A 4AXVA 4CGLA 1FT7A 2RC4A 1IYKA 2XD7A 2Q04A 5IB0A 2C27A 5FVJA 4ZI6A 1R57A 1ZLIA 4ZX8A 2WZNA 3CXPA 3QAYA 3MGDA 2V77A 2ABZA 1BOBA 1VHSA 4TU0A 5IV0A 3SJFA 2BO9A 4UCNA 2HC9A 4NGMA 3NE7A 3SXOA 3GPQA 1IU8A 4NSQA 4CAVA 5ELYA 4KSAA 5HOLA 3KR4A 1CJWA 4OC5A 3GQOA 3FMCA 3EKEA 4MMOA 2RFHA 1XMTA 2ZOFA 2VEZA 4ZX9A 2G9DA 2XEGA 4B5PA 3EXNA 4B13A 3UY5A 4GVVA 3F5BA 3IIBA 2Q4ZA 3PBBA 2PCUA 2B3VA 3VWEA 5LRGA 1UFHA 4RS2A 1VGYA 1BPNA 5LYIA 1Y9WA 2EVNA 4A95A 4ONWA 2LGRA 4CAXA 3CXSA 4MRIA 4U9YA 1MK4A 4MJ8A 3PB7X 2PJ4A 1SQHA 2F8HA 4PQAA 4UFVA 5K8PA 2YNEA 2BCOA 2OR4A 4JXRA 1YR0A 5F48A 3FF3A 4P4FA 4NEXA 4XPDB 5JH9A 3IWEA 3KZWA 1TKJA 4FD6A 1X10A 5EC4A 3CDXA 3ZZIA 2WSAA 2Y0MA 2R98A 2ZW7A 1YLEA 4HNXB 5LRKA 2CTCA 2P6EA 5CB3A 1IOFA 3B3SA 2G0BA 4GXHA 2VXKA 2BSWA 4J5QA 3EJFA 2V8DA 3GY9A 2DF5A 2FS5A 4U9ZA 3WC5A 1Z4RA 2POKA 4ORFA 4AB7A 3GB0A 2DXQA 1YSJA 4UCMA 1KZFA 3DSBA 1M4IA 4UF4A 3DDDA 4GUAA 3RBUA 4BMHA 1QSNA 2L8RA 4FD7A 2YGWA 3D8PA 3QAHA 3LD2A 4MHDA 2FVGA 2BOAA 2A4NA 5AG7A 3RNZA 3V7ZA 1S5KA 3B3CA 2JDCA 2CF4A 1M44A 3FEEA 2V8GA 3I1UA 1TF8A 1ELMP 3B35A 3R96A 1QMUA 5GCNA 3PFEA 4O23A 2OZUA 4LQ6A 4IK2A 1EE3P 1Z8LA 2IQ6A 4JVVA 2ZEOA 4NCZA 3KHXA 3EFAA 4H89A 2R7HA 2B5GB 3Q71A 4R87A 1P4NA 3V8IA 5G20A 4J5SA 1IY7A 2CNTA 4NGPA 2ZEDA 4NJRA 1CPSA 4QUSA 5G1ZA 1NSLA 2X7BA 2OB0A 2WPXA 3P2FA 3EJGA 2B58A 2VBQA 4KSFA 3JRUA 1I12A 4BD9A 1U6MA 1YVOA 5H84A 4MHZA 4A38A 1X12A 5HVGA 2ZEEA 4IF5A 2CNSA 1I21A 1PCAA 3BLNA 3H4QA 1ZG9A 5LYLA 4TWEA 2WUUA 3B3TA 3RAMA 3WC6A 2XEFA 4R3LA 3PB6X 2FE7A 3RYOA 4KSIA 2ZELA 4C2YA 4J5RA 4JZ0A 4AVCA 3SJGA 2Q7SA 1BO4A 2IJZA 3GKRA 3R9EA 3CPXA 1GHEA 2GLFA 2Q4VA 3ISZA 4PXDA 3SIHA 1S3ZA 2YNCA 4MCRA 4A33A 4A94A 2QIRA 4ZY1A 3DR8A 3K9TA 1R43A 2PJ1A 2PJ7A 4MCQA 4OMEA 3S9NA 4AG7A 2FAVA 3DR6A 4I49A 2REEA 3SIIA 4NF1A 3EC4A 4BBHA 1Y7EA 5EMIA 2F7VA 2JEWA 2CNMA 2PQ8A 1S60A 2OOTA 3PEIA 1ZLHA 2D4PA 4GS4A 1YGHA 4A32A 5AG4A 4NXYA 5LYFA 2DPTA 3B3WA 4YWYA 2Z3LA 3B7IA 4CAEA 3IWGA 1CP7A 2FSRA 2PR1A 2PIZA 1H8LA 2VL1A 2YNCC 4P4IA 4PK3A 4C68A 3T9YA 1RTQA 1HDQA 1N71A 3FXTA 3IEHA 4NGSA 2BFRA 1DTDA 1QSOA 1VKCA 3LODA 3PBEA 3WT4A 4IUSA 4CYNA 3FYNA 4M6GA 5JGFA 3SIGA 5E3BA 2PJ6A 5EBVA 2RB7A 4JLYA 4NGRA 4K0CA 1OZPA 4XPLA 4L89A 2QMLA 3S9LA 3N5FA 3EWQA 4YRHA 1JQGA 2ZEFA 4OKOA 3RO0A 4CS0B 3PB9X 2DX6A 3KQZA 1WWZA 1QQ9A 2JDDA 2Z3NA 2OU2A 3DGVA 4MCPA 5CPAA 4QB9A 3BI0A 5IB9A 4NJQA 3G3SA 1Y9KA 2R1IA 3WABA 4FAIA 1IOIA 1IIDA 5FSUA 2XEJA 1QSMA 5I4MA 2Q51A 3CXQA 2Z3PA 4UMLA 2ACFA 4KOXA 4RN7A 4F9VA 5F09A 1Q2DA 3TE4A 3S9MA 2AJ6A 1RO5A 3PB8X 3HLPA 3DLJA 3FB3A 1VIXA 3QB8A 3DNSA 2CTBA 3GIUA 3EO4A 4TNUA 4Y49B 4HNYB 4CYOA 1ELLP 1Q7LA 5K8NA 4UA3A 4KOTA 2B4DA 4MBUA 1YD9A 2IL4A 4X3RA 1VHOA 3TOAA 1TXZA 4IQYA 1M4DA 4KS9A 3TO6A 4JXQA 1XFOA 1IYLA 3FVLA 4P4DA 4B11A 3H8FA 1TKFA 2P0WA 4MY3A 2Z3MA 3TTHA 1OBRA 1Y0RA 1LCPA 1NMTA 1Q2YA 3W6XA 3D7HA 3IU1A 4UEFA 5HVFA 5CMSA 2B3UA 4B10A 4RUHA 1I1DA 3TC8A 2Z3OA 2ZPAA 1L0CA 3R9GA 2GIVA 3NH4A 4KOWA 3P2HA 3TT2A 5H86A 3SJXA 2FIAA 1NJRA 3LACA 4P6YA 1HJZA 4CYQA 4QBJA 1QSRA 3I9SA 3IGRA 2G3AA 3NA6A 4MCSA 2ZW4A 4MHNA 2H5MA 2Q7BA 4OC0A 5D29A 2NSMA 1IICA 4MFPA 2FT0A 3D2MA 5ISVA 2PJCA 2Z11A 3IIDA 4KOUA 3KHZA 4UCPA 4II9A 4C2ZA 1A2ZA 3D7FA 3MN8A 4GM5A 1ZG8A 3I3GA 4B5PB 4XPKA 2QYVA 4GVWA 4MY0A 1LANA 3GPGA 5HMNA 2HB6A 3KGQA 1B87A 4P10A 4JGKA 3D7GA 2WPWA 4OC2A 3SI1A 1YVKA 2ZEPA 1F57A 5F47A 5KTDA 2GE3A 5LYDA 3PGPA 5JPHA 3FX6A 1Y0YA 4C7HA 1FNOA 2PRBA 2CXAA 3TOBA 1XE4A 1XF8A 1Z8TA 3SXNA 3F8KA 2Q0YA 1DE4C 2NYQA 4P4JA 2B4DB 4X2TA 2AFZA 4KUAA 8CPAA 4A30A 4ONUA 5AG5A 5LRJA 2EWBA 2C6PA 2PJ3A 4EMEA 2VQYA 3F0AA 3CPAA 5HH1A 2KQVA 1CX8A 2FXFA 1ARMA 4R76A 1BPMA 4M6IA 3WR7A 2ZEGA 4PSXA 3PP9A 2PJBA 2Q44A 3GLJA 1KUYA 4AVBA 3FH4A 4LUAA 5D8NA 2IMOA 2Q43A 1UWYA 1ARLA 4XNHC 5K8OA 1CPXA 4Q7AA 2DPSA 5KTCA 4UEZA 4FD4A 2Q4YA 4ABLA 1NE9A 2ODFA 2R8VA 1PUAA 3GUXA 2X47A 3NH8A 4KORA 4LQGA 5G21A 2AFSA 3CZXA 3FNCA 4X5KA 3TO7A 2PSWA 4IAVA 1XBUA 4G1PA 1YMEA 4AVAA
