3KR4A

Structure of a protease 3
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
519
structure length
518
Chain Sequence
ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords M17 leucyl aminopeptidase
publication title Structure of the Plasmodium falciparum M17 aminopeptidase and significance for the design of drugs targeting the neutral exopeptidases
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 177
structure length 518
sequence length 519
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3kr4A01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3kr4A02
2ABZA 4PPZA 2V8DA 4IQYA 3D68A 2FAVA 1XBUA 4WWVA 2AFOA 3B3SA 1VHUA 3HUVA 4OC3A 2X47A 3KI9A 5HXDA 1OBRA 3D7GA 4TNUA 3N5FA 4GVWA 3BI0A 4UEEA 3LMSA 3ISZA 4A94A 4KSIA 4J5RA 3H8GA 2PJ1A 3D66A 4FBEA 3VFQA 2CTBA 2Q51A 4A38A 4F8ZA 2XEGA 5HOLA 2PJBA 1R43A 1TF9A 1Y0RA 4JVVA 2PJCA 1ZLIA 3FF3A 2EWBA 4OIDA 3SJXA 3EWOA 3ETIA 2WYRA 4MCSA 1Z2LA 4P44A 5D8NA 4NFRA 8CPAA 5LRJA 4BD9A 4MHNA 3MRUA 3FEDA 3WC7A 3SJFA 2AFUA 3ISXA 4ONWA 3IC1A 3PRTA 2ZELA 4UIBA 4KYBA 3B7IA 4TU0A 2O53A 2PJ5A 3FVLA 1GYTA 1Y7EA 2V8HA 3JRUA 1Z8LA 2VRIA 3DLJA 2HC9A 5HVFA 1RTQA 4RUHA 4MXUA 2AFMA 2BFRA 3VARA 4NGMA 5FSXA 3CT9A 4Q7AA 3B3CA 2PVWA 1CPXA 4ZX8A 4NGPA 2QYVA 3SI2A 4UEZA 3Q71A 4J5SA 4P4EA 3SIGA 2ZEMA 5JH9A 4WJBA 2PE3A 1XFOA 2BOAA 1Z5RA 4MHZA 3EW5A 1TY8A 3EKEA 1ZG7A 5K8OA 1F2PA 2PJ6A 3S9LA 4X2TA 2ZEGA 4NGTA 3PFOA 2PIZA 2ZEOA 3D7FA 3B3TA 2POKA 4H2KA 4OC0A 4NGSA 3B35A 2F8HA 2PJ4A 3WT4A 1HJZA 4UEFA 4EWTA 4P4FA 2OR4A 1VIXA 4J5QA 4IHMA 4DJLA 1NSAA 1TKJA 3DGVA 3GQEA 3KHXA 3GQOA 1HDUA 2PJ8A 2C1CA 4R76A 1YD9A 4MRIA 1ELMP 2EEEA 1ZG9A 3PBEA 2ZENA 2XEIA 4JCAA 4P4BA 2F7VA 1UWYA 3IIDA 3VH9A 3VATA 1CBXA 1YLOA 2V8VA 3Q6ZA 4ABLA 2NYQA 3B2YA 2RFHA 2AFSA 3RZAA 1CP7A 2PIYA 1IY7A 1NJRA 5K8NA 1AYEA 2NSMA 2ZEDA 3IWWA 2BFQA 3D7DA 5JM6A 4MCRA 1AMPA 1LANA 3D4UA 3H8FA 1VHOA 1R3NA 4NGNA 4ETJA 5ELYA 1ZLHA 5JGFA 2ACFA 2ZOGA 3RAMA 1XRYA 3EWRA 3H8EA 5LRGA 4JYWA 1JQGA 1EE3P 1BLLE 2OOTA 3NH8A 1DTDA 3IJ3A 3SJGA 2PJ0A 4P6YA 4FUUA 1VHEA 4R6TA 3KQZA 3T8WA 1TF8A 5FSVA 4JZ0A 1LCPA 1BPMA 4K3NA 4MMOA 4OMEA 3SIIA 2C6PA 2V8GA 2VL1A 4OC2A 1CX8A 1HDQA 3SJEA 3LWUA 3KR4A 2ZEPA 3FECA 3KQXA 2JBKA 3BHXA 3IFEA 1VGYA 4CPAA 4P4IA 2DEAA 3FMCA 4NGQA 4ZI6A 4ESSA 3PB6X 3NFZA 3V38A 6CPAA 3EJFA 1IGBA 5K8MA 5AILA 4PQAA 2DX6A 5K8PA 5LYFA 5E3BA 4GM5A 1CG2A 5FSYA 3QNVA 3KHZA 4A39A 3PB9X 3NH5A 3KR5A 2LGRA 2ZOFA 1CP6A 3FH4A 5J1QA 4ETKA 4UMLA 3EJGA 3IIBA 4DUKA 3SIJA 4G1PA 2BO9A 5HVHA 2PJ9A 5DUSA 4P4JA 3IIFA 4JGKA 1FNOA 3B3WA 4EFDA 5CB3A 3S9NA 1LAMA 4FAIA 2ZEEA 1M4LA 1LAPA 4ZY0A 1XMBA 2PJ2A 2V77A 4ZY1A 2XD7A 1H8LA 3GB0A 1BPNA 3MN8A 4P45A 3CPXA 1FT7A 3PBBA 3SI1A 3PB7X 4OIWA 4O23A 5FSZA 1F2OA 2AFWA 3FX6A 1DE4C 3CDXA 1KWMA 4P10A 2L8RA 2HB6A 2XEJA 3EWPA 2PJ3A 2ZEHA 2BCOA 3KASA 3RBUA 4EMEA 2AFXA 2XEFA 5LYDA 2Q43A 3BI1A 2IQ6A 1ARLA 3IO1A 4DYOA 3SI0A 3HLPA 3PEIA 2FVGA 4NJQA 1CPSA 3S9MA 3K2KA 1HEEA 4PXDA 4X8IA 2IJZA 4MHYA 4AXVA 4PXBA 2GLFA 1LOKA 4OP4A 1ARMA 1XJOA 2QVPA 2G9DA 3WC6A 3JZTA 3V7ZA 2O4HA 2EK8A 4W9YA 5LRKA 4PXCA 1TXZA 2IMOA 4GUAA 3L2NA 3KGQA 3PB8X 4MHPA 3BXMA 3D7HA 2JBJA 5DS0A 4LQGA 2I3CA 4ZX9A 4MCPA 1ZG8A 1LFWA 4OC1A 1QMUA 1YMEA 4NJRA 5F09A 4D86A 1YSJA 5HVGA 2C6CA 3FJUA 4F9UA 2GU2A 3GPGA 3GLJA 4ZYQA 1PCAA 7CPAA 5HIHA 4GVVA 1TKFA 5LYIA 1SPVA 3GPOA 2PRQA 4YWYA 3GPQA 2FXKA 3SIHA 4OC5A 4ZY2A 4IK2A 5D29A 1QQ9A 3KZWA 4MCQA 5CPAA 2Q4ZA 4FWUA 3EWQA 3FEEA 4UF4A 4ABKA 4B6ZA 1ELLP 5CMSA 4Z65A 4IAVA 2CIJA 3CPAA 5LYLA 1ZR5A 3PB4X 4JLLA 2CTCA 4P4DA 4PXEA 4J4ZA 1PYTB 1YW4A 2RB7A 3D67A 1ZR3A 5FSUA 2EK9A 2J9AA 4F9VA 4X3RA 3B3VA 3NH4A 5I4MA 4A37A 4R7MA 4R8FA 1BAVA 2PVVA 3TX8A 4YU9A 2PJ7A 4UIAA 5THWA 1TKHA 3GUXA 4TWEA 1YW6A 2ANPA 4NGRA 3IEHA 3TC8A 2FG1A 2CF4A 4K0CA 5IB9A 2C6GA 5CB5A 1Q7LA 3WABA 1Y0YA 3V45A 1F57A 2AFZA 3K9TA 3KL9A 2JEWA 2QJ8A 2PCUA 2ZEFA 2PJAA 3NA6A 2GLJA 4OC4A 2WZNA 3WC5A 2GREA 2AFCA 4OKOA 3V2BA 5CBMA 3I1UA 3PFEA 1TXRA
chains in the Genus database with same CATH superfamily
