1YD9A

1.6a crystal structure of the non-histone domain of the histone variant macroh2a1.1.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
188
structure length
188
Chain Sequence
GFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGSTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGSDKCEELLEKTVKNCLALADDRKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMAKLDAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the histone variant macroH2A
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein
molecule keywords Core histone macro-H2A.1
total genus 61
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1yd9A00
3EWPA 4JLLA 3T8WA 2L8RA 5CBMA 3KR5A 1NJRA 4D86A 3EWOA 5CB3A 1GYTA 4GUAA 4ZX8A 4JCAA 1TY8A 4KSIA 4GVWA 4K0CA 1LANA 5FSVA 4KYBA 4JVVA 3KR4A 4ZY2A 3H8FA 2EWBA 3V45A 4GVVA 3KQXA 5DUSA 4UMLA 3SIIA 1LCPA 4TU0A 4J4ZA 4R6TA 5E3BA 3EWQA 3IIDA 1BLLE 2BFRA 5D8NA 3GQOA 2BFQA 5AILA 3KQZA 3V2BA 1BPNA 3JRUA 3SIJA 5FSYA 3EJGA 4R7MA 4ESSA 3GPQA 2FG1A 5FSXA 4J5RA 1YD9A 1BPMA 2VRIA 3ETIA 1SPVA 1VHUA 2LGRA 2XD7A 3EWRA 3H8EA 3GQEA 4J5QA 3SIGA 2ACFA 3H8GA 1LAPA 5CMSA 5FSZA 4ETJA 3PEIA 3EKEA 3Q71A 3KZWA 3Q6ZA 1HJZA 1ZR5A 2AFCA 3SIHA 2DX6A 3JZTA 4ZY0A 4X2TA 4ZI6A 3GPGA 4ABLA 5FSUA 4ZYQA 2FXKA 4ETKA 4ABKA 4R76A 4IQYA 3EJFA 3GPOA 3VFQA 1LAMA 4JGKA 1TXZA 2EEEA 3EW5A 2X47A 4ZX9A 3IIFA 1ZR3A 5HOLA 4K3NA 4J5SA 4ZY1A 3IJ3A 2FAVA 2J9AA 5HIHA 5CB5A
chains in the Genus database with same CATH superfamily
3EWPA 4JLLA 3T8WA 2L8RA 5CBMA 3KR5A 1NJRA 4D86A 3EWOA 5CB3A 1GYTA 4GUAA 2JZDA 4ZX8A 4JCAA 1TY8A 4KSIA 4GVWA 4K0CA 1LANA 5FSVA 4KYBA 4JVVA 3KR4A 4ZY2A 3H8FA 2EWBA 2KQVA 4GVVA 3KQXA 3V45A 5DUSA 4UMLA 3SIIA 1LCPA 4TU0A 4J4ZA 4R6TA 5E3BA 3EWQA 3IIDA 1BLLE 2BFRA 5D8NA 3GQOA 2BFQA 5AILA 3KQZA 3V2BA 1BPNA 3JRUA 3SIJA 5FSYA 3EJGA 4R7MA 4ESSA 3GPQA 2FG1A 5FSXA 4J5RA 1YD9A 1BPMA 2VRIA 3ETIA 1SPVA 1VHUA 2LGRA 2XD7A 2W2GA 3EWRA 3H8EA 3GQEA 4J5QA 3SIGA 2ACFA 3H8GA 1LAPA 5CMSA 5FSZA 4ETJA 3PEIA 3EKEA 3Q71A 3KZWA 3Q6ZA 1HJZA 1ZR5A 2AFCA 3SIHA 2DX6A 3JZTA 2RNKA 4ZY0A 4X2TA 4ZI6A 3GPGA 2JZFA 4ABLA 5FSUA 4ZYQA 2FXKA 4ETKA 4ABKA 4R76A 4IQYA 3EJFA 3GPOA 3VFQA 1LAMA 4JGKA 2WCTA 1TXZA 2EEEA 3EW5A 2JZEA 2X47A 4ZX9A 3IIFA 1ZR3A 5HOLA 4K3NA 4J5SA 4ZY1A 3IJ3A 2FAVA 2J9AA 5HIHA 5CB5A