chains in the Genus database with same CATH topology
4NGNA 2PE3A 4ESSA 2AFMA 2I3CA 3SIJA 3D67A 4DJLA 1CBXA 4MHPA 2C6GA 3BXMA 3IWWA 3D66A 3VFQA 2PVVA 3TX8A 3QNVA 3B2YA 4NFRA 1F2PA 3K2KA 1NSAA 1LOKA 4R8FA 3D68A 4J4ZA 3FEDA 1HDUA 4PXBA 2JBJA 2J9AA 4KYBA 2EEEA 4H2KA 3HUVA 3Q6ZA 4JLLA 3KASA 2AFCA 3V2BA 4P45A 4NGTA 3NH5A 1XJOA 4NGQA 3BI1A 1GYTA 3PRTA 4MHYA 3V45A 3SJEA 4W9YA 5HXDA 3D4UA 1CG2A 3ETIA 2PJ5A 2XEIA 3KL9A 5FSZA 2FXKA 3IO1A 4PPZA 1VHUA 4JYWA 4FBEA 2GLJA 4DUKA 1F2OA 1TKHA 4D86A 3T8WA 4P4EA 2C6CA 1TF9A 3WC7A 4DYOA 1BLLE 2O53A 4ETJA 1XMBA 2JBKA 2PVWA 3IJ3A 5CBMA 5CB5A 2EK9A 5HIHA 4OC1A 1AYEA 2WYRA 3KQXA 1HEEA 3FJUA 4MXUA 1YLOA 5J1QA 1R3NA 2GREA 4Z65A 2QJ8A 2V8VA 4PXCA 3V38A 2AFUA 4F8ZA 1TY8A 3JZTA 3CT9A 3IFEA 2BFQA 2V8HA 7CPAA 1LFWA 2AFWA 2ZOGA 1M4LA 1VHEA 4OC4A 2FG1A 3FECA 2PJ0A 4OP4A 4A37A 2ZENA 4UIAA 5DS0A 3LWUA 5FSXA 4P4BA 4WJBA 4UIBA 1LAMA 1Z2LA 3D7DA 3VH9A 4P44A 4A39A 1SPVA 3GQEA 3MRUA 2ZEHA 3VATA 5HVHA 1ZR3A 3KI9A 4OC3A 4B6ZA 4K3NA 2PRQA 5JM6A 5FSVA 5FSYA 1YW6A 2PIYA 4CPAA 4R7MA 2AFOA 3KR5A 1TXRA 4PXEA 1XRYA 1LAPA 3VARA 3SI0A 4EWTA 3L2NA 2GU2A 3SI2A 2PJ8A 3EWPA 2C1CA 1KWMA 1YW4A 5AILA 2EK8A 3H8EA 3EW5A 2O4HA 4UEEA 1PYTB 3B3VA 4ABKA 4EFDA 4OIDA 4ZYQA 4JCAA 1ZG7A 1BAVA 2VRIA 4YU9A 2QVPA 4FUUA 3PFOA 3RZAA 2PJ2A 3PB4X 4ETKA 4WWVA 3ISXA 3GPOA 3LMSA 4R6TA 3IIFA 2PJAA 1ZR5A 3BHXA 3NFZA 5THWA 5K8MA 1Z5RA 1IGBA 1AMPA 4ZY2A 3H8GA 4IHMA 3EWRA 2CIJA 4FWUA 6CPAA 2ANPA 2DEAA 2ZEMA 3EWOA 4ZY0A 4OIWA 5DUSA 2PJ9A 4F9UA 2AFXA 3IC1A 4X8IA 1CP6A 4AXVA 1FT7A 2XD7A 4ZI6A 1ZLIA 4ZX8A 2WZNA 2V77A 2ABZA 4TU0A 3SJFA 2BO9A 2HC9A 4NGMA 3GPQA 5ELYA 5HOLA 3KR4A 4OC5A 3GQOA 3FMCA 3EKEA 4MMOA 2RFHA 2ZOFA 4ZX9A 2G9DA 2XEGA 4GVVA 3IIBA 2Q4ZA 3PBBA 2PCUA 5LRGA 1VGYA 1BPNA 5LYIA 4ONWA 2LGRA 4MRIA 3PB7X 2PJ4A 4PQAA 2F8HA 5K8PA 2BCOA 2OR4A 3FF3A 4P4FA 5JH9A 3KZWA 1TKJA 3CDXA 5LRKA 2CTCA 5CB3A 3B3SA 4J5QA 3EJFA 2V8DA 3WC5A 2POKA 3GB0A 1YSJA 4UF4A 4GUAA 3RBUA 2L8RA 2FVGA 2BOAA 3V7ZA 3B3CA 2CF4A 3FEEA 2V8GA 3I1UA 1TF8A 1ELMP 3B35A 1QMUA 3PFEA 4O23A 4IK2A 1EE3P 1Z8LA 2IQ6A 4JVVA 2ZEOA 3KHXA 3Q71A 4J5SA 1IY7A 4NGPA 2ZEDA 4NJRA 1CPSA 3EJGA 3JRUA 4BD9A 4MHZA 4A38A 5HVGA 2ZEEA 1PCAA 1ZG9A 5LYLA 4TWEA 3B3TA 3RAMA 3WC6A 2XEFA 3PB6X 4KSIA 2ZELA 4J5RA 4JZ0A 3SJGA 2IJZA 3CPXA 2GLFA 3ISZA 4PXDA 3SIHA 4MCRA 4A94A 4ZY1A 3K9TA 1R43A 2PJ1A 2PJ7A 4MCQA 4OMEA 3S9NA 2FAVA 3SIIA 1Y7EA 2F7VA 2JEWA 2OOTA 3PEIA 1ZLHA 5LYFA 3B3WA 4YWYA 3B7IA 1CP7A 2PIZA 1H8LA 2VL1A 4P4IA 1RTQA 1HDQA 3IEHA 4NGSA 2BFRA 1DTDA 3PBEA 3WT4A 5JGFA 3SIGA 5E3BA 2PJ6A 2RB7A 4NGRA 4K0CA 3S9LA 3N5FA 3EWQA 1JQGA 2ZEFA 4OKOA 3PB9X 2DX6A 3KQZA 3DGVA 1QQ9A 5CPAA 4MCPA 5IB9A 3BI0A 4NJQA 3WABA 4FAIA 5FSUA 2XEJA 5I4MA 2Q51A 4F9VA 4UMLA 2ACFA 5F09A 3S9MA 3PB8X 3HLPA 3DLJA 1VIXA 2CTBA 4TNUA 1ELLP 1Q7LA 5K8NA 1YD9A 4X3RA 1VHOA 1TXZA 4IQYA 1XFOA 3FVLA 4P4DA 3H8FA 1TKFA 1OBRA 1Y0RA 1LCPA 3D7HA 4UEFA 5HVFA 5CMSA 4RUHA 3TC8A 3NH4A 3SJXA 4P6YA 1NJRA 1HJZA 3NA6A 4MCSA 4MHNA 4OC0A 5D29A 2NSMA 2PJCA 3IIDA 3KHZA 3D7FA 3MN8A 4GM5A 1ZG8A 2QYVA 4GVWA 1LANA 3GPGA 2HB6A 