2ABZA 2QIRA 4PPZA 2R1IA 1N71A 2V8DA 4IQYA 3D68A 1Z4RA 4UA3A 4B13A 2G3AA 4UWIA 4H6UA 3V8IA 1L0CA 2CXAA 2FAVA 2F5IA 3F8KA 1IOIA 1XBUA 4WWVA 2AFOA 4BBHA 4CRZB 3B3SA 1VHUA 4HNXB 2CNMA 3C26A 3G3SA 1B87A 3HUVA 4OC3A 2X47A 3KI9A 4MFLA 4LUAA 5HXDA 1OBRA 3D7GA 4TNUA 3N5FA 4GVWA 1IIDA 1S7KA 3BI0A 4UEEA 2YNCA 3F0AA 3LMSA 1ZO0A 3ISZA 4OADA 2OU2A 4A94A 3BJ7A 4KSIA 1IYKA 4J5RA 2REEA 2ZW6A 3BLNA 4YRHA 3H8GA 2PJ1A 1S7FA 2BSWA 3D66A 4FBEA 3TO7A 3VFQA 2CTBA 2FXFA 4L8AA 4XNHC 1P4NA 2Q51A 2B4DA 4A38A 4F8ZA 1QSMA 2XEGA 4ORFA 5HOLA 2PJBA 4Q36A 1R43A 1TF9A 1Y0RA 4JVVA 2EBJA 2PJCA 1ZLIA 3FF3A 4KOSA 2EWBA 4OIDA 2PR1A 4NXYA 5G21A 3SJXA 3EWOA 1Y7RA 3ETIA 2WYRA 4MCSA 4R3LA 1Z2LA 5AGEA 2ZW5A 4P44A 4FD7A 4KUAA 4LQ6A 5D8NA 2VZZA 4C7IA 4NFRA 4GS4A 8CPAA 5LRJA 4QB9A 2OZHA 2GFQA 4BD9A 5J8CA 3GYAA 4MHNA 3MRUA 2EVNA 1Q2CA 3FEDA 3WC7A 2B4BA 3SJFA 4F0XA 4CAEA 1MJ9A 3FRMA 3IGRA 2AFUA 3ISXA 4ONWA 2Z3LA 3IC1A 3PRTA 2ZELA 4UIBA 4KYBA 1V0CA 3B7IA 4TU0A 3JUWA 3F5BA 2O53A 2PJ5A 3FVLA 1GYTA 1Y7EA 2V8HA 3RNZA 4XPKA 5KTCA 5KTDA 2Z10A 4CYOA 2Q04A 3DR8A 3NE8A 3JRUA 1Z8LA 4LX9A 2VRIA 3DLJA 2HC9A 5HVFA 1JWQA 1RTQA 1IYLA 1RXTA 4RUHA 2I00A 4MXUA 3JVNA 2AFMA 2BFRA 3VARA 4NGMA 3BJ8A 2JLMA 5DWNA 5FSXA 4RI1A 3CT9A 4Q7AA 3B3CA 1ON0A 2PVWA 1S7NA 3G8WA 4MFPA 2GIVA 4NEXA 3TCVA 1QSRA 3TO9A 1CPXA 4ZX8A 4NGPA 4A2ZA 2QYVA 4JLYA 3SHPA 1MK4A 3SI2A 4FD5A 2G3TA 4UEZA 3Q71A 4A95A 4J5SA 1X12A 4FD4A 3W6SA 4P4EA 1XE4A 3SIGA 4PSWA 2ZEMA 4I49A 1BO4A 5JH9A 2REFA 2X7BA 4B5PB 4WJBA 2VI7A 2PE3A 1XFOA 2BOAA 4KOTA 4PV6A 5AG7A 2J8MA 4C7HA 1Z5RA 4MHZA 3EW5A 1TY8A 2BEIA 4GXHA 3EKEA 1ZG7A 2PRBA 1GHEA 4B5OA 1M4IA 4CS0B 2YNEA 3FXTA 5IB0A 1F2PA 2PJ6A 4AVCA 4X2TA 2ZEGA 4NGTA 3S9LA 3PFOA 2Z3OA 2PIZA 2KQVA 3I3GA 2ZEOA 3D7FA 3S6GA 2RNKA 1I12A 3B3TA 4FD6A 2POKA 3E0KA 4H2KA 2P6GA 4OC0A 4NGSA 2F8HA 2FIWA 3B35A 2PJ4A 4B14A 1X10A 2FT0A 4HNWB 2G0BA 1HJZA 4UCMA 4UEFA 2JDDA 3WT4A 2Q4VA 2DPSA 4EWTA 3PP9A 1IB1E 2OR4A 4P4FA 3FNCA 3TTHA 2Y0MA 1VIXA 4J5QA 4IHMA 4H6ZA 2DF5A 2GE3A 4DJLA 1NSAA 4KSAA 4AG9A 4CGPA 4B12A 1TKJA 3QB8A 2PQ8A 4QVTA 3DGVA 2EUIA 3GQEA 3KHXA 3GQOA 4KVXA 1HDUA 2PJ8A 5HMNA 2AE6A 2C1CA 4R76A 1YD9A 3CZXA 4MRIA 4A30A 3RO0A 4L89A 1J4JA 1ELMP 4AB7A 5JPHA 2EEEA 4KS9A 3ZJ0A 1ZG9A 3PBEA 1M44A 2ZENA 2XEIA 4JCAA 1M1DA 4P4BA 2F7VA 1UWYA 3IIDA 3VH9A 2VZYA 2OB0A 3VATA 1CBXA 2JZFA 1QSOA 1YLOA 2YNCC 4CAFA 2V8VA 4Y49C 3Q6ZA 4ABLA 2NYQA 2KCWA 2Z3PA 3B2YA 2RFHA 2AFSA 4NCZA 3TT2A 3RZAA 4CAWA 1YQEA 3P2HA 2AJ6A 1CP7A 5JQ4A 4OAEA 1IOFA 3EC4A 2JEVA 2PIYA 1IY7A 1NJRA 4ZGYB 4CAXA 4ONUA 5K8NA 2JZDA 1AYEA 2YNDA 3VWEA 1WK4A 2NSMA 4YGOA 3H4QA 2ZEDA 3IWWA 2BFQA 3D7DA 1WWZA 4KOXA 4MCRA 5JM6A 1AMPA 1LANA 3D4UA 4XNHB 4KVME 1Z8TA 3H8FA 4JXQA 1VHOA 1R3NA 4R57A 3MGDA 4NGNA 4ETJA 5ELYA 1Z8XA 1ZLHA 2ACFA 2ZOGA 3GIUA 4HPSA 5JGFA 1S3ZA 4DNCA 3RAMA 4C68A 3FIXA 1XRYA 4M85A 3EWRA 3H8EA 1QSNA 2VQYA 5KTAA 2ZPAA 1YREA 2ARHA 4UCNA 1YX0A 2WPWA 4CAVA 5LRGA 4JYWA 4CYQA 1JQGA 1EE3P 5G1ZA 1BLLE 2OOTA 4JD6A 3NH8A 4C2XA 4HKFA 2HQYA 4OLLA 1MJBA 4KVOE 1DTDA 3IJ3A 2J8RA 3SJGA 2PJ0A 4CGOA 4P6YA 1UFHA 4FUUA 5FVJA 1VHEA 4R6TA 4YFJA 4UFVA 3KQZA 4QUSA 5AG4A 3NE7A 3FBUA 3T8WA 1Q2DA 1TF8A 5FSVA 4JZ0A 1LCPA 2B3UA 2DXQA 5F48A 1BPMA 4K3NA 4MMOA 3IWGA 4OMEA 3SIIA 2Z0ZA 4R3KA 2C6PA 2V8GA 2VL1A 2OZUA 4OC2A 4ZBGA 4BINA 5I0CA 1CX8A 1YVKA 1HDQA 3SJEA 3LWUA 2B58A 3EY5A 3KR4A 1XMTA 2K5TA 1KUVA 3KQXA 2JBKA 2ZEPA 3FECA 3BHXA 4IF5A 5AG6A 4II9A 1IU8A 3IFEA 4PK3A 1VGYA 4MHDA 2FIAA 3LD2A 4P4IA 4B11A 4CPAA 2DEAA 2QECA 3FMCA 2HUZA 4NGQA 4ZI6A 4ESSA 3PB6X 2Z3NA 3NFZA 3V38A 3EJFA 1IGBA 3CXPA 3D2MA 3ZZIA 3IU1A 5AILA 5IX3A 2OH1A 5K8MA 4PQAA 4EVYA 2DX6A 5DWMA 5K8PA 2I79A 2R8VA 3H5ZA 1U6MA 5LYFA 2JZEA 5E3BA 4CGMA 4GM5A 3R96A 1CG2A 5FSYA 3QNVA 3KHZA 4A39A 3PB9X 5C82A 3NH5A 3KR5A 4KZTA 2LGRA 1KZFA 2ZOFA 1CP6A 2HV2A 3EFAA 3FH4A 5J1QA 4ETKA 3DSBA 2CY2A 4UMLA 4KOUA 4MJ8A 1BOBA 3FB3A 3EJGA 3IIBA 3TE4A 4DUKA 3SIJA 2R98A 4A31A 4G1PA 4UBRA 2BO9A 4A33A 5HVHA 2PJ9A 2ZW4A 1Z9UA 5DUSA 3DDDA 4XPDC 5E96A 5A27A 2CNSA 4P4JA 5AG5A 4KUBA 1P0HA 1TIQA 3IIFA 4JGKA 1AUGA 2FL4A 1FNOA 3LACA 3D8PA 2P0WA 3B3WA 5G20A 4EFDA 3IWEA 2IL4A 4MBUA 5CB3A 3S9NA 5A28A 1QSTA 1LAMA 4FAIA 1M4LA 2RC4A 1LAPA 2ZEEA 1Z8WA 3QAHA 4ZY0A 1XMBA 4MFZA 2PJ2A 4QBJA 1NMTA 2V77A 1XF8A 4ZY1A 2P6EA 2XD7A 1H8LA 3GB0A 1BPNA 3LODA 3MN8A 3T9YA 4P45A 1KUXA 1FT7A 1Q2YA 3CPXA 1FY7A 4M6HA 3PBBA 3SI1A 3PB7X 4OIWA 4O23A 5FSZA 2Q7BA 3SXOA 4CYNA 5J8FA 1F2OA 4Y49B 4CGNA 2AFWA 1KUYA 1PUAA 3FX6A 1DE4C 3CDXA 3DR6A 1KWMA 4P10A 4JJXA 4U9ZA 2FE7A 4E0AA 4B10A 2L8RA 4KORA 2HB6A 2XEJA 3EWPA 2PJ3A 4MFQA 1YVOA 2ZEHA 3R95A 2NMTA 4KOVA 2BCOA 3KASA 2VEZA 1S5KA 3RBUA 3WR7A 4U5YA 4B5PA 1K4JA 3TO6A 4EMEA 2AFXA 4UCPA 1Y9KA 2XEFA 1S7LA 3N7ZA 2Q43A 3BI1A 5LYDA 5CNPA 2IQ6A 3SXNA 1ARLA 3DNSA 1XEBA 