chains in the Genus database with same CATH topology
3EWPA 4JLLA 3T8WA 2L8RA 5CBMA 3KR5A 1NJRA 4D86A 3EWOA 5CB3A 1GYTA 4GUAA 4ZX8A 4JCAA 1TY8A 4KSIA 4GVWA 4K0CA 1LANA 5FSVA 4KYBA 4JVVA 3KR4A 4ZY2A 3H8FA 2EWBA 3V45A 4GVVA 3KQXA 5DUSA 4UMLA 3SIIA 1LCPA 4TU0A 4J4ZA 4R6TA 5E3BA 3EWQA 3IIDA 1BLLE 2BFRA 5D8NA 3GQOA 2BFQA 5AILA 3KQZA 3V2BA 1BPNA 3JRUA 3SIJA 5FSYA 3EJGA 4R7MA 4ESSA 3GPQA 2FG1A 5FSXA 4J5RA 1YD9A 1BPMA 2VRIA 3ETIA 1SPVA 1VHUA 2LGRA 2XD7A 3EWRA 3H8EA 3GQEA 4J5QA 3SIGA 2ACFA 3H8GA 1LAPA 5CMSA 5FSZA 4ETJA 3PEIA 3EKEA 3Q71A 3KZWA 3Q6ZA 1HJZA 1ZR5A 2AFCA 3SIHA 2DX6A 3JZTA 4ZY0A 4X2TA 4ZI6A 3GPGA 4ABLA 5FSUA 4ZYQA 2FXKA 4ETKA 4ABKA 4R76A 4IQYA 3EJFA 3GPOA 3VFQA 1LAMA 4JGKA 1TXZA 2EEEA 3EW5A 2X47A 4ZX9A 3IIFA 1ZR3A 5HOLA 4K3NA 4J5SA 4ZY1A 3IJ3A 2FAVA 2J9AA 5HIHA 5CB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWP A;  4JLL A;  3T8W A;  2L8R A;  5CBM A;  3KR5 A;  1NJR A;  4D86 A;  3EWO A;  5CB3 A;  1GYT A;  4GUA A;  4ZX8 A;  4JCA A;  1TY8 A;  4KSI A;  4GVW A;  4K0C A;  1LAN A;  5FSV A;  4KYB A;  4JVV A;  3KR4 A;  4ZY2 A;  3H8F A;  2EWB A;  3V45 A;  4GVV A;  3KQX A;  5DUS A;  4UML A;  3SII A;  1LCP A;  4TU0 A;  4J4Z A;  4R6T A;  5E3B A;  3EWQ A;  3IID A;  1BLL E;  2BFR A;  5D8N A;  3GQO A;  2BFQ A;  5AIL A;  3KQZ A;  3V2B A;  1BPN A;  3JRU A;  3SIJ A;  5FSY A;  3EJG A;  4R7M A;  4ESS A;  3GPQ A;  2FG1 A;  5FSX A;  4J5R A;  1YD9 A;  1BPM A;  2VRI A;  3ETI A;  1SPV A;  1VHU A;  2LGR A;  2XD7 A;  3EWR A;  3H8E A;  3GQE A;  4J5Q A;  3SIG A;  2ACF A;  3H8G A;  1LAP A;  5CMS A;  5FSZ A;  4ETJ A;  3PEI A;  3EKE A;  3Q71 A;  3KZW A;  3Q6Z A;  1HJZ A;  1ZR5 A;  2AFC A;  3SIH A;  2DX6 A;  3JZT A;  4ZY0 A;  4X2T A;  4ZI6 A;  3GPG A;  4ABL A;  5FSU A;  4ZYQ A;  2FXK A;  4ETK A;  4ABK A;  4R76 A;  4IQY A;  3EJF A;  3GPO A;  3VFQ A;  1LAM A;  4JGK A;  1TXZ A;  2EEE A;  3EW5 A;  2X47 A;  4ZX9 A;  3IIF A;  1ZR3 A;  5HOL A;  4K3N A;  4J5S A;  4ZY1 A;  3IJ3 A;  2FAV A;  2J9A A;  5HIH A;  5CB5 A; 
#chains in the Genus database with same CATH topology