3KGQA 4P10A 4JGKA 3D7GA 4OC2A 3SI1A 2ZEPA 1F57A 5LYDA 3FX6A 1Y0YA 1FNOA 1DE4C 2NYQA 4P4JA 4X2TA 2AFZA 8CPAA 5LRJA 2EWBA 2C6PA 2PJ3A 4EMEA 3CPAA 1CX8A 1ARMA 4R76A 1BPMA 2ZEGA 2PJBA 3GLJA 3FH4A 5D8NA 2IMOA 2Q43A 1UWYA 1ARLA 5K8OA 1CPXA 4Q7AA 4UEZA 4ABLA 3GUXA 4LQGA 2X47A 3NH8A 2AFSA 4IAVA 1XBUA 4G1PA 1YMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGN A;  2PE3 A;  4ESS A;  2AFM A;  2I3C A;  3SIJ A;  3D67 A;  4DJL A;  1CBX A;  4MHP A;  2C6G A;  3BXM A;  3IWW A;  3D66 A;  3VFQ A;  2PVV A;  3TX8 A;  3QNV A;  3B2Y A;  4NFR A;  1F2P A;  3K2K A;  1NSA A;  1LOK A;  4R8F A;  3D68 A;  4J4Z A;  3FED A;  1HDU A;  4PXB A;  2JBJ A;  2J9A A;  4KYB A;  2EEE A;  4H2K A;  3HUV A;  3Q6Z A;  4JLL A;  3KAS A;  2AFC A;  3V2B A;  4P45 A;  4NGT A;  3NH5 A;  1XJO A;  4NGQ A;  3BI1 A;  1GYT A;  3PRT A;  4MHY A;  3V45 A;  3SJE A;  4W9Y A;  5HXD A;  3D4U A;  1CG2 A;  3ETI A;  2PJ5 A;  2XEI A;  3KL9 A;  5FSZ A;  2FXK A;  3IO1 A;  4PPZ A;  1VHU A;  4JYW A;  4FBE A;  2GLJ A;  4DUK A;  1F2O A;  1TKH A;  4D86 A;  3T8W A;  4P4E A;  2C6C A;  1TF9 A;  3WC7 A;  4DYO A;  1BLL E;  2O53 A;  4ETJ A;  1XMB A;  2JBK A;  2PVW A;  3IJ3 A;  5CBM A;  5CB5 A;  2EK9 A;  5HIH A;  4OC1 A;  1AYE A;  2WYR A;  3KQX A;  1HEE A;  3FJU A;  4MXU A;  1YLO A;  5J1Q A;  1R3N A;  2GRE A;  4Z65 A;  2QJ8 A;  2V8V A;  4PXC A;  3V38 A;  2AFU A;  4F8Z A;  1TY8 A;  3JZT A;  3CT9 A;  3IFE A;  2BFQ A;  2V8H A;  7CPA A;  1LFW A;  2AFW A;  2ZOG A;  1M4L A;  1VHE A;  4OC4 A;  2FG1 A;  3FEC A;  2PJ0 A;  4OP4 A;  4A37 A;  2ZEN A;  4UIA A;  5DS0 A;  3LWU A;  5FSX A;  4P4B A;  4WJB A;  4UIB A;  1LAM A;  1Z2L A;  3D7D A;  3VH9 A;  4P44 A;  4A39 A;  1SPV A;  3GQE A;  3MRU A;  2ZEH A;  3VAT A;  5HVH A;  1ZR3 A;  3KI9 A;  4OC3 A;  4B6Z A;  4K3N A;  2PRQ A;  5JM6 A;  5FSV A;  5FSY A;  1YW6 A;  2PIY A;  4CPA A;  4R7M A;  2AFO A;  3KR5 A;  1TXR A;  4PXE A;  1XRY A;  1LAP A;  3VAR A;  3SI0 A;  4EWT A;  3L2N A;  2GU2 A;  3SI2 A;  2PJ8 A;  3EWP A;  2C1C A;  1KWM A;  1YW4 A;  5AIL A;  2EK8 A;  3H8E A;  3EW5 A;  2O4H A;  4UEE A;  1PYT B;  3B3V A;  4ABK A;  4EFD A;  4OID A;  4ZYQ A;  4JCA A;  1ZG7 A;  1BAV A;  2VRI A;  4YU9 A;  2QVP A;  4FUU A;  3PFO A;  3RZA A;  2PJ2 A;  3PB4 X;  4ETK A;  4WWV A;  3ISX A;  3GPO A;  3LMS A;  4R6T A;  3IIF A;  2PJA A;  1ZR5 A;  3BHX A;  3NFZ A;  5THW A;  5K8M A;  1Z5R A;  1IGB A;  1AMP A;  4ZY2 A;  3H8G A;  4IHM A;  3EWR A;  2CIJ A;  4FWU A;  6CPA A;  2ANP A;  2DEA A;  2ZEM A;  3EWO A;  4ZY0 A;  4OIW A;  5DUS A;  2PJ9 A;  4F9U A;  2AFX A;  3IC1 A;  4X8I A;  1CP6 A;  4AXV A;  1FT7 A;  2XD7 A;  4ZI6 A;  1ZLI A;  4ZX8 A;  2WZN A;  2V77 A;  2ABZ A;  4TU0 A;  3SJF A;  2BO9 A;  2HC9 A;  4NGM A;  3GPQ A;  5ELY A;  5HOL A;  3KR4 A;  4OC5 A;  3GQO A;  3FMC A;  3EKE A;  4MMO A;  2RFH A;  2ZOF A;  4ZX9 A;  2G9D A;  2XEG A;  4GVV A;  3IIB A;  2Q4Z A;  3PBB A;  2PCU A;  5LRG A;  1VGY A;  1BPN A;  5LYI A;  4ONW A;  2LGR A;  4MRI A;  3PB7 X;  2PJ4 A;  4PQA A;  2F8H A;  5K8P A;  2BCO A;  2OR4 A;  3FF3 A;  4P4F A;  5JH9 A;  3KZW A;  1TKJ A;  3CDX A;  5LRK A;  2CTC A;  5CB3 A;  3B3S A;  4J5Q A;  3EJF A;  2V8D A;  3WC5 A;  2POK A;  3GB0 A;  1YSJ A;  4UF4 A;  4GUA A;  3RBU A;  2L8R A;  2FVG A;  2BOA A;  3V7Z A;  3B3C A;  2CF4 A;  3FEE A;  2V8G A;  3I1U A;  1TF8 A;  1ELM P;  3B35 A;  1QMU A;  3PFE A;  4O23 A;  4IK2 A;  1EE3 P;  1Z8L A;  2IQ6 A;  4JVV A;  2ZEO A;  3KHX A;  3Q71 A;  4J5S A;  1IY7 A;  4NGP A;  2ZED A;  4NJR A;  1CPS A;  3EJG