4R87A 3IO1A 2WPXA 2W2GA 2WUUA 4DYOA 4H89A 3SI0A 2ODFA 3HLPA 3VWDA 3CXQA 3PEIA 1RO5A 2FVGA 1CM0A 4C2ZA 4NJQA 2ZW7A 1CPSA 3S9MA 2VBQA 3I9SA 2Z11A 3K2KA 3RYOA 1M4GA 1HEEA 4PXDA 2H5MA 4U9YA 2ZXVA 4E2AA 4X8IA 3R9FA 2PDOA 2IJZA 4MHYA 4AXVA 3EXNA 4F0YA 3QAYA 4PXBA 2GLFA 1LOKA 4OP4A 1NSLA 1ARMA 1XJOA 2QVPA 2R7HA 3R9GA 2G9DA 2J8NA 3IU2A 3OWCA 3WC6A 3JZTA 3K9UA 4JXRA 4KOYA 2A4NA 4JWPA 3V7ZA 4BMHA 2O4HA 3S6HA 4Q38A 2EK8A 2BUEA 4J3GA 4W9YA 3S6KA 5LRKA 3FYNA 4PXCA 1TXZA 3D2PA 2IMOA 4CGLA 4GUAA 1YK3A 3KGQA 3L2NA 3PB8X 4MHPA 3BXMA 3D7HA 2JBJA 5DS0A 5H86A 3R1KA 2D4PA 1MJAA 1I1DA 4LQGA 2I3CA 1LRZA 4ZX9A 1NE9A 2Q4YA 3P2FA 5IV0A 4MCPA 1ZG8A 3S6FA 1OZPA 1LFWA 1YGHA 4OC1A 1QMUA 1YMEA 3D3SA 4QC6A 4A32A 2O28A 1IICA 4NJRA 3TOBA 4KSFA 5F09A 4D86A 1YSJA 5EMIA 4IUSA 2C6CA 5HVGA 3FJUA 4F9UA 2GU2A 2CNTA 3W6XA 3GPGA 3JTKA 3GLJA 3A9LA 2WCTA 2OZGA 4ZYQA 3PZJA 1B6BA 1PCAA 7CPAA 2B3VA 1R57A 5HIHA 4M6GA 4GVVA 1TKFA 1S60A 5LYIA 1SPVA 3GPOA 1VHSA 2B5GB 2PRQA 4YWYA 3GPQA 4RS2A 4AVAA 2FXKA 3SIHA 4OC5A 4ZY2A 4XPDB 4IK2A 5D29A 4CYPA 3TFYA 2DPTA 1QQ9A 3KZWA 2QMLA 4MCQA 4R9MA 4RN7A 4K30A 5CPAA 2Q4ZA 6CPAA 4FWUA 3EWQA 4PSXA 3FEEA 3R9EA 4UF4A 4ABKA 4B6ZA 1ELLP 5CMSA 4E8OA 2JDCA 5EBVA 4Z65A 4IAVA 2EO8A 2CIJA 3CPAA 5K8OA 2ATRA 5LYLA 1ZR5A 2PC1A 3PB4X 1Y9WA 4JLLA 2CTCA 4HNYB 4P4DA 1YR0A 4PXEA 5EC4A 4MFKA 5G22A 4J4ZA 5C88A 1PYTB 1YW4A 2RB7A 3GKRA 4PK2A 1CJWA 2P6FA 4X5KA 2Z3KA 3D67A 1ZR3A 5H84A 5FSUA 2EK9A 2FS5A 2J9AA 5F49A 3TOAA 4F9VA 2Q44A 3B3VA 4X3RA 3NH4A 4UWJA 5I4MA 1VKCA 4A37A 2PSWA 4R7MA 2GANA 4R8FA 2FSRA 4MY3A 1BAVA 2PVVA 3TX8A 4KOWA 5F46A 3B8GA 4CRYB 4YU9A 4MY0A 2PJ7A 4UIAA 5THWA 4UFXA 3W91A 1TKHA 2PR8A 3GUXA 1A2ZA 4TWEA 4M3SA 4NF1A 1YW6A 2WSAA 4MI4A 2ANPA 4NGRA 3IEHA 1XIXA 3TC8A 2FG1A 2BL1A 2CF4A 3GY9A 4K0CA 5BWAB 5F47A 2C6GA 2FCKA 5IB9A 4F6AA 4XPLA 2VXKA 1SQHA 2B5GA 5CB5A 1I21A 1Q7LA 5GCNA 3WABA 2B4DB 1PU9A 4C2YA 2Z3MA 1Y0YA 3V45A 2D4OA 1F57A 3EO4A 4M6IA 5ISVA 2AFZA 4NSQA 2Q0YA 3K9TA 3KL9A 2JEWA 4KLWA 3T90A 3KKWA 1Z4EA 2QJ8A 4MFJA 1XOVA 2PCUA 4UFWA 2ZEFA 2Q7SA 2PJAA 3NA6A 2GLJA 4OC4A 2WZNA 3WC5A 2GREA 2AFCA 4OKOA 1M4DA 3V2BA 4AG7A 3CXSA 5HH1A 3UY5A 4AVBA 5CBMA 3I1UA 3PFEA 4KLVA 2YGWA 1YLEA 1TXRA 3PGPA 2C27A
chains in the Genus database with same CATH topology
2ABZA 4PPZA 2V8DA 4IQYA 3D68A 2FAVA 1XBUA 4WWVA 2AFOA 3B3SA 1VHUA 3HUVA 4OC3A 2X47A 3KI9A 5HXDA 1OBRA 3D7GA 4TNUA 3N5FA 4GVWA 3BI0A 4UEEA 3LMSA 3ISZA 4A94A 4KSIA 4J5RA 3H8GA 2PJ1A 3D66A 4FBEA 3VFQA 2CTBA 2Q51A 4A38A 4F8ZA 2XEGA 5HOLA 2PJBA 1R43A 1TF9A 1Y0RA 4JVVA 2PJCA 1ZLIA 3FF3A 2EWBA 4OIDA 3SJXA 3EWOA 3ETIA 2WYRA 4MCSA 1Z2LA 4P44A 5D8NA 4NFRA 8CPAA 5LRJA 4BD9A 4MHNA 3MRUA 3FEDA 3WC7A 3SJFA 2AFUA 3ISXA 4ONWA 3IC1A 3PRTA 2ZELA 4UIBA 4KYBA 3B7IA 4TU0A 2O53A 2PJ5A 3FVLA 1GYTA 1Y7EA 2V8HA 3JRUA 1Z8LA 2VRIA 3DLJA 2HC9A 5HVFA 1RTQA 4RUHA 4MXUA 2AFMA 2BFRA 3VARA 4NGMA 5FSXA 3CT9A 4Q7AA 3B3CA 2PVWA 1CPXA 4ZX8A 4NGPA 2QYVA 3SI2A 4UEZA 3Q71A 4J5SA 4P4EA 3SIGA 2ZEMA 5JH9A 4WJBA 2PE3A 1XFOA 2BOAA 1Z5RA 4MHZA 3EW5A 1TY8A 3EKEA 1ZG7A 5K8OA 1F2PA 2PJ6A 3S9LA 4X2TA 2ZEGA 4NGTA 3PFOA 2PIZA 2ZEOA 3D7FA 3B3TA 2POKA 4H2KA 4OC0A 4NGSA 3B35A 2F8HA 2PJ4A 3WT4A 1HJZA 4UEFA 4EWTA 4P4FA 2OR4A 1VIXA 4J5QA 4IHMA 4DJLA 1NSAA 1TKJA 3DGVA 3GQEA 3KHXA 3GQOA 1HDUA 2PJ8A 2C1CA 4R76A 1YD9A 4MRIA 1ELMP 2EEEA 1ZG9A 3PBEA 2ZENA 2XEIA 4JCAA 4P4BA 2F7VA 1UWYA 3IIDA 3VH9A 3VATA 1CBXA 1YLOA 2V8VA 3Q6ZA 4ABLA 2NYQA 3B2YA 2RFHA 2AFSA 3RZAA 1CP7A 2PIYA 1IY7A 1NJRA 5K8NA 1AYEA 2NSMA 2ZEDA 3IWWA 2BFQA 3D7DA 5JM6A 4MCRA 1AMPA 1LANA 3D4UA 3H8FA 1VHOA 1R3NA 4NGNA 4ETJA 5ELYA 1ZLHA 5JGFA 2ACFA 2ZOGA 3RAMA 1XRYA 3EWRA 3H8EA 5LRGA 4JYWA 1JQGA 1EE3P 1BLLE 2OOTA 3NH8A 1DTDA 3IJ3A 3SJGA 2PJ0A 4P6YA 4FUUA 1VHEA 4R6TA 3KQZA 3T8WA 1TF8A 5FSVA 4JZ0A 1LCPA 1BPMA 4K3NA 4MMOA 4OMEA 3SIIA 2C6PA 2V8GA 2VL1A 4OC2A 1CX8A 1HDQA 3SJEA 3LWUA 3KR4A 2ZEPA 3FECA 3KQXA 2JBKA 3BHXA 3IFEA 1VGYA 4CPAA 4P4IA 2DEAA 3FMCA 4NGQA 4ZI6A 4ESSA 3PB6X 3NFZA 3V38A 6CPAA 3EJFA 1IGBA 5K8MA 5AILA 4PQAA 2DX6A 5K8PA 5LYFA 5E3BA 4GM5A 1CG2A 5FSYA 3QNVA 3KHZA 4A39A 3PB9X 3NH5A 3KR5A 2LGRA 2ZOFA 1CP6A 3FH4A 5J1QA 4ETKA 4UMLA 3EJGA 3IIBA 4DUKA 3SIJA 4G1PA 2BO9A 5HVHA 2PJ9A 5DUSA 4P4JA 3IIFA 4JGKA 1FNOA 3B3WA 4EFDA 5CB3A 3S9NA 1LAMA 4FAIA 2ZEEA 1M4LA 1LAPA 4ZY0A 1XMBA 2PJ2A 2V77A 4ZY1A 2XD7A 1H8LA 3GB0A 1BPNA 3MN8A 4P45A 3CPXA 1FT7A 3PBBA 3SI1A 3PB7X 4OIWA 4O23A 