 3EWP A;  4JLL A;  3T8W A;  2L8R A;  5CBM A;  3KR5 A;  1NJR A;  4D86 A;  3EWO A;  5CB3 A;  1GYT A;  4GUA A;  2JZD A;  4ZX8 A;  4JCA A;  1TY8 A;  4KSI A;  4GVW A;  4K0C A;  1LAN A;  5FSV A;  4KYB A;  4JVV A;  3KR4 A;  4ZY2 A;  3H8F A;  2EWB A;  2KQV A;  4GVV A;  3KQX A;  3V45 A;  5DUS A;  4UML A;  3SII A;  1LCP A;  4TU0 A;  4J4Z A;  4R6T A;  5E3B A;  3EWQ A;  3IID A;  1BLL E;  2BFR A;  5D8N A;  3GQO A;  2BFQ A;  5AIL A;  3KQZ A;  3V2B A;  1BPN A;  3JRU A;  3SIJ A;  5FSY A;  3EJG A;  4R7M A;  4ESS A;  3GPQ A;  2FG1 A;  5FSX A;  4J5R A;  1YD9 A;  1BPM A;  2VRI A;  3ETI A;  1SPV A;  1VHU A;  2LGR A;  2XD7 A;  2W2G A;  3EWR A;  3H8E A;  3GQE A;  4J5Q A;  3SIG A;  2ACF A;  3H8G A;  1LAP A;  5CMS A;  5FSZ A;  4ETJ A;  3PEI A;  3EKE A;  3Q71 A;  3KZW A;  3Q6Z A;  1HJZ A;  1ZR5 A;  2AFC A;  3SIH A;  2DX6 A;  3JZT A;  2RNK A;  4ZY0 A;  4X2T A;  4ZI6 A;  3GPG A;  2JZF A;  4ABL A;  5FSU A;  4ZYQ A;  2FXK A;  4ETK A;  4ABK A;  4R76 A;  4IQY A;  3EJF A;  3GPO A;  3VFQ A;  1LAM A;  4JGK A;  2WCT A;  1TXZ A;  2EEE A;  3EW5 A;  2JZE A;  2X47 A;  4ZX9 A;  3IIF A;  1ZR3 A;  5HOL A;  4K3N A;  4J5S A;  4ZY1 A;  3IJ3 A;  2FAV A;  2J9A A;  5HIH A;  5CB5 A; 
#chains in the Genus database with same CATH homology
 3EWP A;  4JLL A;  3T8W A;  2L8R A;  5CBM A;  3KR5 A;  1NJR A;  4D86 A;  3EWO A;  5CB3 A;  1GYT A;  4GUA A;  4ZX8 A;  4JCA A;  1TY8 A;  4KSI A;  4GVW A;  4K0C A;  1LAN A;  5FSV A;  4KYB A;  4JVV A;  3KR4 A;  4ZY2 A;  3H8F A;  2EWB A;  3V45 A;  4GVV A;  3KQX A;  5DUS A;  4UML A;  3SII A;  1LCP A;  4TU0 A;  4J4Z A;  4R6T A;  5E3B A;  3EWQ A;  3IID A;  1BLL E;  2BFR A;  5D8N A;  3GQO A;  2BFQ A;  5AIL A;  3KQZ A;  3V2B A;  1BPN A;  3JRU A;  3SIJ A;  5FSY A;  3EJG A;  4R7M A;  4ESS A;  3GPQ A;  2FG1 A;  5FSX A;  4J5R A;  1YD9 A;  1BPM A;  2VRI A;  3ETI A;  1SPV A;  1VHU A;  2LGR A;  2XD7 A;  3EWR A;  3H8E A;  3GQE A;  4J5Q A;  3SIG A;  2ACF A;  3H8G A;  1LAP A;  5CMS A;  5FSZ A;  4ETJ A;  3PEI A;  3EKE A;  3Q71 A;  3KZW A;  3Q6Z A;  1HJZ A;  1ZR5 A;  2AFC A;  3SIH A;  2DX6 A;  3JZT A;  4ZY0 A;  4X2T A;  4ZI6 A;  3GPG A;  4ABL A;  5FSU A;  4ZYQ A;  2FXK A;  4ETK A;  4ABK A;  4R76 A;  4IQY A;  3EJF A;  3GPO A;  3VFQ A;  1LAM A;  4JGK A;  1TXZ A;  2EEE A;  3EW5 A;  2X47 A;  4ZX9 A;  3IIF A;  1ZR3 A;  5HOL A;  4K3N A;  4J5S A;  4ZY1 A;  3IJ3 A;  2FAV A;  2J9A A;  5HIH A;  5CB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...