A;  3JRU A;  4BD9 A;  4MHZ A;  4A38 A;  5HVG A;  2ZEE A;  1PCA A;  1ZG9 A;  5LYL A;  4TWE A;  3B3T A;  3RAM A;  3WC6 A;  2XEF A;  3PB6 X;  4KSI A;  2ZEL A;  4J5R A;  4JZ0 A;  3SJG A;  2IJZ A;  3CPX A;  2GLF A;  3ISZ A;  4PXD A;  3SIH A;  4MCR A;  4A94 A;  4ZY1 A;  3K9T A;  1R43 A;  2PJ1 A;  2PJ7 A;  4MCQ A;  4OME A;  3S9N A;  2FAV A;  3SII A;  1Y7E A;  2F7V A;  2JEW A;  2OOT A;  3PEI A;  1ZLH A;  5LYF A;  3B3W A;  4YWY A;  3B7I A;  1CP7 A;  2PIZ A;  1H8L A;  2VL1 A;  4P4I A;  1RTQ A;  1HDQ A;  3IEH A;  4NGS A;  2BFR A;  1DTD A;  3PBE A;  3WT4 A;  5JGF A;  3SIG A;  5E3B A;  2PJ6 A;  2RB7 A;  4NGR A;  4K0C A;  3S9L A;  3N5F A;  3EWQ A;  1JQG A;  2ZEF A;  4OKO A;  3PB9 X;  2DX6 A;  3KQZ A;  3DGV A;  1QQ9 A;  5CPA A;  4MCP A;  5IB9 A;  3BI0 A;  4NJQ A;  3WAB A;  4FAI A;  5FSU A;  2XEJ A;  5I4M A;  2Q51 A;  4F9V A;  4UML A;  2ACF A;  5F09 A;  3S9M A;  3PB8 X;  3HLP A;  3DLJ A;  1VIX A;  2CTB A;  4TNU A;  1ELL P;  1Q7L A;  5K8N A;  1YD9 A;  4X3R A;  1VHO A;  1TXZ A;  4IQY A;  1XFO A;  3FVL A;  4P4D A;  3H8F A;  1TKF A;  1OBR A;  1Y0R A;  1LCP A;  3D7H A;  4UEF A;  5HVF A;  5CMS A;  4RUH A;  3TC8 A;  3NH4 A;  3SJX A;  4P6Y A;  1NJR A;  1HJZ A;  3NA6 A;  4MCS A;  4MHN A;  4OC0 A;  5D29 A;  2NSM A;  2PJC A;  3IID A;  3KHZ A;  3D7F A;  3MN8 A;  4GM5 A;  1ZG8 A;  2QYV A;  4GVW A;  1LAN A;  3GPG A;  2HB6 A;  3KGQ A;  4P10 A;  4JGK A;  3D7G A;  4OC2 A;  3SI1 A;  2ZEP A;  1F57 A;  5LYD A;  3FX6 A;  1Y0Y A;  1FNO A;  1DE4 C;  2NYQ A;  4P4J A;  4X2T A;  2AFZ A;  8CPA A;  5LRJ A;  2EWB A;  2C6P A;  2PJ3 A;  4EME A;  3CPA A;  1CX8 A;  1ARM A;  4R76 A;  1BPM A;  2ZEG A;  2PJB A;  3GLJ A;  3FH4 A;  5D8N A;  2IMO A;  2Q43 A;  1UWY A;  1ARL A;  5K8O A;  1CPX A;  4Q7A A;  4UEZ A;  4ABL A;  3GUX A;  4LQG A;  2X47 A;  3NH8 A;  2AFS A;  4IAV A;  1XBU A;  4G1P A;  1YME A; 
#chains in the Genus database with same CATH topology
 3S6K A;  4NGN A;  5C88 A;  2PE3 A;  3S6H A;  3E0K A;  4JWP A;  4ESS A;  2VI7 A;  2AFM A;  2I3C A;  4CAF A;  5G22 A;  3R95 A;  1P0H A;  3SIJ A;  1M4G A;  2P6G A;  4KOY A;  4UBR A;  4CYP A;  3D67 A;  4DJL A;  4E0A A;  1CBX A;  4MHP A;  2C6G A;  3EY5 A;  3BXM A;  4A2Z A;  3G8W A;  3IWW A;  3D66 A;  3VFQ A;  1KUV A;  4F6A A;  4KVX A;  4XNH B;  2EUI A;  4PSW A;  1AUG A;  2PVV A;  2REF A;  5F49 A;  2AE6 A;  4JJX A;  3TX8 A;  3QNV A;  2PC1 A;  4QC6 A;  4M6H A;  3B2Y A;  4NFR A;  1F2P A;  2JEV A;  3K2K A;  1NSA A;  1LOK A;  4R8F A;  1S7L A;  4J4Z A;  3D68 A;  2WCT A;  3FED A;  1HDU A;  4PXB A;  2JBJ A;  3D3S A;  1PU9 A;  2J9A A;  4KYB A;  3FRM A;  2EEE A;  4H2K A;  4B14 A;  4LX9 A;  3TFY A;  4F0Y A;  3HUV A;  3Q6Z A;  4JLL A;  2ATR A;  3KAS A;  2AFC A;  4OAE A;  4UFX A;  3V2B A;  2D4O A;  2KCW A;  4P45 A;  4NGT A;  3NH5 A;  3SHP A;  1XJO A;  4Q36 A;  4MFK A;  4B5O A;  4NGQ A;  4K30 A;  3BI1 A;  1GYT A;  3B8G A;  3PRT A;  2FCK A;  4MHY A;  2B5G A;  4OAD A;  3V45 A;  1TIQ A;  3SJE A;  1Y7R A;  4W9Y A;  4ZGY B;  4UFW A;  5HXD A;  3D4U A;  4KLV A;  4M85 A;  1CG2 A;  4DNC A;  3ETI A;  3JUW A;  1YRE A;  2PJ5 A;  2XEI A;  3KL9 A;  2F5I A;  5FSZ A;  5AG6 A;  2QEC A;  4RI1 A;  3NE8 A;  2FXK A;  3IO1 A;  1IB1 E;  5C82 A;  4PPZ A;  1VHU A;  4JYW A;  3JVN A;  2GLJ A;  4FBE A;  4DUK A;  1F2O A;  1TKH A;  1Q2C A;  2HV2 A;  2ZXV A;  4D86 A;  3T8W A;  4P4E A;  2C6C A;  4CAW A;  1TF9 A;  3R9F A;  3WC7 A;  4MFJ A;  3TCV A;  4DYO A;  4R9M A;  4R57 A;  1BLL E;  2O53 A;  2VZZ A;  3R1K A;  4L8A