5FSZA 1F2OA 2AFWA 3FX6A 1DE4C 3CDXA 1KWMA 4P10A 2L8RA 2HB6A 2XEJA 3EWPA 2PJ3A 2ZEHA 2BCOA 3KASA 3RBUA 4EMEA 2AFXA 2XEFA 5LYDA 2Q43A 3BI1A 2IQ6A 1ARLA 3IO1A 4DYOA 3SI0A 3HLPA 3PEIA 2FVGA 4NJQA 1CPSA 3S9MA 3K2KA 1HEEA 4PXDA 4X8IA 2IJZA 4MHYA 4AXVA 4PXBA 2GLFA 1LOKA 4OP4A 1ARMA 1XJOA 2QVPA 2G9DA 3WC6A 3JZTA 3V7ZA 2O4HA 2EK8A 4W9YA 5LRKA 4PXCA 1TXZA 2IMOA 4GUAA 3L2NA 3KGQA 3PB8X 4MHPA 3BXMA 3D7HA 2JBJA 5DS0A 4LQGA 2I3CA 4ZX9A 4MCPA 1ZG8A 1LFWA 4OC1A 1QMUA 1YMEA 4NJRA 5F09A 4D86A 1YSJA 5HVGA 2C6CA 3FJUA 4F9UA 2GU2A 3GPGA 3GLJA 4ZYQA 1PCAA 7CPAA 5HIHA 4GVVA 1TKFA 5LYIA 1SPVA 3GPOA 2PRQA 4YWYA 3GPQA 2FXKA 3SIHA 4OC5A 4ZY2A 4IK2A 5D29A 1QQ9A 3KZWA 4MCQA 5CPAA 2Q4ZA 4FWUA 3EWQA 3FEEA 4UF4A 4ABKA 4B6ZA 1ELLP 5CMSA 4Z65A 4IAVA 2CIJA 3CPAA 5LYLA 1ZR5A 3PB4X 4JLLA 2CTCA 4P4DA 4PXEA 4J4ZA 1PYTB 1YW4A 2RB7A 3D67A 1ZR3A 5FSUA 2EK9A 2J9AA 4F9VA 4X3RA 3B3VA 3NH4A 5I4MA 4A37A 4R7MA 4R8FA 1BAVA 2PVVA 3TX8A 4YU9A 2PJ7A 4UIAA 5THWA 1TKHA 3GUXA 4TWEA 1YW6A 2ANPA 4NGRA 3IEHA 3TC8A 2FG1A 2CF4A 4K0CA 5IB9A 2C6GA 5CB5A 1Q7LA 3WABA 1Y0YA 3V45A 1F57A 2AFZA 3K9TA 3KL9A 2JEWA 2QJ8A 2PCUA 2ZEFA 2PJAA 3NA6A 2GLJA 4OC4A 2WZNA 3WC5A 2GREA 2AFCA 4OKOA 3V2BA 5CBMA 3I1UA 3PFEA 1TXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABZ A;  4PPZ A;  2V8D A;  4IQY A;  3D68 A;  2FAV A;  1XBU A;  4WWV A;  2AFO A;  3B3S A;  1VHU A;  3HUV A;  4OC3 A;  2X47 A;  3KI9 A;  5HXD A;  1OBR A;  3D7G A;  4TNU A;  3N5F A;  4GVW A;  3BI0 A;  4UEE A;  3LMS A;  3ISZ A;  4A94 A;  4KSI A;  4J5R A;  3H8G A;  2PJ1 A;  3D66 A;  4FBE A;  3VFQ A;  2CTB A;  2Q51 A;  4A38 A;  4F8Z A;  2XEG A;  5HOL A;  2PJB A;  1R43 A;  1TF9 A;  1Y0R A;  4JVV A;  2PJC A;  1ZLI A;  3FF3 A;  2EWB A;  4OID A;  3SJX A;  3EWO A;  3ETI A;  2WYR A;  4MCS A;  1Z2L A;  4P44 A;  5D8N A;  4NFR A;  8CPA A;  5LRJ A;  4BD9 A;  4MHN A;  3MRU A;  3FED A;  3WC7 A;  3SJF A;  2AFU A;  3ISX A;  4ONW A;  3IC1 A;  3PRT A;  2ZEL A;  4UIB A;  4KYB A;  3B7I A;  4TU0 A;  2O53 A;  2PJ5 A;  3FVL A;  1GYT A;  1Y7E A;  2V8H A;  3JRU A;  1Z8L A;  2VRI A;  3DLJ A;  2HC9 A;  5HVF A;  1RTQ A;  4RUH A;  4MXU A;  2AFM A;  2BFR A;  3VAR A;  4NGM A;  5FSX A;  3CT9 A;  4Q7A A;  3B3C A;  2PVW A;  1CPX A;  4ZX8 A;  4NGP A;  2QYV A;  3SI2 A;  4UEZ A;  3Q71 A;  4J5S A;  4P4E A;  3SIG A;  2ZEM A;  5JH9 A;  4WJB A;  2PE3 A;  1XFO A;  2BOA A;  1Z5R A;  4MHZ A;  3EW5 A;  1TY8 A;  3EKE A;  1ZG7 A;  5K8O A;  1F2P A;  2PJ6 A;  3S9L A;  4X2T A;  2ZEG A;  4NGT A;  3PFO A;  2PIZ A;  2ZEO A;  3D7F A;  3B3T A;  2POK A;  4H2K A;  4OC0 A;  4NGS A;  3B35 A;  2F8H A;  2PJ4 A;  3WT4 A;  1HJZ A;  4UEF A;  4EWT A;  4P4F A;  2OR4 A;  1VIX A;  4J5Q A;  4IHM A;  4DJL A;  1NSA A;  1TKJ A;  3DGV A;  3GQE A;  3KHX A;  3GQO A;  1HDU A;  2PJ8 A;  2C1C A;  4R76 A;  1YD9 A;  4MRI A;  1ELM P;  2EEE A;  1ZG9 A;  3PBE A;  2ZEN A;  2XEI A;  4JCA A;  4P4B A;  2F7V A;  1UWY A;  3IID A;  3VH9 A;  3VAT A;  1CBX A;  1YLO A;  2V8V A;  3Q6Z A;  4ABL A;  2NYQ A;  3B2Y A;  2RFH A;  2AFS A;  3RZA A;  1CP7 A;  2PIY A;  1IY7 A;  1NJR A;  5K8N A;  1AYE A;  2NSM A;  2ZED A;  3IWW A;  2BFQ A;  3D7D A;  5JM6 A;  4MCR A;  1AMP A;  1LAN A;  3D4U A;  3H8F A;  1VHO A;  1R3N A;  4NGN A;  4ETJ A;  5ELY A;  1ZLH A;  5JGF A;  2ACF A;  2ZOG A;  3RAM A;  1XRY A;  3EWR A;  3H8E A;  5LRG A;  4JYW A;  1JQG A;  1EE3 P;  1BLL E;  2OOT A;  3NH8 A;  1DTD A;  3IJ3 A;  3SJG A;  2PJ0 A;  4P6Y A;  4FUU A;  1VHE A;  4R6T A;  3KQZ A;  3T8W A;  1TF8 A;  5FSV A;  4JZ0 A;  1LCP A;  1BPM A;  4K3N A;  4MMO A;  4OME A;  3SII A;  2C6P A;  2V8G A;  2VL1 A;  4OC2 A;  1CX8 A;  1HDQ A;  3SJE A;  3LWU A;  3KR4 A;  2ZEP A;  3FEC A;  3KQX A;  2JBK A;  3BHX A;  3IFE A;  1VGY A;  4CPA A;  4P4I A;  2DEA A;  3FMC A;  4NGQ A;  4ZI6 A;  4ESS A;  3PB6 X;  3NFZ A;  3V38 A;  6CPA A;  3EJF A;  1IGB A;  5K8M A;  5AIL A;  4PQA A;  2DX6 A;  5K8P A;  5LYF A;  5E3B A;  4GM5 A;  1CG2 A;  5FSY A;  3QNV A;  3KHZ A;  4A39 A;  3PB9 X;  3NH5 A;  3KR5 A;  2LGR A;  2ZOF A;  1CP6 A;  3FH4 A;  5J1Q A;  4ETK A;  4UML A;  3EJG A;  3IIB A;  4DUK A;  3SIJ A;  4G1P A;  2BO9 A;  5HVH A;  2PJ9 A;  5DUS A;  4P4J A;  3IIF A;  4JGK A;  1FNO A;  3B3W A;  4EFD A;  5CB3 A;  3S9N A;  1LAM A;  4FAI A;  2ZEE A;  1M4L A;  1LAP A;  4ZY0 A;  1XMB A;  2PJ2 A;  2V77 A;  4ZY1 A;  2XD7 A;  1H8L A;  3GB0 A;  1BPN A;  3MN8 A;  4P45 A;  3CPX