A;  4ETJ A;  1FY7 A;  1XMB A;  2HUZ A;  2JBK A;  2PVW A;  4CGO A;  3VWD A;  4U5Y A;  3IJ3 A;  5CBM A;  5CB5 A;  2EK9 A;  2Z0Z A;  5HIH A;  1RXT A;  2PR8 A;  4OC1 A;  1AYE A;  1MJ9 A;  1Z4E A;  2WYR A;  5A28 A;  3KQX A;  3TO9 A;  1XOV A;  5CNP A;  1HEE A;  3FJU A;  4MXU A;  1YLO A;  1S7F A;  5J1Q A;  1R3N A;  2GRE A;  4Z65 A;  3K9U A;  2QJ8 A;  2V8V A;  4PXC A;  3V38 A;  2AFU A;  2EO8 A;  4F8Z A;  1TY8 A;  3JZT A;  2J8N A;  3CT9 A;  2P6F A;  3PZJ A;  4R3K A;  1S7K A;  3IFE A;  5DWM A;  4A31 A;  3T90 A;  2FIW A;  2JZE A;  2BFQ A;  1YK3 A;  2Z3K A;  4CRZ B;  1WK4 A;  2HQY A;  2V8H A;  1LFW A;  3A9L A;  4PV6 A;  2BUE A;  1XEB A;  2AFW A;  4OLL A;  2ZOG A;  1M4L A;  4KZT A;  4XPD C;  1VHE A;  4BIN A;  4OC4 A;  2FG1 A;  1Z8X A;  3FEC A;  2PJ0 A;  4QVT A;  1XIX A;  2JZD A;  3S6G A;  4OP4 A;  2RNK A;  4A37 A;  2ZEN A;  4UIA A;  5DS0 A;  3LWU A;  5FSX A;  4P4B A;  4WJB A;  2NMT A;  4CGP A;  4UIB A;  2VZY A;  2W2G A;  1LAM A;  1Z2L A;  2PDO A;  3D7D A;  4HKF A;  3VH9 A;  1S7N A;  4P44 A;  4A39 A;  1SPV A;  3GQE A;  2O28 A;  3MRU A;  2ZEH A;  3OWC A;  3BJ8 A;  4H6Z A;  1MJB A;  1QST A;  1ZR3 A;  3KI9 A;  4PK2 A;  1K4J A;  3VAT A;  5HVH A;  4MI4 A;  4OC3 A;  4B6Z A;  4EVY A;  4K3N A;  1M1D A;  2PRQ A;  5JM6 A;  5FSV A;  5FSY A;  4YFJ A;  1YW6 A;  4JD6 A;  5IX3 A;  1LRZ A;  2PIY A;  4AG9 A;  1Z9U A;  4CPA A;  2CY2 A;  4HPS A;  4R7M A;  2AFO A;  3KR5 A;  2J8R A;  2OH1 A;  2OZG A;  1JWQ A;  3FIX A;  1TXR A;  4PXE A;  4UWI A;  5J8F A;  1XRY A;  3BJ7 A;  1LAP A;  5AGE A;  5A27 A;  2I00 A;  1KUX A;  1ZO0 A;  4KVO E;  3SI0 A;  3VAR A;  3L2N A;  2GU2 A;  4J3G A;  3SI2 A;  4EWT A;  1ON0 A;  4Y49 C;  2PJ8 A;  3EWP A;  2C1C A;  1KWM A;  4YGO A;  2YND A;  2BEI A;  5I0C A;  1YW4 A;  5AIL A;  1V0C A;  2EK8 A;  4CGN A;  3H8E A;  2FL4 A;  4CGM A;  4F0X A;  3EW5 A;  1YX0 A;  2O4H A;  4E2A A;  4UEE A;  1PYT B;  3B3V A;  3JTK A;  5DWN A;  4KOS A;  4ABK A;  5BWA B;  4B12 A;  2OZH A;  4EFD A;  4OID A;  4ZYQ A;  3ZJ0 A;  4MFL A;  1B6B A;  1ZG7 A;  4JCA A;  1BAV A;  2VRI A;  4YU9 A;  2B4B A;  2G3T A;  2QVP A;  4FUU A;  4MFZ A;  2J8M A;  2JLM A;  3PFO A;  3RZA A;  2PJ2 A;  2ARH A;  5J8C A;  3PB4 X;  4FD5 A;  4ETK A;  3D2P A;  1MJA A;  4WWV A;  2ZW6 A;  4H6U A;  3ISX A;  5E96 A;  3GPO A;  4CRY B;  5JQ4 A;  3LMS A;  1J4J A;  4KVM E;  4C2X A;  4R6T A;  2EBJ A;  3IIF A;  2PJA A;  1ZR5 A;  3BHX A;  3NFZ A;  1Z8W A;  5THW A;  3S6F A;  5F46 A;  5K8M A;  1Z5R A;  5KTA A;  1IGB A;  1AMP A;  2K5T A;  3W6S A;  2GFQ A;  3KKW A;  4KUB A;  4ZY2 A;  3H8G A;  2BL1 A;  4ZBG A;  3W91 A;  4C7I A;  4IHM A;  3N7Z A;  3EWR A;  4M3S A;  1CM0 A;  4MFQ A;  4E8O A;  2CIJ A;  2JZF A;  2ZW5 A;  4KOV A;  4FWU A;  4Q38 A;  6CPA A;  2ANP A;  2DEA A;  2ZEM A;  3EWO A;  3C26 A;  4ZY0 A;  1YQE A;  3GYA A;  3IU2 A;  4OIW A;  4KLW A;  3FBU A;  3H5Z A;  7CPA A;  5DUS A;  2GAN A;  4UWJ A;  2Z10 A;  2PJ9 A;  4F9U A;  2AFX A;  2I79 A;  4HNW B;  3IC1 A;  4X8I A;  1CP6 A;  4AXV A;  4CGL A;  1FT7 A;  2RC4 A;  1IYK A;  2XD7 A;  2Q04 A;  5IB0 A;  2C27 A;  5FVJ A;  4ZI6 A;  1R57 A;  1ZLI A;  4ZX8 A;  2WZN A;  3CXP A;  3QAY A;  3MGD A;  2V77 A;  2ABZ A;  1BOB A;  1VHS A;  4TU0 A;  5IV0 A;  3SJF A;  2BO9 A;  4UCN A;  2HC9 A;  4NGM A;  3NE7 A;  3SXO A;  3GPQ A;  1IU8 A;  4NSQ A;  4CAV A;  5ELY A;  4KSA A;  5HOL A;  3KR4 A;  1CJW A;  4OC5 A;  3GQO A;  3FMC A;  3EKE A;  4MMO A;  2RFH A;  1XMT A;  2ZOF A;  2VEZ A;  4ZX9 A;  2G9D A;  2XEG A;  4B5P A;  3EXN A;  4B13 A;  3UY5 A;  4GVV A;  3F5B A;  3IIB A;  2Q4Z A;  3PBB A;  2PCU A;  2B3V A;  3VWE A;  5LRG A;  1UFH A;  4RS2 A;  1VGY A;  1BPN A;  5LYI A;  1Y9W A;  2EVN A;  4A95 A;  4ONW A;  2LGR A;  4CAX A;  3CXS A;  4MRI A;  4U9Y A;  1MK4 A;  4MJ8 A;  3PB7 X;  2PJ4 A;  1SQH A;  2F8H A;  4PQA A;  4UFV A;  5K8P A;  2YNE A;  2BCO A;  2OR4 A;  4JXR A;  1YR0 A;  5F48 A;  3FF3 A;  4P4F A;  4NEX A;  4XPD B;  5JH9 A;  3IWE A;  3KZW A;  1TKJ A;  4FD6 A;  1X10 A;  5EC4 A;  3CDX A;  3ZZI A;  2WSA A;  2Y0M A;  2R98 A;  2ZW7 A;  1YLE A;  4HNX B;  5LRK A;  2CTC A;  2P6E A;  5CB3 A;  1IOF A;  3B3S A;  2G0B A;  4GXH A;  2VXK A;  2BSW A;  4J5Q A;  3EJF A;  2V8D A;  3GY9 A;  2DF5 A;  2FS5 A;  4U9Z A;  3WC5 A;  1Z4R A;  2POK A;  4ORF A;  4AB7 A;  3GB0 A;  2DXQ A;  1YSJ A;  4UCM A;  1KZF A;  3DSB A;  1M4I A;  4UF4 A;  3DDD A;  4GUA A;  3RBU A;  4BMH A;  1QSN A;  2L8R A;  4FD7 A;  2YGW A;  3D8P A;  3QAH A;  3LD2 A;  4MHD A;  2FVG A;  2BOA A;  2A4N A;  5AG7 A;  3RNZ A;  3V7Z A;  1S5K A;  3B3C A;  2JDC A;  2CF4 A;  1M44 A;  3FEE A;  2V8G A;  3I1U A;  1TF8 A;  1ELM P;  3B35 A;  3R96 A;  1QMU A;  5GCN A;  3PFE A;  4O23 A;  2OZU A;  4LQ6 A;  4IK2 A;  1EE3 P;  1Z8L A;  2IQ6 A;  4JVV A;  2ZEO A;  4NCZ A;  3KHX A;  3EFA A;  4H89 A;  2R7H A;  2B5G B;  3Q71 A;  4R87 A;  1P4N A;  3V8I A;  5G20 A;  4J5S A;  1IY7 A;  2CNT A;  4NGP A;  2ZED A;  4NJR A;  1CPS A;  4QUS A;  5G1Z A;  1NSL A;  2X7B A;  2OB0 A;  2WPX A;  3P2F A;  3EJG A;  2B58 A;  2VBQ A;  4KSF A;  3JRU A;  1I12 A;  4BD9 A;  1U6M A;  1YVO A;  5H84 A;  4MHZ A;  4A38 A;  1X12 A;  5HVG A;  2ZEE A;  4IF5 A;  2CNS A;  1I21 A;  1PCA A;  3BLN A;  3H4Q A;  1ZG9 A;  5LYL A;  4TWE A;  2WUU A;  3B3T A;  3RAM A;  3WC6 A;  2XEF A;  4R3L A;  3PB6 X;  2FE7 A;  3RYO A;  4KSI A;  2ZEL A;  4C2Y A;  4J5R A;  4JZ0 A;  4AVC A;  3SJG A;  2Q7S A;  1BO4 A;  2IJZ A;  3GKR A;  3R9E A;  3CPX A;  1GHE A;  2GLF A;  2Q4V A;  3ISZ A;  4PXD A;  3SIH A;  1S3Z A;  2YNC A;  4MCR A;  4A33 A;  4A94 A;  2QIR A;  4ZY1 A;  3DR8 A;  3K9T A;  1R43 A;  2PJ1 A;  2PJ7 A;  4MCQ A;  4OME A;  3S9N A;  4AG7 A;  2FAV A;  3DR6 A;  4I49 A;  2REE A;  3SII A;  4NF1 A;  3EC4 A;  4BBH A;  1Y7E A;  5EMI A;  2F7V A;  2JEW A;  2CNM A;  2PQ8 A;  1S60 A;  2OOT A;  3PEI A;  1ZLH A;  2D4P A;  4GS4 A;  1YGH A;  4A32 A;  5AG4 A;  4NXY A;  5LYF A;  2DPT A;  3B3W A;  4YWY A;  2Z3L A;  3B7I A;  4CAE A;  3IWG A;  1CP7 A;  2FSR A;  2PR1 A;  2PIZ A;  1H8L A;  2VL1 A;  2YNC C;  4P4I A;  4PK3 A;  4C68 A;  3T9Y A;  1RTQ A;  1HDQ A;  1N71 A;  3FXT A;  3IEH A;  4NGS A;  2BFR A;  1DTD A;  1QSO A;  1VKC A;  3LOD A;  3PBE A;  3WT4 A;  4IUS A;  4CYN A;  3FYN A;  4M6G A;  5JGF A;  3SIG A;  5E3B A;  2PJ6 A;  5EBV A;  2RB7 A;  4JLY A;  4NGR A;  4K0C A;  1OZP A;  4XPL A;  4L89 A;  2QML A;  3S9L A;  3N5F A;  3EWQ A;  4YRH A;  1JQG A;  2ZEF A;  4OKO A;  3RO0 A;  4CS0 B;  3PB9 X;  2DX6 A;  3KQZ A;  1WWZ A;  1QQ9 A;  2JDD A;  2Z3N A;  2OU2 A;  3DGV A;  4MCP A;  5CPA A;  4QB9 A;  3BI0 A;  5IB9 A;  4NJQ A;  3G3S A;  1Y9K A;  2R1I A;  3WAB A;  4FAI A;  1IOI A;  1IID A;  5FSU A;  2XEJ A;  1QSM A;  5I4M A;  2Q51 A;  3CXQ A;  2Z3P A;  4UML A;  2ACF A;  4KOX A;  4RN7 A;  4F9V A;  5F09 A;  1Q2D A;  3TE4 A;  3S9M A;  2AJ6 A;  1RO5 A;  3PB8 X;  3HLP A;  3DLJ A;  3FB3 A;  1VIX A;  3QB8 A;  3DNS A;  2CTB A;  3GIU A;  3EO4 A;  4TNU A;  4Y49 B;  4HNY B;  4CYO A;  1ELL P;  1Q7L A;  5K8N A;  4UA3 A;  4KOT A;  2B4D A;  4MBU A;  1YD9 A;  2IL4 