A;  1FT7 A;  3PBB A;  3SI1 A;  3PB7 X;  4OIW A;  4O23 A;  5FSZ A;  1F2O A;  2AFW A;  3FX6 A;  1DE4 C;  3CDX A;  1KWM A;  4P10 A;  2L8R A;  2HB6 A;  2XEJ A;  3EWP A;  2PJ3 A;  2ZEH A;  2BCO A;  3KAS A;  3RBU A;  4EME A;  2AFX A;  2XEF A;  5LYD A;  2Q43 A;  3BI1 A;  2IQ6 A;  1ARL A;  3IO1 A;  4DYO A;  3SI0 A;  3HLP A;  3PEI A;  2FVG A;  4NJQ A;  1CPS A;  3S9M A;  3K2K A;  1HEE A;  4PXD A;  4X8I A;  2IJZ A;  4MHY A;  4AXV A;  4PXB A;  2GLF A;  1LOK A;  4OP4 A;  1ARM A;  1XJO A;  2QVP A;  2G9D A;  3WC6 A;  3JZT A;  3V7Z A;  2O4H A;  2EK8 A;  4W9Y A;  5LRK A;  4PXC A;  1TXZ A;  2IMO A;  4GUA A;  3L2N A;  3KGQ A;  3PB8 X;  4MHP A;  3BXM A;  3D7H A;  2JBJ A;  5DS0 A;  4LQG A;  2I3C A;  4ZX9 A;  4MCP A;  1ZG8 A;  1LFW A;  4OC1 A;  1QMU A;  1YME A;  4NJR A;  5F09 A;  4D86 A;  1YSJ A;  5HVG A;  2C6C A;  3FJU A;  4F9U A;  2GU2 A;  3GPG A;  3GLJ A;  4ZYQ A;  1PCA A;  7CPA A;  5HIH A;  4GVV A;  1TKF A;  5LYI A;  1SPV A;  3GPO A;  2PRQ A;  4YWY A;  3GPQ A;  2FXK A;  3SIH A;  4OC5 A;  4ZY2 A;  4IK2 A;  5D29 A;  1QQ9 A;  3KZW A;  4MCQ A;  5CPA A;  2Q4Z A;  4FWU A;  3EWQ A;  3FEE A;  4UF4 A;  4ABK A;  4B6Z A;  1ELL P;  5CMS A;  4Z65 A;  4IAV A;  2CIJ A;  3CPA A;  5LYL A;  1ZR5 A;  3PB4 X;  4JLL A;  2CTC A;  4P4D A;  4PXE A;  4J4Z A;  1PYT B;  1YW4 A;  2RB7 A;  3D67 A;  1ZR3 A;  5FSU A;  2EK9 A;  2J9A A;  4F9V A;  4X3R A;  3B3V A;  3NH4 A;  5I4M A;  4A37 A;  4R7M A;  4R8F A;  1BAV A;  2PVV A;  3TX8 A;  4YU9 A;  2PJ7 A;  4UIA A;  5THW A;  1TKH A;  3GUX A;  4TWE A;  1YW6 A;  2ANP A;  4NGR A;  3IEH A;  3TC8 A;  2FG1 A;  2CF4 A;  4K0C A;  5IB9 A;  2C6G A;  5CB5 A;  1Q7L A;  3WAB A;  1Y0Y A;  3V45 A;  1F57 A;  2AFZ A;  3K9T A;  3KL9 A;  2JEW A;  2QJ8 A;  2PCU A;  2ZEF A;  2PJA A;  3NA6 A;  2GLJ A;  4OC4 A;  2WZN A;  3WC5 A;  2GRE A;  2AFC A;  4OKO A;  3V2B A;  5CBM A;  3I1U A;  3PFE A;  1TXR A; 
#chains in the Genus database with same CATH topology
 2ABZ A;  2QIR A;  4PPZ A;  2R1I A;  1N71 A;  2V8D A;  4IQY A;  3D68 A;  1Z4R A;  4UA3 A;  4B13 A;  2G3A A;  4UWI A;  4H6U A;  3V8I A;  1L0C A;  2CXA A;  2FAV A;  2F5I A;  3F8K A;  1IOI A;  1XBU A;  4WWV A;  2AFO A;  4BBH A;  4CRZ B;  3B3S A;  1VHU A;  4HNX B;  2CNM A;  3C26 A;  3G3S A;  1B87 A;  3HUV A;  4OC3 A;  2X47 A;  3KI9 A;  4MFL A;  4LUA A;  5HXD A;  1OBR A;  3D7G A;  4TNU A;  3N5F A;  4GVW A;  1IID A;  1S7K A;  3BI0 A;  4UEE A;  2YNC A;  3F0A A;  3LMS A;  1ZO0 A;  3ISZ A;  4OAD A;  2OU2 A;  4A94 A;  3BJ7 A;  4KSI A;  1IYK A;  4J5R A;  2REE A;  2ZW6 A;  3BLN A;  4YRH A;  3H8G A;  2PJ1 A;  1S7F A;  2BSW A;  3D66 A;  4FBE A;  3TO7 A;  3VFQ A;  2CTB A;  2FXF A;  4L8A A;  4XNH C;  1P4N A;  2Q51 A;  2B4D A;  4A38 A;  4F8Z A;  1QSM A;  2XEG A;  4ORF A;  5HOL A;  2PJB A;  4Q36 A;  1R43 A;  1TF9 A;  1Y0R A;  4JVV A;  2EBJ A;  2PJC A;  1ZLI A;  3FF3 A;  4KOS A;  2EWB A;  4OID A;  2PR1 A;  4NXY A;  5G21 A;  3SJX A;  3EWO A;  1Y7R A;  3ETI A;  2WYR A;  4MCS A;  4R3L A;  1Z2L A;  5AGE A;  2ZW5 A;  4P44 A;  4FD7 A;  4KUA A;  4LQ6 A;  5D8N A;  2VZZ A;  4C7I A;  4NFR A;  4GS4 A;  8CPA A;  5LRJ A;  4QB9 A;  2OZH A;  2GFQ A;  4BD9 A;  5J8C A;  3GYA A;  4MHN A;  3MRU A;  2EVN A;  1Q2C A;  3FED A;  3WC7 A;  2B4B A;  3SJF A;  4F0X A;  4CAE A;  1MJ9 A;  3FRM A;  3IGR A;  2AFU A;  3ISX A;  4ONW A;  2Z3L A;  3IC1 A;  3PRT A;  2ZEL A;  4UIB A;  4KYB A;  1V0C A;  3B7I A;  4TU0 A;  3JUW A;  3F5B A;  2O53 A;  2PJ5 A;  3FVL A;  1GYT A;  1Y7E A;  2V8H A;  3RNZ A;  4XPK A;  5KTC A;  5KTD A;  2Z10 A;  4CYO A;  2Q04 A;  3DR8 A;  3NE8 A;  3JRU A;  1Z8L A;  4LX9 A;  2VRI A;  3DLJ A;  2HC9 A;  5HVF A;  1JWQ A;  1RTQ A;  1IYL A;  1RXT A;  4RUH A;  2I00 A;  4MXU A;  3JVN A;  2AFM A;  2BFR A;  3VAR A;  4NGM A;  3BJ8 A;  2JLM A;  5DWN A;  5FSX A;  4RI1 A;  3CT9 A;  4Q7A A;  3B3C A;  1ON0 A;  2PVW A;  1S7N A;  3G8W A;  4MFP A;  2GIV A;  4NEX A;  3TCV A;  1QSR A;  3TO9 A;  1CPX A;  4ZX8 A;  4NGP A;  4A2Z A;  2QYV A;  4JLY A;  3SHP A;  1MK4 A;  3SI2 A;  4FD5 A;  2G3T A;  4UEZ A;  3Q71 A;  4A95 A;  4J5S A;  1X12 A;  4FD4 A;  3W6S A;  4P4E A;  1XE4 A;  3SIG A;  4PSW A;  2ZEM A;  4I49 A;  1BO4 A;  5JH9 A;  2REF A;  2X7B A;  4B5P B;  4WJB A;  2VI7 A;  2PE3 A;  1XFO A;  2BOA A;  4KOT A;  4PV6 A;  5AG7 A;  2J8M A;  4C7H A;  1Z5R A;  4MHZ A;  3EW5 A;  1TY8 A;  2BEI A;  4GXH A;  3EKE A;  1ZG7 A;  2PRB A;  