A;  4X3R A;  1VHO A;  3TOA A;  1TXZ A;  4IQY A;  1M4D A;  4KS9 A;  3TO6 A;  4JXQ A;  1XFO A;  1IYL A;  3FVL A;  4P4D A;  4B11 A;  3H8F A;  1TKF A;  2P0W A;  4MY3 A;  2Z3M A;  3TTH A;  1OBR A;  1Y0R A;  1LCP A;  1NMT A;  1Q2Y A;  3W6X A;  3D7H A;  3IU1 A;  4UEF A;  5HVF A;  5CMS A;  2B3U A;  4B10 A;  4RUH A;  1I1D A;  3TC8 A;  2Z3O A;  2ZPA A;  1L0C A;  3R9G A;  2GIV A;  3NH4 A;  4KOW A;  3P2H A;  3TT2 A;  5H86 A;  3SJX A;  2FIA A;  1NJR A;  3LAC A;  4P6Y A;  1HJZ A;  4CYQ A;  4QBJ A;  1QSR A;  3I9S A;  3IGR A;  2G3A A;  3NA6 A;  4MCS A;  2ZW4 A;  4MHN A;  2H5M A;  2Q7B A;  4OC0 A;  5D29 A;  2NSM A;  1IIC A;  4MFP A;  2FT0 A;  3D2M A;  5ISV A;  2PJC A;  2Z11 A;  3IID A;  4KOU A;  3KHZ A;  4UCP A;  4II9 A;  4C2Z A;  1A2Z A;  3D7F A;  3MN8 A;  4GM5 A;  1ZG8 A;  3I3G A;  4B5P B;  4XPK A;  2QYV A;  4GVW A;  4MY0 A;  1LAN A;  3GPG A;  5HMN A;  2HB6 A;  3KGQ A;  1B87 A;  4P10 A;  4JGK A;  3D7G A;  2WPW A;  4OC2 A;  3SI1 A;  1YVK A;  2ZEP A;  1F57 A;  5F47 A;  5KTD A;  2GE3 A;  5LYD A;  3PGP A;  5JPH A;  3FX6 A;  1Y0Y A;  4C7H A;  1FNO A;  2PRB A;  2CXA A;  3TOB A;  1XE4 A;  1XF8 A;  1Z8T A;  3SXN A;  3F8K A;  2Q0Y A;  1DE4 C;  2NYQ A;  4P4J A;  2B4D B;  4X2T A;  2AFZ A;  4KUA A;  8CPA A;  4A30 A;  4ONU A;  5AG5 A;  5LRJ A;  2EWB A;  2C6P A;  2PJ3 A;  4EME A;  2VQY A;  3F0A A;  3CPA A;  5HH1 A;  2KQV A;  1CX8 A;  2FXF A;  1ARM A;  4R76 A;  1BPM A;  4M6I A;  3WR7 A;  2ZEG A;  4PSX A;  3PP9 A;  2PJB A;  2Q44 A;  3GLJ A;  1KUY A;  4AVB A;  3FH4 A;  4LUA A;  5D8N A;  2IMO A;  2Q43 A;  1UWY A;  1ARL A;  4XNH C;  5K8O A;  1CPX A;  4Q7A A;  2DPS A;  5KTC A;  4UEZ A;  4FD4 A;  2Q4Y A;  4ABL A;  1NE9 A;  2ODF A;  2R8V A;  1PUA A;  3GUX A;  2X47 A;  3NH8 A;  4KOR A;  4LQG A;  5G21 A;  2AFS A;  3CZX A;  3FNC A;  4X5K A;  3TO7 A;  2PSW A;  4IAV A;  1XBU A;  4G1P A;  1YME A;  4AVA A; 
#chains in the Genus database with same CATH homology
 4NGN A;  2PE3 A;  4ESS A;  2AFM A;  2I3C A;  3SIJ A;  3D67 A;  4DJL A;  1CBX A;  4MHP A;  2C6G A;  3BXM A;  3IWW A;  3D66 A;  3VFQ A;  2PVV A;  3TX8 A;  3QNV A;  3B2Y A;  4NFR A;  1F2P A;  3K2K A;  1NSA A;  1LOK A;  4R8F A;  3D68 A;  4J4Z A;  3FED A;  1HDU A;  4PXB A;  2JBJ A;  2J9A A;  4KYB A;  2EEE A;  4H2K A;  3HUV A;  3Q6Z A;  4JLL A;  3KAS A;  2AFC A;  3V2B A;  4P45 A;  4NGT A;  3NH5 A;  1XJO A;  4NGQ A;  3BI1 A;  1GYT A;  3PRT A;  4MHY A;  3V45 A;  3SJE A;  4W9Y A;  5HXD A;  3D4U A;  1CG2 A;  3ETI A;  2PJ5 A;  2XEI A;  3KL9 A;  5FSZ A;  2FXK A;  3IO1 A;  4PPZ A;  1VHU A;  4JYW A;  4FBE A;  2GLJ A;  4DUK A;  1F2O A;  1TKH A;  4D86 A;  3T8W A;  4P4E A;  2C6C A;  1TF9 A;  3WC7 A;  4DYO A;  1BLL E;  2O53 A;  4ETJ A;  1XMB A;  2JBK A;  2PVW A;  3IJ3 A;  5CBM A;  5CB5 A;  2EK9 A;  5HIH A;  4OC1 A;  1AYE A;  2WYR A;  3KQX A;  1HEE A;  3FJU A;  4MXU A;  1YLO A;  5J1Q A;  1R3N A;  2GRE A;  4Z65 A;  2QJ8 A;  2V8V A;  4PXC A;  3V38 A;  2AFU A;  4F8Z A;  1TY8 A;  3JZT A;  3CT9 A;  3IFE A;  2BFQ A;  2V8H A;  7CPA A;  1LFW A;  2AFW A;  2ZOG A;  1M4L A;  1VHE A;  4OC4 A;  2FG1 A;  3FEC A;  2PJ0 A;  4OP4 A;  4A37 A;  2ZEN A;  4UIA A;  5DS0 A;  3LWU A;  5FSX A;  4P4B A;  4WJB A;  4UIB A;  1LAM A;  1Z2L A;  3D7D A;  3VH9 A;  4P44 A;  4A39 A;  1SPV A;  3GQE A;  3MRU A;  2ZEH A;  3VAT A;  5HVH A;  1ZR3 A;  3KI9 A;  4OC3 A;  4B6Z A;  4K3N A;  2PRQ A;  5JM6 A;  5FSV A;  5FSY A;  1YW6 A;  2PIY A;  4CPA A;  4R7M A;  2AFO A;  3KR5 A;  1TXR A;  4PXE A;  1XRY A;  1LAP A;  3VAR A;  3SI0 A;  4EWT A;  3L2N A;  2GU2 A;  3SI2 A;  2PJ8 A;  3EWP A;  2C1C A;  1KWM A;  1YW4 A;  5AIL A;  2EK8 A;  3H8E A;  3EW5 A;  2O4H A;  4UEE A;  1PYT B;  3B3V A;  4ABK A;  4EFD A;  4OID A;  4ZYQ A;  4JCA A;  1ZG7 A;  1BAV A;  2VRI A;  4YU9 A;  2QVP A;  4FUU A;  3PFO A;  3RZA A;  2PJ2 A;  3PB4 X;  4ETK A;  4WWV A;  3ISX A;  3GPO A;  3LMS A;  4R6T A;  3IIF A;  2PJA A;  1ZR5 A;  3BHX A;  3NFZ A;  5THW A;  5K8M A;  1Z5R A;  1IGB A;  1AMP A;  4ZY2 A;  3H8G A;  4IHM A;  3EWR A;  2CIJ A;  4FWU A;  6CPA A;  2ANP A;  2DEA A;  2ZEM A;  3EWO A;  4ZY0 A;  4OIW A;  5DUS A;  2PJ9 A;  4F9U A;  2AFX A;  3IC1 A;  4X8I A;  1CP6 A;  4AXV A;  1FT7 A;  2XD7 A;  4ZI6 A;  1ZLI A;  4ZX8 A;  2WZN A;  2V77 A;  2ABZ A;  4TU0 A;  3SJF A;  2BO9 A;  2HC9 A;  4NGM A;  3GPQ A;  5ELY A;  5HOL A;  3KR4 A;  4OC5 A;  3GQO A;  3FMC A;  3EKE A;  4MMO A;  2RFH A;  2ZOF A;  4ZX9 A;  2G9D A;  2XEG A;  4GVV A;  3IIB A;  2Q4Z A;  3PBB A;  2PCU A;  5LRG A;  1VGY A;  1BPN A;  5LYI A;  4ONW A;  2LGR A;  4MRI A;  3PB7 X;  2PJ4 A;  4PQA A;  2F8H A;  5K8P A;  2BCO A;  2OR4 A;  3FF3 A;  4P4F A;  5JH9 A;  3KZW A;  1TKJ A;  3CDX A;  5LRK A;  2CTC A;  5CB3 A;  3B3S A;  4J5Q A;  3EJF A;  2V8D A;  3WC5 A;  2POK A;  3GB0 A;  1YSJ A;  4UF4 A;  4GUA A;  3RBU A;  2L8R A;  2FVG A;  2BOA A;  3V7Z A;  3B3C A;  2CF4 A;  3FEE A;  2V8G A;  3I1U A;  1TF8 A;  1ELM P;  3B35 A;  1QMU A;  3PFE A;  4O23 A;  4IK2 A;  1EE3 P;  1Z8L A;  2IQ6 A;  4JVV A;  2ZEO A;  3KHX A;  3Q71 A;  4J5S A;  1IY7 A;  4NGP A;  2ZED A;  4NJR A;  1CPS A;  3EJG A;  3JRU A;  4BD9 A;  4MHZ A;  4A38 A;  5HVG A;  2ZEE A;  1PCA A;  1ZG9 A;  5LYL A;  4TWE A;  3B3T A;  3RAM A;  3WC6 A;  2XEF A;  3PB6 X;  4KSI A;  2ZEL A;  4J5R A;  4JZ0 A;  3SJG A;  2IJZ A;  3CPX A;  2GLF A;  3ISZ A;  4PXD A;  3SIH A;  4MCR A;  4A94 A;  4ZY1 A;  3K9T A;  1R43 A;  2PJ1 A;  2PJ7 A;  4MCQ A;  4OME A;  3S9N A;  2FAV A;  3SII A;  1Y7E A;  2F7V A;  2JEW A;  2OOT A;  3PEI A;  1ZLH A;  5LYF A;  3B3W A;  4YWY A;  3B7I A;  1CP7 A;  2PIZ A;  1H8L A;  2VL1 A;  4P4I A;  1RTQ A;  1HDQ A;  3IEH A;  4NGS A;  2BFR A;  1DTD A;  3PBE A;  3WT4 A;  5JGF A;  3SIG A;  5E3B A;  2PJ6 A;  2RB7 A;  4NGR A;  4K0C A;  3S9L A;  3N5F A;  3EWQ A;  1JQG A;  2ZEF A;  4OKO A;  3PB9 X;  2DX6 A;  3KQZ A;  3DGV A;  1QQ9 A;  5CPA A;  4MCP A;  5IB9 A;  3BI0 A;  4NJQ A;  3WAB A;  4FAI A;  5FSU A;  2XEJ A;  5I4M A;  2Q51 A;  4F9V A;  4UML A;  2ACF A;  5F09 A;  3S9M A;  3PB8 X;  3HLP A;  3DLJ A;  1VIX A;  2CTB A;  4TNU A;  1ELL P;  1Q7L A;  5K8N A;  1YD9 A;  4X3R A;  1VHO A;  1TXZ A;  4IQY A;  1XFO A;  3FVL A;  4P4D A;  3H8F A;  1TKF A;  1OBR A;  1Y0R A;  1LCP A;  3D7H A;  4UEF A;  5HVF A;  5CMS A;  4RUH A;  3TC8 A;  3NH4 A;  3SJX A;  4P6Y A;  1NJR A;  1HJZ A;  3NA6 A;  4MCS A;  4MHN A;  4OC0 A;  5D29 A;  2NSM A;  2PJC A;  3IID A;  3KHZ A;  3D7F A;  3MN8 A;  4GM5 A;  1ZG8 A;  2QYV A;  4GVW A;  1LAN A;  3GPG A;  2HB6 A;  3KGQ A;  4P10 A;  4JGK A;  3D7G A;  4OC2 A;  3SI1 A;  2ZEP A;  1F57 A;  5LYD A;  3FX6 A;  1Y0Y A;  1FNO A;  1DE4 C;  2NYQ A;  4P4J A;  4X2T A;  2AFZ A;  8CPA A;  5LRJ A;  2EWB A;  2C6P A;  2PJ3 A;  4EME A;  3CPA A;  1CX8 A;  1ARM A;  4R76 A;  1BPM A;  2ZEG A;  2PJB A;  3GLJ A;  3FH4 A;  5D8N A;  2IMO A;  2Q43 A;  1UWY A;  1ARL A;  5K8O A;  1CPX A;  4Q7A A;  4UEZ A;  4ABL A;  3GUX A;  4LQG A;  2X47 A;  3NH8 A;  2AFS A;  4IAV A;  1XBU A;  4G1P A;  1YME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...