1GHE A;  4B5O A;  1M4I A;  4CS0 B;  2YNE A;  3FXT A;  5IB0 A;  1F2P A;  2PJ6 A;  4AVC A;  4X2T A;  2ZEG A;  4NGT A;  3S9L A;  3PFO A;  2Z3O A;  2PIZ A;  2KQV A;  3I3G A;  2ZEO A;  3D7F A;  3S6G A;  2RNK A;  1I12 A;  3B3T A;  4FD6 A;  2POK A;  3E0K A;  4H2K A;  2P6G A;  4OC0 A;  4NGS A;  2F8H A;  2FIW A;  3B35 A;  2PJ4 A;  4B14 A;  1X10 A;  2FT0 A;  4HNW B;  2G0B A;  1HJZ A;  4UCM A;  4UEF A;  2JDD A;  3WT4 A;  2Q4V A;  2DPS A;  4EWT A;  3PP9 A;  1IB1 E;  2OR4 A;  4P4F A;  3FNC A;  3TTH A;  2Y0M A;  1VIX A;  4J5Q A;  4IHM A;  4H6Z A;  2DF5 A;  2GE3 A;  4DJL A;  1NSA A;  4KSA A;  4AG9 A;  4CGP A;  4B12 A;  1TKJ A;  3QB8 A;  2PQ8 A;  4QVT A;  3DGV A;  2EUI A;  3GQE A;  3KHX A;  3GQO A;  4KVX A;  1HDU A;  2PJ8 A;  5HMN A;  2AE6 A;  2C1C A;  4R76 A;  1YD9 A;  3CZX A;  4MRI A;  4A30 A;  3RO0 A;  4L89 A;  1J4J A;  1ELM P;  4AB7 A;  5JPH A;  2EEE A;  4KS9 A;  3ZJ0 A;  1ZG9 A;  3PBE A;  1M44 A;  2ZEN A;  2XEI A;  4JCA A;  1M1D A;  4P4B A;  2F7V A;  1UWY A;  3IID A;  3VH9 A;  2VZY A;  2OB0 A;  3VAT A;  1CBX A;  2JZF A;  1QSO A;  1YLO A;  2YNC C;  4CAF A;  2V8V A;  4Y49 C;  3Q6Z A;  4ABL A;  2NYQ A;  2KCW A;  2Z3P A;  3B2Y A;  2RFH A;  2AFS A;  4NCZ A;  3TT2 A;  3RZA A;  4CAW A;  1YQE A;  3P2H A;  2AJ6 A;  1CP7 A;  5JQ4 A;  4OAE A;  1IOF A;  3EC4 A;  2JEV A;  2PIY A;  1IY7 A;  1NJR A;  4ZGY B;  4CAX A;  4ONU A;  5K8N A;  2JZD A;  1AYE A;  2YND A;  3VWE A;  1WK4 A;  2NSM A;  4YGO A;  3H4Q A;  2ZED A;  3IWW A;  2BFQ A;  3D7D A;  1WWZ A;  4KOX A;  4MCR A;  5JM6 A;  1AMP A;  1LAN A;  3D4U A;  4XNH B;  4KVM E;  1Z8T A;  3H8F A;  4JXQ A;  1VHO A;  1R3N A;  4R57 A;  3MGD A;  4NGN A;  4ETJ A;  5ELY A;  1Z8X A;  1ZLH A;  2ACF A;  2ZOG A;  3GIU A;  4HPS A;  5JGF A;  1S3Z A;  4DNC A;  3RAM A;  4C68 A;  3FIX A;  1XRY A;  4M85 A;  3EWR A;  3H8E A;  1QSN A;  2VQY A;  5KTA A;  2ZPA A;  1YRE A;  2ARH A;  4UCN A;  1YX0 A;  2WPW A;  4CAV A;  5LRG A;  4JYW A;  4CYQ A;  1JQG A;  1EE3 P;  5G1Z A;  1BLL E;  2OOT A;  4JD6 A;  3NH8 A;  4C2X A;  4HKF A;  2HQY A;  4OLL A;  1MJB A;  4KVO E;  1DTD A;  3IJ3 A;  2J8R A;  3SJG A;  2PJ0 A;  4CGO A;  4P6Y A;  1UFH A;  4FUU A;  5FVJ A;  1VHE A;  4R6T A;  4YFJ A;  4UFV A;  3KQZ A;  4QUS A;  5AG4 A;  3NE7 A;  3FBU A;  3T8W A;  1Q2D A;  1TF8 A;  5FSV A;  4JZ0 A;  1LCP A;  2B3U A;  2DXQ A;  5F48 A;  1BPM A;  4K3N A;  4MMO A;  3IWG A;  4OME A;  3SII A;  2Z0Z A;  4R3K A;  2C6P A;  2V8G A;  2VL1 A;  2OZU A;  4OC2 A;  4ZBG A;  4BIN A;  5I0C A;  1CX8 A;  1YVK A;  1HDQ A;  3SJE A;  3LWU A;  2B58 A;  3EY5 A;  3KR4 A;  1XMT A;  2K5T A;  1KUV A;  3KQX A;  2JBK A;  2ZEP A;  3FEC A;  3BHX A;  4IF5 A;  5AG6 A;  4II9 A;  1IU8 A;  3IFE A;  4PK3 A;  1VGY A;  4MHD A;  2FIA A;  3LD2 A;  4P4I A;  4B11 A;  4CPA A;  2DEA A;  2QEC A;  3FMC A;  2HUZ A;  4NGQ A;  4ZI6 A;  4ESS A;  3PB6 X;  2Z3N A;  3NFZ A;  3V38 A;  3EJF A;  1IGB A;  3CXP A;  3D2M A;  3ZZI A;  3IU1 A;  5AIL A;  5IX3 A;  2OH1 A;  5K8M A;  4PQA A;  4EVY A;  2DX6 A;  5DWM A;  5K8P A;  2I79 A;  2R8V A;  3H5Z A;  1U6M A;  5LYF A;  2JZE A;  5E3B A;  4CGM A;  4GM5 A;  3R96 A;  1CG2 A;  5FSY A;  3QNV A;  3KHZ A;  4A39 A;  3PB9 X;  5C82 A;  3NH5 A;  3KR5 A;  4KZT A;  2LGR A;  1KZF A;  2ZOF A;  1CP6 A;  2HV2 A;  3EFA A;  3FH4 A;  5J1Q A;  4ETK A;  3DSB A;  2CY2 A;  4UML A;  4KOU A;  4MJ8 A;  1BOB A;  3FB3 A;  3EJG A;  3IIB A;  3TE4 A;  4DUK A;  3SIJ A;  2R98 A;  4A31 A;  4G1P A;  4UBR A;  2BO9 A;  4A33 A;  5HVH A;  2PJ9 A;  2ZW4 A;  1Z9U A;  5DUS A;  3DDD A;  4XPD C;  5E96 A;  5A27 A;  2CNS A;  4P4J A;  5AG5 A;  4KUB A;  1P0H A;  1TIQ A;  3IIF A;  4JGK A;  1AUG A;  2FL4 A;  1FNO A;  3LAC A;  3D8P A;  2P0W A;  3B3W A;  5G20 A;  4EFD A;  3IWE A;  2IL4 A;  4MBU A;  5CB3 A;  3S9N A;  5A28 A;  1QST A;  1LAM A;  4FAI A;  1M4L A;  2RC4 A;  1LAP A;  2ZEE A;  1Z8W A;  3QAH A;  4ZY0 A;  1XMB A;  4MFZ A;  2PJ2 A;  4QBJ A;  1NMT A;  2V77 A;  1XF8 A;  4ZY1 A;  2P6E A;  2XD7 A;  1H8L A;  3GB0 A;  1BPN A;  3LOD A;  3MN8 A;  3T9Y A;  4P45 A;  1KUX A;  1FT7 A;  1Q2Y A;  3CPX A;  1FY7 A;  4M6H A;  3PBB A;  3SI1 A;  3PB7 X;  4OIW A;  4O23 A;  5FSZ A;  2Q7B A;  3SXO A;  4CYN A;  5J8F A;  1F2O A;  4Y49 B;  4CGN A;  2AFW A;  1KUY A;  1PUA A;  3FX6 A;  1DE4 C;  3CDX A;  3DR6 A;  1KWM A;  4P10 A;  4JJX A;  4U9Z A;  2FE7 A;  4E0A A;  4B10 A;  2L8R A;  4KOR A;  2HB6 A;  2XEJ A;  3EWP A;  2PJ3 A;  4MFQ A;  1YVO A;  2ZEH A;  3R95 A;  2NMT A;  4KOV A;  2BCO A;  3KAS A;  2VEZ A;  1S5K A;  3RBU A;  3WR7 A;  4U5Y A;  4B5P A;  1K4J A;  3TO6 A;  4EME A;  2AFX A;  4UCP A;  1Y9K A;  2XEF A;  1S7L A;  3N7Z A;  2Q43 A;  3BI1 A;  5LYD A;  5CNP A;  2IQ6 A;  3SXN A;  1ARL A;  3DNS A;  1XEB A;  4R87 A;  3IO1 A;  2WPX A;  2W2G A;  2WUU A;  4DYO A;  4H89 A;  3SI0 A;  2ODF A;  3HLP A;  3VWD A;  3CXQ A;  3PEI A;  1RO5 A;  2FVG A;  1CM0 A;  4C2Z A;  4NJQ A;  2ZW7 A;  1CPS A;  3S9M A;  2VBQ A;  3I9S A;  2Z11 A;  3K2K A;  3RYO A;  1M4G A;  1HEE A;  4PXD A;  2H5M A;  4U9Y A;  2ZXV A;  4E2A A;  4X8I A;  3R9F A;  2PDO A;  2IJZ A;  4MHY A;  4AXV A;  3EXN A;  4F0Y A;  3QAY A;  4PXB A;  2GLF A;  1LOK A;  4OP4 A;  1NSL A;  1ARM A;  1XJO A;  2QVP A;  2R7H A;  3R9G A;  2G9D A;  2J8N A;  3IU2 A;  3OWC A;  3WC6 A;  3JZT A;  3K9U A;  4JXR A;  4KOY A;  2A4N A;  4JWP A;  3V7Z A;  4BMH A;  2O4H A;  3S6H A;  4Q38 A;  2EK8 A;  2BUE A;  4J3G A;  4W9Y A;  3S6K A;  5LRK A;  3FYN A;  4PXC A;  1TXZ A;  3D2P A;  2IMO A;  4CGL A;  4GUA A;  1YK3 A;  3KGQ A;  3L2N A;  3PB8 X;  4MHP A;  3BXM A;  3D7H A;  2JBJ A;  5DS0 A;  5H86 A;  3R1K A;  2D4P A;  1MJA A;  1I1D A;  4LQG A;  2I3C A;  1LRZ A;  4ZX9 A;  1NE9 A;  2Q4Y A;  3P2F A;  5IV0 A;  4MCP A;  1ZG8 A;  3S6F A;  1OZP A;  1LFW A;  1YGH A;  4OC1 A;  1QMU A;  1YME A;  3D3S A;  4QC6 A;  4A32 A;  2O28 A;  1IIC A;  4NJR A;  3TOB A;  4KSF A;  5F09 A;  4D86 A;  1YSJ A;  5EMI A;  4IUS A;  2C6C A;  5HVG A;  3FJU A;  4F9U A;  2GU2 A;  2CNT A;  3W6X A;  3GPG A;  3JTK A;  3GLJ A;  3A9L A;  2WCT A;  2OZG A;  4ZYQ A;  3PZJ A;  1B6B A;  1PCA A;  7CPA A;  2B3V A;  1R57 A;  5HIH A;  4M6G A;  4GVV A;  1TKF A;  1S60 A;  5LYI A;  1SPV A;  3GPO A;  1VHS A;  2B5G B;  2PRQ A;  4YWY A;  3GPQ A;  4RS2 A;  4AVA A;  2FXK A;  3SIH A;  4OC5 A;  4ZY2 A;  4XPD B;  4IK2 A;  5D29 A;  4CYP A;  3TFY A;  2DPT A;  1QQ9 A;  3KZW A;  2QML A;  4MCQ A;  4R9M A;  4RN7 A;  4K30 A;  5CPA A;  2Q4Z A;  6CPA A;  4FWU A;  3EWQ A;  4PSX A;  3FEE A;  3R9E A;  4UF4 A;  4ABK A;  4B6Z A;  1ELL P;  5CMS A;  4E8O A;  2JDC A;  5EBV A;  4Z65 A;  4IAV A;  2EO8 A;  2CIJ A;  3CPA A;  5K8O A;  2ATR A;  5LYL A;  1ZR5 A;  2PC1 A;  3PB4 X;  1Y9W A;  4JLL A;  2CTC A;  4HNY B;  4P4D A;  1YR0 A;  4PXE A;  5EC4 A;  4MFK A;  5G22 A;  4J4Z A;  5C88 A;  1PYT B;  1YW4 A;  2RB7 A;  3GKR A;  4PK2 A;  1CJW A;  2P6F A;  4X5K A;  2Z3K A;  3D67 A;  1ZR3 A;  5H84 A;  5FSU A;  2EK9 A;  2FS5 A;  2J9A A;  5F49 A;  3TOA A;  4F9V A;  2Q44 A;  3B3V A;  4X3R A;  3NH4 A;  4UWJ A;  5I4M A;  1VKC A;  4A37 A;  2PSW A;  4R7M A;  2GAN A;  4R8F A;  2FSR A;  4MY3 A;  1BAV A;  2PVV A;  3TX8 A;  4KOW A;  5F46 A;  3B8G A;  4CRY B;  4YU9 A;  4MY0 A;  2PJ7 A;  4UIA A;  5THW A;  4UFX A;  3W91 A;  1TKH A;  2PR8 A;  3GUX A;  1A2Z A;  4TWE A;  4M3S A;  4NF1 A;  1YW6 A;  2WSA A;  4MI4 A;  2ANP A;  4NGR A;  3IEH A;  1XIX A;  3TC8 A;  2FG1 A;  2BL1 A;  2CF4 A;  3GY9 A;  4K0C A;  5BWA B;  5F47 A;  2C6G A;  2FCK A;  5IB9 A;  4F6A A;  4XPL A;  2VXK A;  1SQH A;  2B5G A;  5CB5 A;  1I21 A;  1Q7L A;  5GCN A;  3WAB A;  2B4D B;  1PU9 A;  4C2Y A;  2Z3M A;  1Y0Y A;  3V45 A;  2D4O A;  1F57 A;  3EO4 A;  4M6I A;  5ISV A;  2AFZ A;  4NSQ A;  2Q0Y A;  3K9T A;  3KL9 A;  2JEW A;  4KLW A;  3T90 A;  3KKW A;  1Z4E A;  2QJ8 A;  4MFJ A;  1XOV A;  2PCU A;  4UFW A;  2ZEF A;  2Q7S A;  2PJA A;  3NA6 A;  2GLJ A;  4OC4 A;  2WZN A;  3WC5 A;  2GRE A;  2AFC A;  4OKO A;  1M4D A;  3V2B A;  4AG7 A;  3CXS A;  5HH1 A;  3UY5 A;  4AVB A;  5CBM A;  3I1U A;  3PFE A;  4KLV A;  2YGW A;  1YLE A;  1TXR A;  3PGP A;  2C27 A; 
#chains in the Genus database with same CATH homology
 2ABZ A;  4PPZ A;  2V8D A;  4IQY A;  3D68 A;  2FAV A;  1XBU A;  4WWV A;  2AFO A;  3B3S A;  1VHU A;  3HUV A;  4OC3 A;  2X47 A;  3KI9 A;  5HXD A;  1OBR A;  3D7G A;  4TNU A;  3N5F A;  4GVW A;  3BI0 A;  4UEE A;  3LMS A;  3ISZ A;  4A94 A;  4KSI A;  4J5R A;  3H8G A;  2PJ1 A;  3D66 A;  4FBE A;  3VFQ A;  2CTB A;  2Q51 A;  4A38 A;  4F8Z A;  2XEG A;  5HOL A;  2PJB A;  1R43 A;  1TF9 A;  1Y0R A;  4JVV A;  2PJC A;  1ZLI A;  3FF3 A;  2EWB A;  4OID A;  3SJX A;  3EWO A;  3ETI A;  2WYR A;  4MCS A;  1Z2L A;  4P44 A;  5D8N A;  4NFR A;  8CPA A;  5LRJ A;  4BD9 A;  4MHN A;  3MRU A;  3FED A;  3WC7 A;  3SJF A;  2AFU A;  3ISX A;  4ONW A;  3IC1 A;  3PRT A;  2ZEL A;  4UIB A;  4KYB A;  3B7I A;  4TU0 A;  2O53 A;  2PJ5 A;  3FVL A;  1GYT A;  1Y7E A;  2V8H A;  3JRU A;  1Z8L A;  2VRI A;  3DLJ A;  2HC9 A;  5HVF A;  1RTQ A;  4RUH A;  4MXU A;  2AFM A;  2BFR A;  3VAR A;  4NGM A;  5FSX A;  3CT9 A;  4Q7A A;  3B3C A;  2PVW A;  1CPX A;  4ZX8 A;  4NGP A;  2QYV A;  3SI2 A;  4UEZ A;  3Q71 A;  4J5S A;  4P4E A;  3SIG A;  2ZEM A;  5JH9 A;  4WJB A;  2PE3 A;  1XFO A;  2BOA A;  1Z5R A;  4MHZ A;  3EW5 A;  1TY8 A;  3EKE A;  1ZG7 A;  5K8O A;  1F2P A;  2PJ6 A;  3S9L A;  4X2T A;  2ZEG A;  4NGT A;  3PFO A;  2PIZ A;  2ZEO A;  3D7F A;  3B3T A;  2POK A;  4H2K A;  4OC0 A;  4NGS A;  3B35 A;  2F8H A;  2PJ4 A;  3WT4 A;  1HJZ A;  4UEF A;  4EWT A;  4P4F A;  2OR4 A;  1VIX A;  4J5Q A;  4IHM A;  4DJL A;  1NSA A;  1TKJ A;  3DGV A;  3GQE A;  3KHX A;  3GQO A;  1HDU A;  2PJ8 A;  2C1C A;  4R76 A;  1YD9 A;  4MRI A;  1ELM P;  2EEE A;  1ZG9 A;  3PBE A;  2ZEN A;  2XEI A;  4JCA A;  4P4B A;  2F7V A;  1UWY A;  3IID A;  3VH9 A;  3VAT A;  1CBX A;  1YLO A;  2V8V A;  3Q6Z A;  4ABL A;  2NYQ A;  3B2Y A;  2RFH A;  2AFS A;  3RZA A;  1CP7 A;  2PIY A;  1IY7 A;  1NJR A;  5K8N A;  1AYE A;  2NSM A;  2ZED A;  3IWW A;  2BFQ A;  3D7D A;  5JM6 A;  4MCR A;  1AMP A;  1LAN A;  3D4U A;  3H8F A;  1VHO A;  1R3N A;  4NGN A;  4ETJ A;  5ELY A;  1ZLH A;  5JGF A;  2ACF A;  2ZOG A;  3RAM A;  1XRY A;  3EWR A;  3H8E A;  5LRG A;  4JYW A;  1JQG A;  1EE3 P;  1BLL E;  2OOT A;  3NH8 A;  1DTD A;  3IJ3 A;  3SJG A;  2PJ0 A;  4P6Y A;  4FUU A;  1VHE A;  4R6T A;  3KQZ A;  3T8W A;  1TF8 A;  5FSV A;  4JZ0 A;  1LCP A;  1BPM A;  4K3N A;  4MMO A;  4OME A;  3SII A;  2C6P A;  2V8G A;  2VL1 A;  4OC2 A;  1CX8 A;  1HDQ A;  3SJE A;  3LWU A;  3KR4 A;  2ZEP A;  3FEC A;  3KQX A;  2JBK A;  3BHX A;  3IFE A;  1VGY A;  4CPA A;  4P4I A;  2DEA A;  3FMC A;  4NGQ A;  4ZI6 A;  4ESS A;  3PB6 X;  3NFZ A;  3V38 A;  6CPA A;  3EJF A;  1IGB A;  5K8M A;  5AIL A;  4PQA A;  2DX6 A;  5K8P A;  5LYF A;  5E3B A;  4GM5 A;  1CG2 A;  5FSY A;  3QNV A;  3KHZ A;  4A39 A;  3PB9 X;  3NH5 A;  3KR5 A;  2LGR A;  2ZOF A;  1CP6 A;  3FH4 A;  5J1Q A;  4ETK A;  4UML A;  3EJG A;  3IIB A;  4DUK A;  3SIJ A;  4G1P A;  2BO9 A;  5HVH A;  2PJ9 A;  5DUS A;  4P4J A;  3IIF A;  4JGK A;  1FNO A;  3B3W A;  4EFD A;  5CB3 A;  3S9N A;  1LAM A;  4FAI A;  2ZEE A;  1M4L A;  1LAP A;  4ZY0 A;  1XMB A;  2PJ2 A;  2V77 A;  4ZY1 A;  2XD7 A;  1H8L A;  3GB0 A;  1BPN A;  3MN8 A;  4P45 A;  3CPX A;  1FT7 A;  3PBB A;  3SI1 A;  3PB7 X;  4OIW A;  4O23 A;  5FSZ A;  1F2O A;  2AFW A;  3FX6 A;  1DE4 C;  3CDX A;  1KWM A;  4P10 A;  2L8R A;  2HB6 A;  2XEJ A;  3EWP A;  2PJ3 A;  2ZEH A;  2BCO A;  3KAS A;  3RBU A;  4EME A;  2AFX A;  2XEF A;  5LYD A;  2Q43 A;  3BI1 A;  2IQ6 A;  1ARL A;  3IO1 A;  4DYO A;  3SI0 A;  3HLP A;  3PEI A;  2FVG A;  4NJQ A;  1CPS A;  3S9M A;  3K2K A;  1HEE A;  4PXD A;  4X8I A;  2IJZ A;  4MHY A;  4AXV A;  4PXB A;  2GLF A;  1LOK A;  4OP4 A;  1ARM A;  1XJO A;  2QVP A;  2G9D A;  3WC6 A;  3JZT A;  3V7Z A;  2O4H A;  2EK8 A;  4W9Y A;  5LRK A;  4PXC A;  1TXZ A;  2IMO A;  4GUA A;  3L2N A;  3KGQ A;  3PB8 X;  4MHP A;  3BXM A;  3D7H A;  2JBJ A;  5DS0 A;  4LQG A;  2I3C A;  4ZX9 A;  4MCP A;  1ZG8 A;  1LFW A;  4OC1 A;  1QMU A;  1YME A;  4NJR A;  5F09 A;  4D86 A;  1YSJ A;  5HVG A;  2C6C A;  3FJU A;  4F9U A;  2GU2 A;  3GPG A;  3GLJ A;  4ZYQ A;  1PCA A;  7CPA A;  5HIH A;  4GVV A;  1TKF A;  5LYI A;  1SPV A;  3GPO A;  2PRQ A;  4YWY A;  3GPQ A;  2FXK A;  3SIH A;  4OC5 A;  4ZY2 A;  4IK2 A;  5D29 A;  1QQ9 A;  3KZW A;  4MCQ A;  5CPA A;  2Q4Z A;  4FWU A;  3EWQ A;  3FEE A;  4UF4 A;  4ABK A;  4B6Z A;  1ELL P;  5CMS A;  4Z65 A;  4IAV A;  2CIJ A;  3CPA A;  5LYL A;  1ZR5 A;  3PB4 X;  4JLL A;  2CTC A;  4P4D A;  4PXE A;  4J4Z A;  1PYT B;  1YW4 A;  2RB7 A;  3D67 A;  1ZR3 A;  5FSU A;  2EK9 A;  2J9A A;  4F9V A;  4X3R A;  3B3V A;  3NH4 A;  5I4M A;  4A37 A;  4R7M A;  4R8F A;  1BAV A;  2PVV A;  3TX8 A;  4YU9 A;  2PJ7 A;  4UIA A;  5THW A;  1TKH A;  3GUX A;  4TWE A;  1YW6 A;  2ANP A;  4NGR A;  3IEH A;  3TC8 A;  2FG1 A;  2CF4 A;  4K0C A;  5IB9 A;  2C6G A;  5CB5 A;  1Q7L A;  3WAB A;  1Y0Y A;  3V45 A;  1F57 A;  2AFZ A;  3K9T A;  3KL9 A;  2JEW A;  2QJ8 A;  2PCU A;  2ZEF A;  2PJA A;  3NA6 A;  2GLJ A;  4OC4 A;  2WZN A;  3WC5 A;  2GRE A;  2AFC A;  4OKO A;  3V2B A;  5CBM A;  3I1U A;  3PFE A;  1TXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...